Advanced Search (OLGA)

Gene: NANP (N-acetylneuraminic acid phosphatase) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

NANP

Name:

N-acetylneuraminic acid phosphatase

RGD ID:

1345004

HGNC Page

HGNC:16140

Description:

Enables N-acylneuraminate-9-phosphatase activity. Involved in CMP-N-acetylneuraminate biosynthetic process; N-acetylneuraminate biosynthetic process; and glycosylation. Predicted to be active in cytosol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C20orf147; dJ694B14.3; haloacid dehalogenase-like hydrolase domain containing 4; haloacid dehalogenase-like hydrolase domain-containing protein 4; HDHD4; MGC26833; N-acylneuraminate-9-phosphatase; Neu5Ac-9-Pase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

LOC100128407 LOC100130747 LOC100271656

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	25,612,935 - 25,624,014 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	25,612,935 - 25,624,014 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	25,593,571 - 25,604,650 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	25,543,001 - 25,552,614 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	25,543,001 - 25,552,614	NCBI
Celera	20	25,667,188 - 25,678,265 (-)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	25,551,390 - 25,562,466 (-)	NCBI		HuRef
CHM1_1	20	25,593,809 - 25,604,886 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	25,678,481 - 25,689,560 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	1,2-dimethylhydrazine	decreases expression	ISO	Nanp (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of NANP mRNA	CTD	PMID:22206623
NANP	Human	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of NANP mRNA	CTD	PMID:31614463
NANP	Human	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of NANP mRNA	CTD	PMID:26232522 and PMID:33387578
NANP	Human	2,4-D	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
NANP	Human	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	Nanp (Mus musculus)	6480464	3 more ...	CTD	PMID:19467301
NANP	Human	3-chloropropane-1,2-diol	increases expression	ISO	Nanp (Rattus norvegicus)	6480464	alpha-Chlorohydrin results in increased expression of NANP protein	CTD	PMID:34915118
NANP	Human	4-aminobenzhydrazide	multiple interactions	EXP		6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of NANP mRNA]	CTD	PMID:24530881
NANP	Human	4-hydroxyphenyl retinamide	increases expression	ISO	Nanp (Mus musculus)	6480464	Fenretinide results in increased expression of NANP mRNA	CTD	PMID:28973697
NANP	Human	aflatoxin B1	increases methylation	EXP		6480464	Aflatoxin B1 results in increased methylation of NANP intron	CTD	PMID:30157460
NANP	Human	aldehydo-D-glucose	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
NANP	Human	arsenous acid	multiple interactions	EXP		6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NANP protein]	CTD	PMID:26598702
NANP	Human	benzene-1,2,4-triol	multiple interactions	EXP		6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of NANP mRNA]	CTD	PMID:24530881
NANP	Human	benzene-1,2,4-triol	decreases expression	EXP		6480464	hydroxyhydroquinone results in decreased expression of NANP mRNA	CTD	PMID:24530881
NANP	Human	benzo[a]pyrene	affects methylation	EXP		6480464	Benzo(a)pyrene affects the methylation of NANP intron	CTD	PMID:30157460
NANP	Human	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of NANP mRNA	CTD	PMID:32234424
NANP	Human	benzo[a]pyrene diol epoxide I	decreases expression	EXP		6480464	7 more ...	CTD	PMID:20382639
NANP	Human	benzo[e]pyrene	increases methylation	EXP		6480464	benzo(e)pyrene results in increased methylation of NANP intron	CTD	PMID:30157460
NANP	Human	cadmium dichloride	decreases expression	EXP		6480464	Cadmium Chloride results in decreased expression of NANP mRNA	CTD	PMID:38568856
NANP	Human	calcium silicate	decreases expression	ISO	Nanp (Mus musculus)	6480464	calcium silicate results in decreased expression of NANP mRNA	CTD	PMID:29279043
NANP	Human	choline	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
NANP	Human	cisplatin	multiple interactions	EXP		6480464	[Cisplatin co-treated with jinfukang] results in increased expression of NANP mRNA	CTD	PMID:27392435
NANP	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of NANP mRNA	CTD	PMID:27392435
NANP	Human	copper(II) sulfate	decreases expression	EXP		6480464	Copper Sulfate results in decreased expression of NANP mRNA	CTD	PMID:19549813
NANP	Human	coumestrol	increases expression	EXP		6480464	Coumestrol results in increased expression of NANP mRNA	CTD	PMID:19167446
NANP	Human	crocidolite asbestos	decreases expression	ISO	Nanp (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of NANP mRNA	CTD	PMID:29279043
NANP	Human	cypermethrin	decreases expression	ISO	Nanp (Mus musculus)	6480464	cypermethrin results in decreased expression of NANP mRNA	CTD	PMID:29020013
NANP	Human	D-glucose	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
NANP	Human	diarsenic trioxide	multiple interactions	EXP		6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NANP protein]	CTD	PMID:26598702
NANP	Human	Dibutyl phosphate	affects expression	EXP		6480464	di-n-butylphosphoric acid affects the expression of NANP mRNA	CTD	PMID:37042841
NANP	Human	dibutyl phthalate	decreases expression	ISO	Nanp (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of NANP mRNA	CTD	PMID:21266533
NANP	Human	dorsomorphin	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
NANP	Human	flutamide	increases expression	ISO	Nanp (Rattus norvegicus)	6480464	Flutamide results in increased expression of NANP mRNA	CTD	PMID:24136188
NANP	Human	folic acid	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
NANP	Human	formaldehyde	decreases expression	EXP		6480464	Formaldehyde results in decreased expression of NANP mRNA	CTD	PMID:20655997
NANP	Human	fructose	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
NANP	Human	gentamycin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of NANP mRNA	CTD	PMID:33387578
NANP	Human	glucose	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
NANP	Human	hydrogen peroxide	affects expression	EXP		6480464	Hydrogen Peroxide affects the expression of NANP mRNA	CTD	PMID:20044591
NANP	Human	L-methionine	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
NANP	Human	methapyrilene	increases methylation	EXP		6480464	Methapyrilene results in increased methylation of NANP intron	CTD	PMID:30157460
NANP	Human	nickel sulfate	decreases expression	EXP		6480464	nickel sulfate results in decreased expression of NANP mRNA	CTD	PMID:22714537
NANP	Human	oxaliplatin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	oxaliplatin results in decreased expression of NANP mRNA	CTD	PMID:25729387
NANP	Human	oxaliplatin	multiple interactions	ISO	Nanp (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NANP mRNA	CTD	PMID:25729387
NANP	Human	ozone	multiple interactions	ISO	Nanp (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NANP mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NANP mRNA	CTD	PMID:34911549
NANP	Human	SB 431542	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
NANP	Human	silicon dioxide	decreases expression	ISO	Nanp (Mus musculus)	6480464	Silicon Dioxide results in decreased expression of NANP mRNA	CTD	PMID:19073995 and PMID:33720480
NANP	Human	silver atom	decreases expression	EXP		6480464	Silver results in decreased expression of NANP mRNA	CTD	PMID:26014281
NANP	Human	silver(0)	decreases expression	EXP		6480464	Silver results in decreased expression of NANP mRNA	CTD	PMID:26014281
NANP	Human	sodium arsenite	decreases expression	EXP		6480464	sodium arsenite results in decreased expression of NANP mRNA	CTD	PMID:22714537 and PMID:38568856
NANP	Human	sunitinib	increases expression	EXP		6480464	Sunitinib results in increased expression of NANP mRNA	CTD	PMID:31533062
NANP	Human	thioacetamide	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of NANP mRNA	CTD	PMID:34492290
NANP	Human	titanium dioxide	decreases expression	ISO	Nanp (Mus musculus)	6480464	titanium dioxide results in decreased expression of NANP mRNA	CTD	PMID:29264374
NANP	Human	titanium dioxide	decreases methylation	ISO	Nanp (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NANP gene	CTD	PMID:35295148
NANP	Human	topotecan	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Topotecan results in decreased expression of NANP mRNA	CTD	PMID:25729387
NANP	Human	topotecan	multiple interactions	ISO	Nanp (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NANP mRNA	CTD	PMID:25729387
NANP	Human	triphenyl phosphate	affects expression	EXP		6480464	triphenyl phosphate affects the expression of NANP mRNA	CTD	PMID:37042841
NANP	Human	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of NANP gene	CTD	PMID:29154799
NANP	Human	valproic acid	multiple interactions	EXP		6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
NANP	Human	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of NANP mRNA	CTD	PMID:23179753 more ...
NANP	Human	valproic acid	affects expression	EXP		6480464	Valproic Acid affects the expression of NANP mRNA	CTD	PMID:25979313
NANP	Human	vinclozolin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	vinclozolin results in decreased expression of NANP mRNA	CTD	PMID:20566332

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	CMP-N-acetylneuraminate biosynthetic process	involved_in	IMP		150520179	PMID:31121216	FlyBase	PMID:31121216
NANP	Human	CMP-N-acetylneuraminate biosynthetic process	involved_in	IEA	UniProtKB:Q9CPT3 and ensembl:ENSMUSP00000063895	150520179		Ensembl	GO_REF:0000107
NANP	Human	glycosylation	involved_in	IMP		150520179	PMID:31121216	FlyBase	PMID:31121216
NANP	Human	N-acetylglucosamine biosynthetic process	involved_in	IEA	UniPathway:UPA00630	150520179		UniProt	GO_REF:0000041
NANP	Human	N-acetylneuraminate biosynthetic process	involved_in	IBA	PANTHER:PTN000977427 more ...	150520179		GO_Central	GO_REF:0000033
NANP	Human	N-acetylneuraminate biosynthetic process	involved_in	IDA		150520179	PMID:16237198	UniProt	PMID:16237198
NANP	Human	N-acetylneuraminate metabolic process	involved_in	IEA	UniProtKB:Q9CPT3 and ensembl:ENSMUSP00000063895	150520179		Ensembl	GO_REF:0000107
NANP	Human	small molecule biosynthetic process	involved_in	IEA	ARBA:ARBA00028534	150520179		UniProt	GO_REF:0000117

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	cytosol	is_active_in	ISO	Nanp (Rattus norvegicus)	9068941	PMID:6093772	FlyBase	PMID:6093772 and REF_RGD_ID:407430002
NANP	Human	cytosol	located_in	TAS		150520179		Reactome	Reactome:R-HSA-4084989

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
NANP	Human	hydrolase activity	enables	IEA	InterPro:IPR011950	150520179		InterPro	GO_REF:0000002
NANP	Human	N-acylneuraminate-9-phosphatase activity	enables	IBA	PANTHER:PTN000977427 more ...	150520179		GO_Central	GO_REF:0000033
NANP	Human	N-acylneuraminate-9-phosphatase activity	enables	IDA		150520179	PMID:16237198 and PMID:23747226	UniProt	PMID:16237198 and PMID:23747226
NANP	Human	N-acylneuraminate-9-phosphatase activity	enables	IEA	EC:3.1.3.29	150520179		UniProt	GO_REF:0000003
NANP	Human	phosphatase activity	enables	IEA	ARBA:ARBA00026393	150520179		UniProt	GO_REF:0000117

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	amino sugar metabolic pathway		EXP		10402751		SMPDB	SMP:00045
NANP	Human	french type sialuria pathway		EXP		10402751		SMPDB	SMP:00216
NANP	Human	french type sialuria pathway		EXP		10402751		SMPDB	SMP:00217
NANP	Human	sialic acid storage disease pathway		EXP		10402751		SMPDB	SMP:00240
NANP	Human	Tay-Sachs disease pathway		EXP		10402751		SMPDB	SMP:00390

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
NANP	Human	amino sugar metabolic pathway		IEA		6907045		KEGG	hsa:00520
NANP	Human	nucleotide sugar metabolic pathway		IEA		6907045		KEGG	hsa:00520

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:11780052	PMID:12477932	PMID:14702039	PMID:15489334	PMID:16237198	PMID:16344560	PMID:17207965	PMID:21873635	PMID:23747226	PMID:23824909	PMID:26344197
PMID:26496610	PMID:28775156	PMID:31121216	PMID:31586073	PMID:32687490	PMID:33916271	PMID:34079125	PMID:34597346	PMID:35831314	PMID:37827155	PMID:38943005

NANP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	25,612,935 - 25,624,014 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	25,612,935 - 25,624,014 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	25,593,571 - 25,604,650 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	25,543,001 - 25,552,614 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	25,543,001 - 25,552,614	NCBI
Celera	20	25,667,188 - 25,678,265 (-)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	25,551,390 - 25,562,466 (-)	NCBI		HuRef
CHM1_1	20	25,593,809 - 25,604,886 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	25,678,481 - 25,689,560 (-)	NCBI		T2T-CHM13v2.0

Nanp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	150,871,605 - 150,881,299 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	150,871,605 - 150,881,318 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	151,029,685 - 151,039,379 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	151,029,685 - 151,039,398 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	150,855,421 - 150,865,115 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	150,721,138 - 150,730,796 (-)	NCBI		MGSCv36	mm8
Celera	2	152,263,425 - 152,273,317 (-)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

Nanp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,289,269 - 160,302,001 (-)	NCBI		GRCr8
mRatBN7.2	3	139,826,549 - 139,841,655 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,826,549 - 139,841,648 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,725,380 - 143,738,147 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,309,149 - 152,321,917 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,057,374 - 150,070,106 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,800,018 - 146,812,988 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,800,019 - 146,812,989 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,160,644 - 153,173,614 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,639,178 - 141,651,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,544,751 - 141,557,483 (-)	NCBI
Celera	3	138,589,564 - 138,602,296 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

Nanp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,453,393 - 31,460,386 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,453,393 - 31,460,147 (-)	NCBI	ChiLan1.0	ChiLan1.0

NANP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	26,497,333 - 26,507,875 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	26,494,167 - 26,504,699 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	25,566,464 - 25,576,960 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	25,970,274 - 25,981,685 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	25,970,274 - 25,981,685 (-)	Ensembl	panpan1.1		panPan2

NANP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	1,757,963 - 1,776,758 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	1,788,489 - 1,807,300 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	1,999,374 - 2,018,194 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	2,001,001 - 2,018,134 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	1,840,190 - 1,858,994 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	1,964,897 - 1,983,691 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	1,932,577 - 1,951,375 (-)	NCBI		UU_Cfam_GSD_1.0

Nanp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	146,814,474 - 146,825,293 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936620	234,964 - 246,803 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936620	235,013 - 245,138 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NANP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	31,208,181 - 31,217,310 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	31,206,265 - 31,217,366 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	35,137,366 - 35,147,715 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103247037
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666124	54,355 - 64,917 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nanp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624939	41,567 - 51,634 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624939	41,154 - 47,608 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in NANP
13 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 20p13-11.21(chr20:89939-25697564)x3	copy number gain	See cases [RCV000051227]	Chr20:89939..25697564 [GRCh38] Chr20:70580..25678200 [GRCh37] Chr20:18580..25626200 [NCBI36] Chr20:20p13-11.21	pathogenic
GRCh38/hg38 20p12.2-q12(chr20:9811433-39316956)x3	copy number gain	See cases [RCV000052999]	Chr20:9811433..39316956 [GRCh38] Chr20:9792081..37945599 [GRCh37] Chr20:9740081..37379013 [NCBI36] Chr20:20p12.2-q12	pathogenic
GRCh38/hg38 20p11.22-q11.1(chr20:22061586-30285812)x3	copy number gain	See cases [RCV000053000]	Chr20:22061586..30285812 [GRCh38] Chr20:22042224..29520488 [GRCh37] Chr20:21990224..28134149 [NCBI36] Chr20:20p11.22-q11.1	pathogenic
GRCh38/hg38 20p13-q11.1(chr20:80106-30227427)x3	copy number gain	See cases [RCV000133996]	Chr20:80106..30227427 [GRCh38] Chr20:60747..29462103 [GRCh37] Chr20:8747..28075764 [NCBI36] Chr20:20p13-q11.1	pathogenic
GRCh38/hg38 20p13-q13.33(chr20:99557-64277321)x3	copy number gain	See cases [RCV000135859]	Chr20:99557..64277321 [GRCh38] Chr20:80198..62908674 [GRCh37] Chr20:28198..62379118 [NCBI36] Chr20:20p13-q13.33	pathogenic
GRCh38/hg38 20p13-11.1(chr20:80927-26324843)x3	copy number gain	See cases [RCV000142017]	Chr20:80927..26324843 [GRCh38] Chr20:61568..26305479 [GRCh37] Chr20:9568..26253479 [NCBI36] Chr20:20p13-11.1	pathogenic
GRCh38/hg38 20p11.21(chr20:25031679-25625520)x3	copy number gain	See cases [RCV000143540]	Chr20:25031679..25625520 [GRCh38] Chr20:25012315..25606156 [GRCh37] Chr20:24960315..25554156 [NCBI36] Chr20:20p11.21	uncertain significance
GRCh37/hg19 20p11.21-11.1(chr20:25039251-26067042)x3	copy number gain	See cases [RCV000240131]	Chr20:25039251..26067042 [GRCh37] Chr20:20p11.21-11.1	uncertain significance
GRCh37/hg19 20p13-11.1(chr20:80198-26075841)x3	copy number gain	See cases [RCV000239954]	Chr20:80198..26075841 [GRCh37] Chr20:20p13-11.1	pathogenic
GRCh37/hg19 20p12.1-q11.21(chr20:17705775-31600738)x3	copy number gain	See cases [RCV000240436]	Chr20:17705775..31600738 [GRCh37] Chr20:20p12.1-q11.21	pathogenic
GRCh37/hg19 20p11.21-11.1(chr20:25506885-25732554)x3	copy number gain	not provided [RCV000584939]	Chr20:25506885..25732554 [GRCh37] Chr20:20p11.21-11.1	likely benign
GRCh37/hg19 20p11.21-q11.21(chr20:24162775-31820857)x3	copy number gain	See cases [RCV000448977]	Chr20:24162775..31820857 [GRCh37] Chr20:20p11.21-q11.21	likely pathogenic
GRCh37/hg19 20p13-q11.21(chr20:80198-26208081)x3	copy number gain	not provided [RCV000487461]	Chr20:80198..26208081 [GRCh37] Chr20:20p13-q11.21	pathogenic
GRCh37/hg19 20p11.23-11.1(chr20:18500917-25847320)x1	copy number loss	See cases [RCV000510621]	Chr20:18500917..25847320 [GRCh37] Chr20:20p11.23-11.1	pathogenic
GRCh37/hg19 20p13-q13.33(chr20:61569-62915555)x3	copy number gain	See cases [RCV000510832]	Chr20:61569..62915555 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p11.21-q11.21(chr20:24876569-30494851)x3	copy number gain	See cases [RCV000512500]	Chr20:24876569..30494851 [GRCh37] Chr20:20p11.21-q11.21	uncertain significance
GRCh37/hg19 20p13-q13.33(chr20:61569-62915555)	copy number gain	See cases [RCV000512450]	Chr20:61569..62915555 [GRCh37] Chr20:20p13-q13.33	pathogenic
Single allele	duplication	not provided [RCV000677978]	Chr20:17705775..31600738 [GRCh37] Chr20:20p12.1-q11.21	pathogenic
GRCh37/hg19 20p13-q13.33(chr20:63244-62961294)x3	copy number gain	not provided [RCV000741059]	Chr20:63244..62961294 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p11.21-11.1(chr20:25402778-25635327)x1	copy number loss	not provided [RCV000741158]	Chr20:25402778..25635327 [GRCh37] Chr20:20p11.21-11.1	benign
GRCh37/hg19 20p13-q13.33(chr20:63244-62912463)x3	copy number gain	not provided [RCV000741057]	Chr20:63244..62912463 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p13-q13.33(chr20:63244-62948788)x3	copy number gain	not provided [RCV000741058]	Chr20:63244..62948788 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p11.21-11.1(chr20:25496752-25657484)x1	copy number loss	not provided [RCV000848755]	Chr20:25496752..25657484 [GRCh37] Chr20:20p11.21-11.1	uncertain significance
GRCh37/hg19 20p11.21-11.1(chr20:25496752-25657484)x1	copy number loss	not provided [RCV000848756]	Chr20:25496752..25657484 [GRCh37] Chr20:20p11.21-11.1	uncertain significance
GRCh37/hg19 20p13-11.1(chr20:61568-26305479)x3	copy number gain	not provided [RCV001007068]	Chr20:61568..26305479 [GRCh37] Chr20:20p13-11.1	pathogenic
GRCh37/hg19 20p11.23-q11.21(chr20:19750804-30479077)x3	copy number gain	not provided [RCV001258738]	Chr20:19750804..30479077 [GRCh37] Chr20:20p11.23-q11.21	likely pathogenic
GRCh37/hg19 20p11.21-11.1(chr20:25388830-25635771)x1	copy number loss	not provided [RCV001258737]	Chr20:25388830..25635771 [GRCh37] Chr20:20p11.21-11.1	uncertain significance
GRCh37/hg19 20p11.21-q11.22(chr20:25442597-33761550)	copy number gain	not specified [RCV002052709]	Chr20:25442597..33761550 [GRCh37] Chr20:20p11.21-q11.22	pathogenic
GRCh37/hg19 20p11.23-q11.22(chr20:18665879-33903216)x3	copy number gain	not provided [RCV001829151]	Chr20:18665879..33903216 [GRCh37] Chr20:20p11.23-q11.22	likely pathogenic
GRCh37/hg19 20p11.21-q11.21(chr20:24162775-31820857)	copy number gain	not specified [RCV002052707]	Chr20:24162775..31820857 [GRCh37] Chr20:20p11.21-q11.21	likely pathogenic
GRCh37/hg19 20p11.21-11.1(chr20:25208244-25734692)x3	copy number gain	not provided [RCV002475837]	Chr20:25208244..25734692 [GRCh37] Chr20:20p11.21-11.1	uncertain significance
NM_152667.3(NANP):c.482G>A (p.Arg161Lys)	single nucleotide variant	not specified [RCV004146295]	Chr20:25616190 [GRCh38] Chr20:25596826 [GRCh37] Chr20:20p11.21	likely benign
NM_152667.3(NANP):c.65G>A (p.Gly22Glu)	single nucleotide variant	not specified [RCV004203881]	Chr20:25623884 [GRCh38] Chr20:25604520 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.532G>A (p.Gly178Arg)	single nucleotide variant	not specified [RCV004232741]	Chr20:25616140 [GRCh38] Chr20:25596776 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.139A>C (p.Ile47Leu)	single nucleotide variant	not specified [RCV004203237]	Chr20:25616533 [GRCh38] Chr20:25597169 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.311G>A (p.Arg104His)	single nucleotide variant	not specified [RCV004283087]	Chr20:25616361 [GRCh38] Chr20:25596997 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.608T>G (p.Leu203Trp)	single nucleotide variant	not specified [RCV004474103]	Chr20:25616064 [GRCh38] Chr20:25596700 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.226T>G (p.Trp76Gly)	single nucleotide variant	not specified [RCV004652281]	Chr20:25616446 [GRCh38] Chr20:25597082 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.587A>T (p.Gln196Leu)	single nucleotide variant	not specified [RCV004641173]	Chr20:25616085 [GRCh38] Chr20:25596721 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.194A>G (p.Asn65Ser)	single nucleotide variant	not specified [RCV004834055]	Chr20:25616478 [GRCh38] Chr20:25597114 [GRCh37] Chr20:20p11.21	likely benign
NM_152667.3(NANP):c.662C>T (p.Pro221Leu)	single nucleotide variant	not specified [RCV004834056]	Chr20:25616010 [GRCh38] Chr20:25596646 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.677T>C (p.Met226Thr)	single nucleotide variant	not specified [RCV004834058]	Chr20:25615995 [GRCh38] Chr20:25596631 [GRCh37] Chr20:20p11.21	uncertain significance
NM_152667.3(NANP):c.19C>T (p.Arg7Trp)	single nucleotide variant	not specified [RCV004834057]	Chr20:25623930 [GRCh38] Chr20:25604566 [GRCh37] Chr20:20p11.21	uncertain significance

Predicted Target Of

	Summary Value
Count of predictions:	1067
Count of miRNA genes:	716
Interacting mature miRNAs:	795
Transcripts:	ENST00000304788
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597253122	GWAS1349196_H	psychotic symptoms QTL GWAS1349196 (human)		0.000006	psychotic symptoms		20	25620824	25620825	Human

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system
1204	2431	2788	2245	4942	1723	2345	4	622	1945	464	2268	7278	6451	51	3708	847	1731	1612	171


RefSeq Transcripts	NM_152667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI693731	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK055472	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK074335	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL031673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL833116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC003415	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC022552	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CF126993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DA858639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000304788 ⟹ ENSP00000302441

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	20	25,612,935 - 25,624,014 (-)	Ensembl

RefSeq Acc Id:

NM_152667 ⟹ NP_689880

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	25,612,935 - 25,624,014 (-)	NCBI
GRCh37	20	25,593,571 - 25,604,648 (-)	RGD
Build 36	20	25,543,001 - 25,552,614 (-)	NCBI Archive
Celera	20	25,667,188 - 25,678,265 (-)	RGD
HuRef	20	25,551,390 - 25,562,466 (-)	ENTREZGENE
CHM1_1	20	25,593,809 - 25,604,886 (-)	NCBI
T2T-CHM13v2.0	20	25,678,481 - 25,689,560 (-)	NCBI

Sequence:

show sequence

GCAGTCCGCCTTGCGCATGCGCAGGCGGCGGTGGCAAGGCTACGGTTCGCGCCAGCGGCCGGCGCTATGGGGCTGAGCCGCGTGCGGGCGGTTTTCTTTGACTTGGACAACACTCTCATCGACACGGC
CGGGGCGAGCAGGAGAGGCATGTTGGAGGTGATAAAACTCTTACAATCAAAATACCATTATAAAGAAGAGGCTGAAATCATCTGTGATAAAGTTCAAGTTAAACTCAGCAAGGAATGTTTTCATCCTT
ACAATACATGCATTACTGATTTAAGGACTTCACATTGGGAAGAAGCAATCCAGGAAACAAAAGGTGGTGCAGCCAATAGAAAATTGGCTGAAGAATGTTATTTCCTTTGGAAATCTACACGTTTACAG
CATATGACACTAGCAGAAGACGTCAAAGCCATGCTTACTGAACTTCGAAAGGAGGTCCGCCTACTTCTATTAACGAATGGGGACAGACAGACCCAGAGGGAGAAGATTGAGGCTTGTGCCTGTCAGTC
CTATTTTGACGCTGTTGTTGTAGGTGGAGAGCAGAGAGAGGAGAAACCAGCACCGTCCATATTTTATTACTGCTGCAATCTTCTCGGAGTACAACCTGGGGACTGTGTGATGGTCGGTGACACATTAG
AAACCGACATCCAAGGAGGCCTCAATGCAGGATTGAAAGCAACAGTCTGGATCAATAAAAATGGAATAGTGCCACTGAAGTCCTCCCCAGTTCCGCATTACATGGTTTCTTCTGTGCTAGAGTTACCT
GCTCTCTTACAAAGTATAGACTGCAAAGTCAGTATGTCCACTTAAAGCACATAAAAGGGCATGATTATGAATGTTAGAATCAATTTGCTGAGTATGAAATAAGAAAAGTTAGGGCACTCCACTTATGA
TAATCCAGCTCTAAGAATAATTTTACTTATGATTTAATGGCCAATATTTTGAAGGTCTTCCCAACCCTATTGCTTCTAAGTTGTAACAACCAACCATTGAGTGGTACTTATATCTGAAAATTCAGATT
GCATGAATTCAGGTCAGTAGTATAGCCCAGAAAATTTAAGGAAATATATTATTTGTTAGTCTGTATCTGGAGCTTTTTAAAATTATGTTATTAATCTTTTAGTATCTTGGCTGCATAATGCCAAGCAG
GATTGCTTTACACATGGATGCACAAATGTAAGGTTTATCTTCTGGCTTAAAAATAGATATTTTTAAAAAATAGATTTTCTAAAACACAGATTTATGAAAGCAAGTGAATCTGGTTAATATGAAATAAG
TACTAAGTCACATGCAAATCAAGGTATTATATAGTGAAATTATTTTGCATATTTTGAAAACATAAACCATAGTTTTTGCCTACTTTGGATGTATACTTTCTTTTATGAACCTGATTTTTCTGTATGAC
ATTTTTTTTTTTTTCAGAGGGCAGGGAGCAATTTTTCTATGGCATGTGACAGATTCCTCCAGTTAGAAAAAGCTGTTAAAATCAACACATGGTGCTCCTTTACCGTGACATTTTCTCACCTGTGCACA
GTGAGCCGGTAGCTTCCTTTTAGTCTTCACCTCTCAAGGAAATGTTTTTACTGTCTTTTCCCAGACACACAGTGGGGTTGAGGGAGCTAGGCTGTTTTGCTAGAGATAATTGCAAGGCACGTGGCACT
AAAAGTCATTTTTCTTCTGTGGATCCATAAGAGGAACATTTCCTCAGTGTAGCCTAACAATGCAGCCCCCAATCTGTTCCTTTTTTTTTTTGAAATGGGATCTCTGTCGCCCAGGTTGGAGTGCCATG
GCACCATCTCGGCTCACTGCAACCTCTGCCTCCTGAGCTCAAGTGATCCTCCCACCTCAGCCTCCCAAGGGTGTGTGTGACTACAAGTACACACTACCACGCCCAGCTAATGTGTGTTTTTGTAGAGA
TGGGATTTTGCCATGTTGCCCAGGCTGGTCTCGAATTCCTGGATTCAAGTGATCCTCCCACCTCAGCCTCCTAAAGTCCTAGGATTATAGGCATGAGCCACTGTGCCTGGCCCCCTCATCTGATAGAA
AATTAGATTTTGCTATGAGCCATTTCCTGAGGGCCAATTTAATACTCGTGTGACTCTTCTTAGAGTTACCATCTGCCTTAAATTTCCTCTGTTTTTCACATTCTTGGAAATATATCATTGTTTTGCAA
ATTTCTATATCTAATTCAGGGTTTACCAGGAGCTTAATAATTAATGGCTACATAGCAAGGCATCGTCTTGGAACCGGAGAATTTTCTCTAGACTATTAGGCTAGACAGTCTCATGATTATACTAACCA
AACCTGGAGTAAAGTGGTTGAAAAAAAAGAAAGTATAAAGGGGCTTATTAAAGTGGTTAATAAATATGATTTAGGTTGGTTTTTGATATGTTTTTCTTCCAACTGTTATATAAGAAACTACTAATGTA
AAATAGTAGGCTATATGTTGGGATGTGTATAGCTATGTCTTCAAGACTAATACTCAGAGAATCAAATTGTAGATTGTACCTATCTGTGAGCCTATTTCTTTAGCCAGTTTTCTGTCTACTGCCAAGAA
ACAGAATTCTCTGCCTCATGCAAATGCCCTTTCGTGTTTACTTTTCGCTCTAGATTTTTAAAAATGTGATTGTGCCCTTGACTGTACCAAAGTGCTGTTGCTATAACAGTGAACATTTGTGAACAGAG
GATGTTTGTAGTTTCAAATGCAGTACCCATATGACCTTGATCATATTTTAGCTATTTAAAAATTAAGTTGGAGGATTTTGGCAGAAGTAGTCACATGCATGATTGCTCTGATAGATTGGTTGGCGTGT
GCTGCAGGGGGCTTGTCCTTTTAACTCTCCCACAGGATGGATGTAGGCAGTGTCACATTCATTATGCTGAGAGTGAAGGTTCATCACTCCTGTATCATGGTAGCAAATCTCAACAGGATAGCTTCTAG
GATGTTAAGTGAGCAGTTCTCCAGCAGAAATGATGTAGAAGGAAAAAATTGAATAATTAAATTTCCTTGTCTTCACAGTTTGTATTCTACAGAGTACAGTAATGTATTACATTCCATTTGCACCCTTC
CTTAGGGAAGAACTTTGTGGTTATCTACCTTCTGAGTGGAATGTTACAGAAAATATTTTAAAATATTGGAATAAACCTATGATTTTATTAATATTTTTTGTTTTAGAATAATATTCCTTAAAATTATG
GGTGATGTTTTGTCATCTTTATTTTTTTTCAAAGTTTCCCTGTAGTGGCCTTCTCACACAAAGCCAGAGGCCCTCCCTAACACTGCTTACAGAGGTGGGCCTAGAACAGACATGAATGGACACTGCAC
CTGGAATACCAGCACCTGGTGGGGAGGTTTGGTTCCATGTGCACCTCCACATACAAGGCACGAACATCTCAGATCTGGGAGTGCCCAGGACCCAGTGGATGCTCAGTATTGTAGGAAAGCAGGTCTTT
ACCAAAGTTCTTGGTTTATTGCTTTCAAACTTCTTTGCAACCTTCAGTAAGAAACATTTTCTATCATAACCTCTTTAACACATTTATAGTGTTAGATAACACTGTAACTATATATAAATATAAATATA
ACACATGTATATAAATAAATATAAATATAACATTTTATAGTATAACATTAATATGTGTATGGGATCCAGTTTTATATGTTTAATTTTCATAAAACATTCTTGTTACGTGTGATGATATTTTTCATTCC
ATTCTTTTTTGAATTAGGGAATATATTCATTGTTGAACAAGTACTACTTGTAGTACACAAGTCAAAAAAATAAAAGGGTGAATGGTGAAAA

hide sequence


Protein RefSeqs	NP_689880	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH22552	(Get FASTA)	NCBI Sequence Viewer
	BAB85055	(Get FASTA)	NCBI Sequence Viewer
	BAG51524	(Get FASTA)	NCBI Sequence Viewer
	EAX10081	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000302441
	ENSP00000302441.3
GenBank Protein	Q8TBE9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_689880 ⟸ NM_152667

- UniProtKB:

Q8TE97 (UniProtKB/Swiss-Prot), Q5JYN8 (UniProtKB/Swiss-Prot), B3KP12 (UniProtKB/Swiss-Prot), Q9Y3N0 (UniProtKB/Swiss-Prot), Q8TBE9 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYNTCITDLRTSHWEEAIQETKGGAANRKLAEECYFLWKSTRLQHMTLAEDVKAMLTELRKEVRLL
LLTNGDRQTQREKIEACACQSYFDAVVVGGEQREEKPAPSIFYYCCNLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVSSVLELPALLQSIDCKVSMST

hide sequence

Ensembl Acc Id:

ENSP00000302441 ⟸ ENST00000304788

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8TBE9-F1-model_v2	AlphaFold	Q8TBE9	1-248	view protein structure

RGD ID:

6798856

Promoter ID:

HG_KWN:38919

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000078457

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	20	25,552,454 - 25,552,954 (-)	MPROMDB

RGD ID:

13206583

Promoter ID:

EPDNEW_H26872

Type:

initiation region

Name:

NANP_1

Description:

N-acetylneuraminic acid phosphatase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H26873 EPDNEW_H26874

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	25,623,979 - 25,624,039	EPDNEW

RGD ID:

13206585

Promoter ID:

EPDNEW_H26873

Type:

initiation region

Name:

NANP_3

Description:

N-acetylneuraminic acid phosphatase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H26872 EPDNEW_H26874

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	25,624,112 - 25,624,172	EPDNEW

RGD ID:

13206587

Promoter ID:

EPDNEW_H26874

Type:

initiation region

Name:

NANP_2

Description:

N-acetylneuraminic acid phosphatase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H26872 EPDNEW_H26873

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	25,624,422 - 25,624,482	EPDNEW

Database	Acc Id	Source(s)
COSMIC	NANP	COSMIC
Ensembl Genes	ENSG00000170191	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000304788	ENTREZGENE
	ENST00000304788.4	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1000	UniProtKB/Swiss-Prot
	Haloacid dehalogenase hydrolase-like domain	UniProtKB/Swiss-Prot
GTEx	ENSG00000170191	GTEx
HGNC ID	HGNC:16140	ENTREZGENE
Human Proteome Map	NANP	Human Proteome Map
InterPro	HAD-like_hydrolase	UniProtKB/Swiss-Prot
	HAD-like_sf	UniProtKB/Swiss-Prot
	HAD-SF_hydro_IA	UniProtKB/Swiss-Prot
	HAD-SF_hydro_IA_CTE7	UniProtKB/Swiss-Prot
	HAD_sf	UniProtKB/Swiss-Prot
KEGG Report	hsa:140838	UniProtKB/Swiss-Prot
NCBI Gene	140838	ENTREZGENE
OMIM	610763	OMIM
PANTHER	N-ACYLNEURAMINATE-9-PHOSPHATASE	UniProtKB/Swiss-Prot
	N-ACYLNEURAMINATE-9-PHOSPHATASE	UniProtKB/Swiss-Prot
Pfam	Hydrolase	UniProtKB/Swiss-Prot
PharmGKB	PA25689	PharmGKB
PRINTS	HADHALOGNASE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56784	UniProtKB/Swiss-Prot
UniProt	B3KP12	ENTREZGENE
	L8EBE6_HUMAN	UniProtKB/TrEMBL
	NANP_HUMAN	UniProtKB/Swiss-Prot
	Q5JYN8	ENTREZGENE
	Q8TBE9	ENTREZGENE
	Q8TE97	ENTREZGENE
	Q9Y3N0	ENTREZGENE
UniProt Secondary	B3KP12	UniProtKB/Swiss-Prot
	Q5JYN8	UniProtKB/Swiss-Prot
	Q8TE97	UniProtKB/Swiss-Prot
	Q9Y3N0	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)