Advanced Search (OLGA)

Gene: Nanp (N-acetylneuraminic acid phosphatase) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Nanp

Name:

N-acetylneuraminic acid phosphatase

RGD ID:

1551900

MGI Page

MGI

Description:

Predicted to enable N-acylneuraminate-9-phosphatase activity. Involved in CMP-N-acetylneuraminate biosynthetic process and N-acetylneuraminate metabolic process. Predicted to be active in cytosol. Is expressed in several structures, including alimentary system; liver; submandibular gland primordium; and telencephalon ventricular layer. Orthologous to human NANP (N-acetylneuraminic acid phosphatase).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1600031M04Rik; A130094D17Rik; haloacid dehalogenase-like hydrolase domain containing 4; haloacid dehalogenase-like hydrolase domain-containing protein 4; Hdhd4; MGC103377; N-acylneuraminate-9-phosphatase; neu5Ac-9-Pase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NANP (N-acetylneuraminic acid phosphatase)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Nanp (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nanp (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NANP (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NANP (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nanp (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NANP (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LOC103247037 (N-acylneuraminate-9-phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nanp (N-acetylneuraminic acid phosphatase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Nanp (N-acetylneuraminic acid phosphatase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NANP (N-acetylneuraminic acid phosphatase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nanp (N-acetylneuraminic acid phosphatase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CG15771	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nanp	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Gm18698 Gm6741

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	150,871,605 - 150,881,299 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	150,871,605 - 150,881,318 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	151,029,685 - 151,039,379 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	151,029,685 - 151,039,398 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	150,855,421 - 150,865,115 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	150,721,138 - 150,730,796 (-)	NCBI		MGSCv36	mm8
Celera	2	152,263,425 - 152,273,317 (-)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	1,2-dimethylhydrazine	decreases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in decreased expression of NANP mRNA	CTD	PMID:22206623
Nanp	Mouse	17beta-estradiol	increases expression	ISO	NANP (Homo sapiens)	6480464	Estradiol results in increased expression of NANP mRNA	CTD	PMID:31614463
Nanp	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of NANP mRNA	CTD	PMID:26232522 and PMID:33387578
Nanp	Mouse	2,4-D	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
Nanp	Mouse	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	EXP		6480464	3 more ...	CTD	PMID:19467301
Nanp	Mouse	3-chloropropane-1,2-diol	increases expression	ISO	Nanp (Rattus norvegicus)	6480464	alpha-Chlorohydrin results in increased expression of NANP protein	CTD	PMID:34915118
Nanp	Mouse	4-aminobenzhydrazide	multiple interactions	ISO	NANP (Homo sapiens)	6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of NANP mRNA]	CTD	PMID:24530881
Nanp	Mouse	4-hydroxyphenyl retinamide	increases expression	EXP		6480464	Fenretinide results in increased expression of NANP mRNA	CTD	PMID:28973697
Nanp	Mouse	aflatoxin B1	increases methylation	ISO	NANP (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of NANP intron	CTD	PMID:30157460
Nanp	Mouse	aldehydo-D-glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
Nanp	Mouse	arsenous acid	multiple interactions	ISO	NANP (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NANP protein]	CTD	PMID:26598702
Nanp	Mouse	benzene-1,2,4-triol	decreases expression	ISO	NANP (Homo sapiens)	6480464	hydroxyhydroquinone results in decreased expression of NANP mRNA	CTD	PMID:24530881
Nanp	Mouse	benzene-1,2,4-triol	multiple interactions	ISO	NANP (Homo sapiens)	6480464	4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in decreased expression of NANP mRNA]	CTD	PMID:24530881
Nanp	Mouse	benzo[a]pyrene	affects methylation	ISO	NANP (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of NANP intron	CTD	PMID:30157460
Nanp	Mouse	benzo[a]pyrene	increases expression	ISO	NANP (Homo sapiens)	6480464	Benzo(a)pyrene results in increased expression of NANP mRNA	CTD	PMID:32234424
Nanp	Mouse	benzo[a]pyrene diol epoxide I	decreases expression	ISO	NANP (Homo sapiens)	6480464	7 more ...	CTD	PMID:20382639
Nanp	Mouse	benzo[e]pyrene	increases methylation	ISO	NANP (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of NANP intron	CTD	PMID:30157460
Nanp	Mouse	cadmium dichloride	decreases expression	ISO	NANP (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of NANP mRNA	CTD	PMID:38568856
Nanp	Mouse	calcium silicate	decreases expression	EXP		6480464	calcium silicate results in decreased expression of NANP mRNA	CTD	PMID:29279043
Nanp	Mouse	choline	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
Nanp	Mouse	cisplatin	multiple interactions	ISO	NANP (Homo sapiens)	6480464	[Cisplatin co-treated with jinfukang] results in increased expression of NANP mRNA	CTD	PMID:27392435
Nanp	Mouse	cisplatin	increases expression	ISO	NANP (Homo sapiens)	6480464	Cisplatin results in increased expression of NANP mRNA	CTD	PMID:27392435
Nanp	Mouse	copper(II) sulfate	decreases expression	ISO	NANP (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of NANP mRNA	CTD	PMID:19549813
Nanp	Mouse	coumestrol	increases expression	ISO	NANP (Homo sapiens)	6480464	Coumestrol results in increased expression of NANP mRNA	CTD	PMID:19167446
Nanp	Mouse	crocidolite asbestos	decreases expression	EXP		6480464	Asbestos and Crocidolite results in decreased expression of NANP mRNA	CTD	PMID:29279043
Nanp	Mouse	cypermethrin	decreases expression	EXP		6480464	cypermethrin results in decreased expression of NANP mRNA	CTD	PMID:29020013
Nanp	Mouse	D-glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
Nanp	Mouse	diarsenic trioxide	multiple interactions	ISO	NANP (Homo sapiens)	6480464	Arsenic Trioxide inhibits the reaction [4-aminophenylarsenoxide binds to NANP protein]	CTD	PMID:26598702
Nanp	Mouse	Dibutyl phosphate	affects expression	ISO	NANP (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of NANP mRNA	CTD	PMID:37042841
Nanp	Mouse	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of NANP mRNA	CTD	PMID:21266533
Nanp	Mouse	dorsomorphin	multiple interactions	ISO	NANP (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
Nanp	Mouse	flutamide	increases expression	ISO	Nanp (Rattus norvegicus)	6480464	Flutamide results in increased expression of NANP mRNA	CTD	PMID:24136188
Nanp	Mouse	folic acid	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
Nanp	Mouse	formaldehyde	decreases expression	ISO	NANP (Homo sapiens)	6480464	Formaldehyde results in decreased expression of NANP mRNA	CTD	PMID:20655997
Nanp	Mouse	fructose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
Nanp	Mouse	gentamycin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of NANP mRNA	CTD	PMID:33387578
Nanp	Mouse	glucose	multiple interactions	EXP		6480464	[lard co-treated with Cholesterol more ...	CTD	PMID:37567420
Nanp	Mouse	hydrogen peroxide	affects expression	ISO	NANP (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of NANP mRNA	CTD	PMID:20044591
Nanp	Mouse	L-methionine	multiple interactions	EXP		6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of NANP gene	CTD	PMID:20938992
Nanp	Mouse	methapyrilene	increases methylation	ISO	NANP (Homo sapiens)	6480464	Methapyrilene results in increased methylation of NANP intron	CTD	PMID:30157460
Nanp	Mouse	nickel sulfate	decreases expression	ISO	NANP (Homo sapiens)	6480464	nickel sulfate results in decreased expression of NANP mRNA	CTD	PMID:22714537
Nanp	Mouse	oxaliplatin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	oxaliplatin results in decreased expression of NANP mRNA	CTD	PMID:25729387
Nanp	Mouse	oxaliplatin	multiple interactions	ISO	Nanp (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NANP mRNA	CTD	PMID:25729387
Nanp	Mouse	ozone	multiple interactions	EXP		6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NANP mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NANP mRNA	CTD	PMID:34911549
Nanp	Mouse	SB 431542	multiple interactions	ISO	NANP (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
Nanp	Mouse	silicon dioxide	decreases expression	EXP		6480464	Silicon Dioxide results in decreased expression of NANP mRNA	CTD	PMID:19073995 and PMID:33720480
Nanp	Mouse	silver atom	decreases expression	ISO	NANP (Homo sapiens)	6480464	Silver results in decreased expression of NANP mRNA	CTD	PMID:26014281
Nanp	Mouse	silver(0)	decreases expression	ISO	NANP (Homo sapiens)	6480464	Silver results in decreased expression of NANP mRNA	CTD	PMID:26014281
Nanp	Mouse	sodium arsenite	decreases expression	ISO	NANP (Homo sapiens)	6480464	sodium arsenite results in decreased expression of NANP mRNA	CTD	PMID:22714537 and PMID:38568856
Nanp	Mouse	sunitinib	increases expression	ISO	NANP (Homo sapiens)	6480464	Sunitinib results in increased expression of NANP mRNA	CTD	PMID:31533062
Nanp	Mouse	thioacetamide	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of NANP mRNA	CTD	PMID:34492290
Nanp	Mouse	titanium dioxide	decreases expression	EXP		6480464	titanium dioxide results in decreased expression of NANP mRNA	CTD	PMID:29264374
Nanp	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of NANP gene	CTD	PMID:35295148
Nanp	Mouse	topotecan	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	Topotecan results in decreased expression of NANP mRNA	CTD	PMID:25729387
Nanp	Mouse	topotecan	multiple interactions	ISO	Nanp (Rattus norvegicus)	6480464	[oxaliplatin co-treated with Topotecan] results in decreased expression of NANP mRNA	CTD	PMID:25729387
Nanp	Mouse	triphenyl phosphate	affects expression	ISO	NANP (Homo sapiens)	6480464	triphenyl phosphate affects the expression of NANP mRNA	CTD	PMID:37042841
Nanp	Mouse	valproic acid	affects expression	ISO	NANP (Homo sapiens)	6480464	Valproic Acid affects the expression of NANP mRNA	CTD	PMID:25979313
Nanp	Mouse	valproic acid	multiple interactions	ISO	NANP (Homo sapiens)	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NANP mRNA	CTD	PMID:27188386
Nanp	Mouse	valproic acid	increases expression	ISO	NANP (Homo sapiens)	6480464	Valproic Acid results in increased expression of NANP mRNA	CTD	PMID:23179753 more ...
Nanp	Mouse	valproic acid	increases methylation	ISO	NANP (Homo sapiens)	6480464	Valproic Acid results in increased methylation of NANP gene	CTD	PMID:29154799
Nanp	Mouse	vinclozolin	decreases expression	ISO	Nanp (Rattus norvegicus)	6480464	vinclozolin results in decreased expression of NANP mRNA	CTD	PMID:20566332

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	CMP-N-acetylneuraminate biosynthetic process	involved_in	IMP	MGI:2182685	2290270	PMID:11929971	MGI	PMID:11929971
Nanp	Mouse	glycosylation	involved_in	IEA	UniProtKB:Q8TBE9 and ensembl:ENSP00000302441	2290270		Ensembl	GO_REF:0000107
Nanp	Mouse	N-acetylglucosamine biosynthetic process	involved_in	IEA	UniPathway:UPA00630	2290270		UniProt	GO_REF:0000041
Nanp	Mouse	N-acetylneuraminate biosynthetic process	involved_in	ISO	UniProtKB:Q8TBE9	2290270		GO_Central	GO_REF:0000119
Nanp	Mouse	N-acetylneuraminate biosynthetic process	involved_in	ISO	Nanp (Rattus norvegicus)	2290270	PMID:16237198	MGI	GO_REF:0000096 and PMID:16237198
Nanp	Mouse	N-acetylneuraminate biosynthetic process	involved_in	ISS	UniProtKB:Q5M969	2290270		UniProt	GO_REF:0000024
Nanp	Mouse	N-acetylneuraminate biosynthetic process	involved_in	IBA	PANTHER:PTN000977427 more ...	2290270		GO_Central	GO_REF:0000033
Nanp	Mouse	N-acetylneuraminate metabolic process	involved_in	IMP	MGI:6281181	2290270	PMID:30382946	MGI	PMID:30382946

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	cellular_component	is_active_in	ND		2290270		MGI	GO_REF:0000015
Nanp	Mouse	cytosol	is_active_in	ISO	Nanp (Rattus norvegicus)	2290270	PMID:16237198	MGI	PMID:16237198

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	N-acylneuraminate-9-phosphatase activity	enables	ISO	UniProtKB:Q8TBE9	2290270		GO_Central	GO_REF:0000119
Nanp	Mouse	N-acylneuraminate-9-phosphatase activity	enables	ISS	UniProtKB:Q5M969	2290270		UniProt	GO_REF:0000024
Nanp	Mouse	N-acylneuraminate-9-phosphatase activity	enables	ISO	Nanp (Rattus norvegicus)	2290270	PMID:16237198	GO_Central	GO_REF:0000096 and PMID:16237198
Nanp	Mouse	N-acylneuraminate-9-phosphatase activity	enables	IBA	PANTHER:PTN000977427 more ...	2290270		GO_Central	GO_REF:0000033

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	amino sugar metabolic pathway		ISO	NANP (Homo sapiens)	10402751		SMPDB	SMP:00045
Nanp	Mouse	french type sialuria pathway		ISO	NANP (Homo sapiens)	10402751		SMPDB	SMP:00216
Nanp	Mouse	french type sialuria pathway		ISO	NANP (Homo sapiens)	10402751		SMPDB	SMP:00217
Nanp	Mouse	sialic acid storage disease pathway		ISO	NANP (Homo sapiens)	10402751		SMPDB	SMP:00240
Nanp	Mouse	Tay-Sachs disease pathway		ISO	NANP (Homo sapiens)	10402751		SMPDB	SMP:00390

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	amino sugar metabolic pathway		IEA		6907045		KEGG	mmu:00520
Nanp	Mouse	nucleotide sugar metabolic pathway		IEA		6907045		KEGG	mmu:00520

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Nanp	Mouse	preweaning lethality, incomplete penetrance		IEA		5509061		MGI

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	MGDs mouse GO annotations	MGD data from the GO Consortium
3.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11929971	PMID:12477932	PMID:14610273	PMID:14681479	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16237198
PMID:21267068	PMID:21677750	PMID:21873635	PMID:30382946	PMID:32325033	PMID:38355793

Nanp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	150,871,605 - 150,881,299 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	150,871,605 - 150,881,318 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	151,029,685 - 151,039,379 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	151,029,685 - 151,039,398 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	150,855,421 - 150,865,115 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	150,721,138 - 150,730,796 (-)	NCBI		MGSCv36	mm8
Celera	2	152,263,425 - 152,273,317 (-)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	74.83	NCBI

NANP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	25,612,935 - 25,624,014 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	25,612,935 - 25,624,014 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	25,593,571 - 25,604,650 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	25,543,001 - 25,552,614 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	25,543,001 - 25,552,614	NCBI
Celera	20	25,667,188 - 25,678,265 (-)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	25,551,390 - 25,562,466 (-)	NCBI		HuRef
CHM1_1	20	25,593,809 - 25,604,886 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	25,678,481 - 25,689,560 (-)	NCBI		T2T-CHM13v2.0

Nanp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	160,289,269 - 160,302,001 (-)	NCBI		GRCr8
mRatBN7.2	3	139,826,549 - 139,841,655 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	139,826,549 - 139,841,648 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	143,725,380 - 143,738,147 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	152,309,149 - 152,321,917 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	150,057,374 - 150,070,106 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	146,800,018 - 146,812,988 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	146,800,019 - 146,812,989 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	153,160,644 - 153,173,614 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	141,639,178 - 141,651,910 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	141,544,751 - 141,557,483 (-)	NCBI
Celera	3	138,589,564 - 138,602,296 (-)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

Nanp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	31,453,393 - 31,460,386 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	31,453,393 - 31,460,147 (-)	NCBI	ChiLan1.0	ChiLan1.0

NANP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	26,497,333 - 26,507,875 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	26,494,167 - 26,504,699 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	25,566,464 - 25,576,960 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	25,970,274 - 25,981,685 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	25,970,274 - 25,981,685 (-)	Ensembl	panpan1.1		panPan2

NANP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	23	1,757,963 - 1,776,758 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	23	1,788,489 - 1,807,300 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	23	1,999,374 - 2,018,194 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	23	2,001,001 - 2,018,134 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	23	1,840,190 - 1,858,994 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	23	1,964,897 - 1,983,691 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	23	1,932,577 - 1,951,375 (-)	NCBI		UU_Cfam_GSD_1.0

Nanp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	146,814,474 - 146,825,293 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936620	234,964 - 246,803 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936620	235,013 - 245,138 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NANP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	31,208,181 - 31,217,310 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	31,206,265 - 31,217,366 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	35,137,366 - 35,147,715 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103247037
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666124	54,355 - 64,917 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nanp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624939	41,567 - 51,634 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624939	41,154 - 47,608 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Nanp
537 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	226
Count of miRNA genes:	198
Interacting mature miRNAs:	219
Transcripts:	ENSMUST00000066640, ENSMUST00000140124
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301907	Rends_m	renal disease susceptibility (mouse)			Not determined		2	135699221	169699361	Mouse
1301783	Bhr1_m	bronchial hyperresponsiveness 1 (mouse)			Not determined		2	142593476	178442452	Mouse
12790983	Bwq12_m	body weight QTL 12 (mouse)					2	148238204	181755017	Mouse
11038701	Ltpr2e_m	Leishmania tropica response 2e (mouse)					2	150212221	181755017	Mouse
11038702	Ltpr2_m	Leishmania tropica response 2 (mouse)					2	103095716	167212356	Mouse
12910799	Pwgrq2_m	pre-weaning growth rate QTL 2 (mouse)					2	118589253	160611165	Mouse
1558939	Gnf1_m	growth and fatness 1 (mouse)			Not determined		2	143773445	169117924	Mouse
4142450	Lmr16_m	leishmaniasis resistance 16 (mouse)			Not determined		2	150212221	181755017	Mouse
12910795	Pwbwq5_m	post-weaning body weight QTL 5 (mouse)					2	118589253	160611165	Mouse
1301085	Lrnx10_m	learning-contextual 10 (mouse)			Not determined		2	150212221	181755017	Mouse
11353826	Bdln10_m	body length 10 (mouse)					2	140441482	174441482	Mouse
1300867	Lore2_m	loss of righting induced by ethanol 2 (mouse)			Not determined		2	144515861	180896594	Mouse
1558917	Gct8_m	granulosa cell tumorigenesis 8 (mouse)			Not determined		2	149236907	181755017	Mouse
1300806	Aod4_m	autoimmune ovarian dysgenesis 4 (mouse)			Not determined		2	145228719	179228841	Mouse
27226761	Feml18_m	femur length 18, 16 week (mouse)					2	94230345	154241920	Mouse
4141033	Wg2d_m	weight gain in high growth mice 2d (mouse)			Not determined			143773445	160303008	Mouse
12910812	Pwgrq1_m	pre-weaning growth rate QTL 1 (mouse)					2	118589253	160611165	Mouse
1301961	Bts1_m	bladder tumor susceptibility 1 (mouse)			Not determined		2	132024159	166024330	Mouse
12910814	Pwbwq1_m	pre-weaning body weight QTL 1 (mouse)					2	118589253	160611165	Mouse
1300751	Bdt1_m	bone density traits 1 (mouse)			Not determined		2	149988902	181755017	Mouse
1301618	Bglu1_m	blood glucose level 1 (mouse)			Not determined		2	117942930	174324863	Mouse
27226749	Femd10_m	femur midshaft diameter 10, 16 week (mouse)					2	124441920	168241920	Mouse
10045885	Cplaq15_m	circadian period of locomotor activity 15 (mouse)			Not determined		2	110916118	154354667	Mouse
10054066	Bwq9_m	body weight QTL 9 (mouse)			Not determined		2	135699221	169699361	Mouse
1302143	Bwq5_m	body weight (mouse)			Not determined		2	127664019	161664118	Mouse
1301822	Pgia2_m	proteoglycan induced arthritis 2 (mouse)			Not determined		2	123937311	157937424	Mouse
10043956	Gnf5_m	growth and fatness 5 (mouse)			Not determined		2	135699221	169699361	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
1302013	Tbbmd3_m	total body bone mineral density 3 (mouse)			Not determined		2	145196949	179197085	Mouse
5491196	Mobq6_m	multigenic obesity QTL 6 (mouse)			Not determined		2	85724269	180896594	Mouse
12880427	V25Dq3_m	vitamin D inactive form serum level QTL 3 (mouse)					2	129341920	163341920	Mouse
13504830	Bacsq1_m	baculum shape QTL 1 (mouse)					2	145716184	161016184	Mouse
12801456	Intmrm1_m	intima/media ratio modifier 1 (mouse)					2	142428347	176428450	Mouse
1301031	Bdln3_m	body length 3 (mouse)			Not determined		2	127664019	161664118	Mouse
11049566	Lmr28e_m	leishmaniasis resistance 28e (mouse)					2	133144911	167145058	Mouse
12801461	Intim1_m	intima modifier 1 (mouse)					2	142428347	176428450	Mouse
11049567	Lmr28f_m	leishmaniasis resistance 28f (mouse)					2	133144911	167145058	Mouse
11341717	Rvfs1_m	Rift Valley fever susceptibility 1 (mouse)					2	135432544	173449616	Mouse
4141703	Chlq13_m	circulating hormone level QTL 13 (mouse)			Not determined		2	135699221	169699361	Mouse
1357484	Bsbob_m	BSB obesity (mouse)			Not determined		2	143773445	165665019	Mouse
1301865	Hdlq19_m	HDL QTL 19 (mouse)			Not determined		2	145518775	179518926	Mouse
27226788	Feml13_m	femur length 13, 10 week (mouse)					2	102630345	159941920	Mouse
4142211	Nilac3_m	nicotine induced locomotor activity 3 (mouse)			Not determined		2	148664893	181755017	Mouse
1301294	Hrtfm5_m	heart failure modifier 5 (mouse)			Not determined		2	122883015	156883131	Mouse
1300846	Pbwg11_m	postnatal body weight growth 11 (mouse)			Not determined		2	138966600	172966729	Mouse

UniSTS:488753

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	17	91,236,791 - 91,238,055	UniSTS	GRCm38
MGSCv37	17	91,636,131 - 91,637,395	UniSTS	GRCm37
Celera	17	95,634,403 - 95,635,683	UniSTS
Cytogenetic Map	17	E5	UniSTS
Cytogenetic Map	2	H1	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_026086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006500068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK005566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK021344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK164971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL808125	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC018527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000066640 ⟹ ENSMUSP00000063895

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	150,871,605 - 150,881,318 (-)	Ensembl
GRCm38.p6 Ensembl	2	151,029,685 - 151,039,398 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000140124

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	150,872,677 - 150,881,282 (-)	Ensembl
GRCm38.p6 Ensembl	2	151,030,757 - 151,039,362 (-)	Ensembl

RefSeq Acc Id:

NM_026086 ⟹ NP_080362

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	150,871,605 - 150,881,299 (-)	NCBI
GRCm38	2	151,029,685 - 151,039,379 (-)	ENTREZGENE
MGSCv37	2	150,855,421 - 150,865,115 (-)	RGD
Celera	2	152,263,425 - 152,273,317 (-)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

CGCATGCGCGGCGCGGCAGAAGCGGCTCGCGCGCTGCTTGGGTTGCCGAGGCTATGGGGCTGAGTCGGGTCCGCGCGGTCTTCTTTGACCTGGACAACACACTCATCGACACGGCCGGGGCGAGCAGG
AGAGGCATGTTGGAGGTAATAAAGCTCTTACAGTCAAAATACCACTACAAAGAAGAGGCTGAAATCATCTGTGATAAAGTTCAAGTTAAACTGAGCAAGGAGTGCTTTCATCCCTATAGTACATGCAT
TACAGATGTGAGGACTTCACACTGGGAAGAAGCAATCCAGGAAACCAAAGGAGGTGCTGACAATAGGAAATTGGCGGAGGAATGTTATTTCCTGTGGAAATCTACACGCTTACAGCACATGATCCTAG
CAGACGATGTCAAAGCCATGCTCACTGAACTTCGAAAAGAGGTCCGCCTGCTCCTGTTAACAAATGGTGACAGACAGACTCAGAGGGAAAAGATCGAGGCCTGCGCCTGCCAGTCTTACTTTGATGCC
ATTGTTATTGGCGGAGAACAGAAGGAAGAGAAACCAGCACCTTCCATATTTTATCACTGCTGTGATCTTCTTGGAGTGCAGCCAGGTGACTGTGTGATGGTTGGTGACACACTGGAAACCGATATACA
AGGAGGCCTCAATGCAGGACTGAAAGCTACGGTCTGGATAAACAAGAGTGGAAGAGTGCCGCTGACATCATCACCCATGCCTCACTATATGGTTTCTTCTGTGCTAGAATTACCTGCTCTCTTGCAAA
GCATAGATTGCAAAGTCAGCATGTCTGTGTAAATACAGAAGAGCGCAGGGACCATGTTCAGAGCCAGTTTCCAGCGTTAGAACTAAGGGAAGCTAAGGTGTTCCTGTATATTTGGTTCTATTCTAAGA
ATAATGTGAGCGAGGAATTCATAGTCCCCTGTGAAGATCCTCCCAACCCTGCTGCTGTTGATAACCATAGGCTTGTGTTCATATCCGAAATCCAGGTATTAATCGTGTAGTCCAAAAAACTTGAAGAA
AGGCAAAATAGCTTATATGATGATATACAAATACTGGTTTCTAGAGTAGAAATTGATTTTTTTAAAAAAAATAGATATTCTAAAATAGAGATTCAGGCAGCTGAATCGGGACAATATAAGTACTAAAT
CATACAAATCGAGACATTTCATAGTGAAATTTTGCATATTTTAGGCAAATTTGTTATAAATATTGTGCCTACTTTCAATGTATGTGTTCTTAATCTGTTATCTAATTTTTCTGCATGACTTTTGGAGG
GCTGAATTTTCTGTGGCGTGAACATGACATTGTTATAGTTTGGTGAAAAACTATTAAAAATCAAACCGTGGTGCTTTTTTCCCACACTGTTTTCAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006500068 ⟹ XP_006500131

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	150,871,614 - 150,881,282 (-)	NCBI
GRCm38	2	151,029,694 - 151,039,362 (-)	NCBI

Sequence:

show sequence

AGAAGCGGCTCGCGCGCTGCTTGGGTTGCCGAGGCTATGGGGCTGAGTCGGGTCCGCGCGGTCTTCTTTGACCTGGACAACACACTCATCGACACGGCCGGGGCGAGCAGGAGAGGCATGTTGGAGCT
TCAAGGAGAAACCGAAGGAGTATCAGATGTGGAAAGCCCACTTACAAAAAAATGCCTGCCCTTTCAATACTAAGGGTCTTATGCGTCTTCAGGTAATAAAGCTCTTACAGTCAAAATACCACTACAAA
GAAGAGGCTGAAATCATCTGTGATAAAGTTCAAGTTAAACTGAGCAAGGAGTGCTTTCATCCCTATAGTACATGCATTACAGATGTGAGGACTTCACACTGGGAAGAAGCAATCCAGGAAACCAAAGG
AGGTGCTGACAATAGGAAATTGGCGGAGGAATGTTATTTCCTGTGGAAATCTACACGCTTACAGCACATGATCCTAGCAGACGATGTCAAAGCCATGCTCACTGAACTTCGAAAAGAGGTCCGCCTGC
TCCTGTTAACAAATGGTGACAGACAGACTCAGAGGGAAAAGATCGAGGCCTGCGCCTGCCAGTCTTACTTTGATGCCATTGTTATTGGCGGAGAACAGAAGGAAGAGAAACCAGCACCTTCCATATTT
TATCACTGCTGTGATCTTCTTGGAGTGCAGCCAGGTGACTGTGTGATGGTTGGTGACACACTGGAAACCGATATACAAGGAGGCCTCAATGCAGGACTGAAAGCTACGGTCTGGATAAACAAGAGTGG
AAGAGTGCCGCTGACATCATCACCCATGCCTCACTATATGGTTTCTTCTGTGCTAGAATTACCTGCTCTCTTGCAAAGCATAGATTGCAAAGTCAGCATGTCTGTGTAAATACAGAAGAGCGCAGGGA
CCATGTTCAGAGCCAGTTTCCAGCGTTAGAACTAAGGGAAGCTAAGGTGTTCCTGTATATTTGGTTCTATTCTAAGAATAATGTGAGCGAGGAATTCATAGTCCCCTGTGAAGATCCTCCCAACCCTG
CTGCTGTTGATAACCATAGGCTTGTGTTCATATCCGAAATCCAGGTATTAATCGTGTAGTCCAAAAAACTTGAAGAAAGGCAAAATAGCTTATATGATGATATACAAATACTGGTTTCTAGAGTAGAA
ATTGATTTTTTTAAAAAAAATAGATATTCTAAAATAGAGATTCAGGCAGCTGAATCGGGACAATATAAGTACTAAATCATACAAATCGAGACATTTCATAGTGAAATTTTGCATATTTTAGGCAAATT
TGTTATAAATATTGTGCCTACTTTCAATGTATGTGTTCTTAATCTGTTATCTAATTTTTCTGCATGACTTTTGGAGGGCTGAATTTTCTGTGGCGTGAACATGACATTGTTATAGTTTGGTGAAAAAC
TATTAAAAATCAAACCGTGGTGCTTTTTTCCCACA

hide sequence


Protein RefSeqs	NP_080362	(Get FASTA)	NCBI Sequence Viewer
	XP_006500131	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH18527	(Get FASTA)	NCBI Sequence Viewer
	AAH83086	(Get FASTA)	NCBI Sequence Viewer
	BAB24126	(Get FASTA)	NCBI Sequence Viewer
	BAB32381	(Get FASTA)	NCBI Sequence Viewer
	EDL28594	(Get FASTA)	NCBI Sequence Viewer
	EDL28595	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000063895
	ENSMUSP00000063895.5
GenBank Protein	Q9CPT3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_080362 ⟸ NM_026086

- UniProtKB:

Q9CPT3 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MGLSRVRAVFFDLDNTLIDTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYSTCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLL
LLTNGDRQTQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMSV

hide sequence

RefSeq Acc Id:

XP_006500131 ⟸ XM_006500068

- Peptide Label:

isoform X1

- Sequence:

show sequence

MWKAHLQKNACPFNTKGLMRLQVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHPYSTCITDVRTSHWEEAIQETKGGADNRKLAEECYFLWKSTRLQHMILADDVKAMLTELRKEVRLLLLTNGDRQ
TQREKIEACACQSYFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTLETDIQGGLNAGLKATVWINKSGRVPLTSSPMPHYMVSSVLELPALLQSIDCKVSMSV

hide sequence

Ensembl Acc Id:

ENSMUSP00000063895 ⟸ ENSMUST00000066640

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9CPT3-F1-model_v2	AlphaFold	Q9CPT3	1-248	view protein structure

RGD ID:

6831896

Promoter ID:

MM_KWN:32230

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

AK164971_A130094D17RIK, OTTMUST00000037517, OTTMUST00000037518, OTTMUST00000037533

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	2	150,863,956 - 150,865,312 (-)	MPROMDB

RGD ID:

6879122

Promoter ID:

EPDNEW_M3012

Type:

multiple initiation site

Name:

Nanp_1

Description:

Mus musculus N-acetylneuraminic acid phosphatase , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	151,039,362 - 151,039,422	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000053916	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000066640	ENTREZGENE
	ENSMUST00000066640.5	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1000	UniProtKB/Swiss-Prot
	Haloacid dehalogenase hydrolase-like domain	UniProtKB/Swiss-Prot
InterPro	HAD-like_hydrolase	UniProtKB/Swiss-Prot
	HAD-like_sf	UniProtKB/Swiss-Prot
	HAD-SF_hydro_IA	UniProtKB/Swiss-Prot
	HAD-SF_hydro_IA_CTE7	UniProtKB/Swiss-Prot
	HAD_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:67311	UniProtKB/Swiss-Prot
MGD	MGI:1914561	ENTREZGENE
NCBI Gene	67311	ENTREZGENE
PANTHER	N-ACYLNEURAMINATE-9-PHOSPHATASE	UniProtKB/Swiss-Prot
	N-ACYLNEURAMINATE-9-PHOSPHATASE	UniProtKB/Swiss-Prot
Pfam	Hydrolase	UniProtKB/Swiss-Prot
PhenoGen	Nanp	PhenoGen
PRINTS	HADHALOGNASE	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF56784	UniProtKB/Swiss-Prot
UniProt	NANP_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Mammalian Phenotype