Symbol:
RCC1
Name:
regulator of chromosome condensation 1
RGD ID:
1343250
HGNC Page
HGNC:1913
Description:
Enables several functions, including guanyl-nucleotide exchange factor activity; nucleosomal DNA binding activity; and protein heterodimerization activity. Involved in G1/S transition of mitotic cell cycle; regulation of mitotic nuclear division; and spindle organization. Located in chromatin; cytoplasm; and nuclear lumen. Part of protein-containing complex.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
cell cycle regulatory protein; CHC1; chromosome condensation 1; chromosome condensation protein 1; guanine nucleotide-releasing protein; RCC1-I; regulator of chromosome condensation; SNHG3-RCC1; SNHG3-RCC1 readthrough; SNHG3-RCC1 readthrough transcript
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Rcc1 (regulator of chromosome condensation 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Rcc1 (regulator of chromosome condensation 1) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Rcc1 (regulator of chromosome condensation 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
RCC1 (regulator of chromosome condensation 1) NCBI
Ortholog
Canis lupus familiaris (dog):
RCC1 (regulator of chromosome condensation 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rcc1 (regulator of chromosome condensation 1) NCBI
Ortholog
Sus scrofa (pig):
RCC1 (regulator of chromosome condensation 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
RCC1 (regulator of chromosome condensation 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Rcc1 (regulator of chromosome condensation 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Rcc1 (regulator of chromosome condensation 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Rcc1 (regulator of chromosome condensation 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rcc1 (regulator of chromosome condensation 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
ran-3
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Rcc1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SRM1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
rcc1.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
rcc1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
rcc1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 28,506,043 - 28,538,989 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 28,505,943 - 28,539,300 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 28,832,555 - 28,865,501 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 28,717,332 - 28,738,194 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 28,653,183 - 28,686,118 NCBI Celera 1 27,228,232 - 27,261,474 (+) NCBI Celera Cytogenetic Map 1 p35.3 NCBI HuRef 1 27,086,264 - 27,119,463 (+) NCBI HuRef CHM1_1 1 28,947,946 - 28,981,201 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 28,347,999 - 28,380,949 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
RCC1 Human 1,2-dimethylhydrazine increases expression ISO RGD:1614239 6480464 1,2-Dimethylhydrazine results in increased expression of RCC1 mRNA CTD PMID:22206623 RCC1 Human 1-chloro-2,4-dinitrobenzene increases expression ISO RGD:1614239 6480464 Dinitrochlorobenzene results in increased expression of RCC1 mRNA CTD PMID:18242016 RCC1 Human 17alpha-ethynylestradiol increases expression ISO RGD:1614239 6480464 Ethinyl Estradiol results in increased expression of RCC1 mRNA CTD PMID:17942748 RCC1 Human 17alpha-ethynylestradiol multiple interactions ISO RGD:1614239 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RCC1 mRNA CTD PMID:17942748 RCC1 Human 17beta-estradiol multiple interactions ISO RGD:1614239 6480464 ESR1 protein promotes the reaction [Estradiol results in increased expression of RCC1 mRNA] CTD PMID:25210133 RCC1 Human 17beta-estradiol increases expression ISO RGD:1614239 6480464 Estradiol results in increased expression of RCC1 mRNA CTD PMID:25210133 RCC1 Human 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of RCC1 protein CTD PMID:31675489 RCC1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1614239 6480464 Tetrachlorodibenzodioxin affects the expression of RCC1 mRNA CTD PMID:21570461 RCC1 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1614239 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RCC1 mRNA CTD PMID:17942748 RCC1 Human 2-amino-14,16-dimethyloctadecan-3-ol decreases expression EXP 6480464 2-amino-14,16-dimethyloctadecan-3-ol results in decreased expression of RCC1 protein CTD PMID:32044396 RCC1 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of RCC1 mRNA CTD PMID:21179406 RCC1 Human 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO RGD:1614239 6480464 Oxazolone results in increased expression of RCC1 mRNA CTD PMID:18242016 RCC1 Human 5-fluorouracil decreases expression EXP 6480464 Fluorouracil results in decreased expression of RCC1 mRNA CTD PMID:16709241 RCC1 Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 RCC1 Human actinomycin D multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RCC1 protein CTD PMID:38460933 RCC1 Human all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of RCC1 mRNA CTD PMID:15498508 RCC1 Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 RCC1 Human AM-251 decreases expression EXP 6480464 AM 251 results in decreased expression of RCC1 mRNA CTD PMID:16500647 RCC1 Human amphetamine decreases expression ISO RGD:1592835 6480464 Amphetamine results in decreased expression of RCC1 mRNA CTD PMID:30779732 RCC1 Human Aroclor 1254 decreases expression ISO RGD:1614239 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of RCC1 mRNA CTD PMID:23650126 RCC1 Human arsenite(3-) increases expression ISO RGD:1614239 6480464 arsenite results in increased expression of RCC1 protein CTD PMID:37955338 RCC1 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of RCC1 mRNA CTD PMID:20018196 RCC1 Human benzo[e]pyrene increases methylation EXP 6480464 benzo(e)pyrene results in increased methylation of RCC1 intron CTD PMID:30157460 RCC1 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of RCC1 gene CTD PMID:31601247 RCC1 Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of RCC1 protein CTD PMID:34186270 RCC1 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of RCC1 protein CTD PMID:34186270 RCC1 Human Brodifacoum increases expression ISO RGD:1592835 6480464 bromfenacoum results in increased expression of RCC1 protein CTD PMID:28903499 RCC1 Human carbon nanotube increases expression ISO RGD:1614239 6480464 Nanotubes, Carbon analog results in increased expression of RCC1 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 RCC1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to RCC1 gene] CTD PMID:28238834 RCC1 Human choline multiple interactions ISO RGD:1614239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 RCC1 Human clofibrate decreases expression ISO RGD:1614239 6480464 Clofibrate results in decreased expression of RCC1 mRNA CTD PMID:17585979 RCC1 Human cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of RCC1 mRNA CTD PMID:19320972|PMID:19376846 RCC1 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of RCC1 mRNA CTD PMID:19549813 RCC1 Human deoxynivalenol increases phosphorylation ISO RGD:1614239 6480464 deoxynivalenol results in increased phosphorylation of RCC1 protein CTD PMID:23352502 RCC1 Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of RCC1 mRNA CTD PMID:29803840 RCC1 Human enzyme inhibitor multiple interactions EXP 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 RCC1 Human folic acid multiple interactions ISO RGD:1614239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 RCC1 Human formaldehyde decreases expression EXP 6480464 Formaldehyde results in decreased expression of RCC1 mRNA CTD PMID:23649840 RCC1 Human FR900359 increases phosphorylation EXP 6480464 FR900359 results in increased phosphorylation of RCC1 protein CTD PMID:37730182 RCC1 Human hexadecanoic acid decreases phosphorylation EXP 6480464 Palmitic Acid results in decreased phosphorylation of RCC1 protein CTD PMID:28073184 RCC1 Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of RCC1 mRNA CTD PMID:21179406 RCC1 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of RCC1 protein CTD PMID:32959892 RCC1 Human L-methionine multiple interactions ISO RGD:1614239 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 RCC1 Human lead(0) affects expression EXP 6480464 Lead affects the expression of RCC1 mRNA CTD PMID:28903495 RCC1 Human methapyrilene increases methylation EXP 6480464 Methapyrilene results in increased methylation of RCC1 intron CTD PMID:30157460 RCC1 Human methyl methanesulfonate decreases expression EXP 6480464 Methyl Methanesulfonate results in decreased expression of RCC1 mRNA CTD PMID:23649840 RCC1 Human N-methyl-4-phenylpyridinium increases expression ISO RGD:1614239 6480464 1-Methyl-4-phenylpyridinium results in increased expression of RCC1 protein CTD PMID:26558463 RCC1 Human nickel atom increases expression EXP 6480464 Nickel results in increased expression of RCC1 mRNA CTD PMID:25583101 RCC1 Human Nutlin-3 multiple interactions EXP 6480464 [Dactinomycin co-treated with nutlin 3] results in increased secretion of RCC1 protein CTD PMID:38460933 RCC1 Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 RCC1 Human ozone multiple interactions ISO RGD:1614239 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 RCC1 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of RCC1 mRNA CTD PMID:29067470 RCC1 Human perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of RCC1 mRNA CTD PMID:36326898 RCC1 Human pirinixic acid increases expression ISO RGD:1614239 6480464 pirinixic acid results in increased expression of RCC1 mRNA CTD PMID:18301758 RCC1 Human potassium chromate increases expression EXP 6480464 potassium chromate(VI) results in increased expression of RCC1 mRNA CTD PMID:22714537 RCC1 Human progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of RCC1 mRNA CTD PMID:17404688|PMID:18037150 RCC1 Human rotenone increases expression ISO RGD:1614239 6480464 Rotenone results in increased expression of RCC1 mRNA CTD PMID:32937126 RCC1 Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of RCC1 mRNA CTD PMID:28595984|PMID:34032870 RCC1 Human sodium arsenite decreases expression ISO RGD:1614239 6480464 sodium arsenite results in decreased expression of RCC1 mRNA CTD PMID:36209798 RCC1 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of RCC1 mRNA CTD PMID:38568856 RCC1 Human sodium fluoride decreases expression ISO RGD:1614239 6480464 Sodium Fluoride results in decreased expression of RCC1 mRNA; Sodium Fluoride results in decreased expression more ... CTD PMID:21340527|PMID:28918527 RCC1 Human tacrolimus hydrate decreases expression ISO RGD:1614239 6480464 Tacrolimus results in decreased expression of RCC1 mRNA CTD PMID:25270620 RCC1 Human tamibarotene decreases expression EXP 6480464 tamibarotene results in decreased expression of RCC1 mRNA CTD PMID:15498508 RCC1 Human thioacetamide increases expression ISO RGD:1592835 6480464 Thioacetamide results in increased expression of RCC1 mRNA CTD PMID:34492290 RCC1 Human titanium dioxide increases expression ISO RGD:1614239 6480464 titanium dioxide results in increased expression of RCC1 mRNA CTD PMID:29264374 RCC1 Human titanium dioxide decreases methylation ISO RGD:1614239 6480464 titanium dioxide results in decreased methylation of RCC1 gene CTD PMID:35295148 RCC1 Human toluene 2,4-diisocyanate increases expression ISO RGD:1614239 6480464 Toluene 2,4-Diisocyanate results in increased expression of RCC1 mRNA CTD PMID:18242016 RCC1 Human trichostatin A affects expression EXP 6480464 trichostatin A affects the expression of RCC1 mRNA CTD PMID:28542535 RCC1 Human trimellitic anhydride increases expression ISO RGD:1614239 6480464 trimellitic anhydride results in increased expression of RCC1 mRNA CTD PMID:19042947 RCC1 Human triptonide increases expression ISO RGD:1614239 6480464 triptonide results in increased expression of RCC1 mRNA CTD PMID:33045310 RCC1 Human tunicamycin decreases expression EXP 6480464 Tunicamycin results in decreased expression of RCC1 mRNA CTD PMID:22378314 RCC1 Human valproic acid affects expression ISO RGD:1614239 6480464 Valproic Acid affects the expression of RCC1 mRNA CTD PMID:17292431|PMID:17963808 RCC1 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of RCC1 mRNA CTD PMID:25979313 RCC1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of RCC1 mRNA CTD PMID:22083351|PMID:23179753|PMID:27188386 RCC1 Human venlafaxine hydrochloride increases expression EXP 6480464 Venlafaxine Hydrochloride results in increased expression of RCC1 mRNA CTD PMID:16341940
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2-amino-14,16-dimethyloctadecan-3-ol (EXP) 2-methylcholine (EXP) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-fluorouracil (EXP) acrolein (EXP) actinomycin D (EXP) all-trans-retinoic acid (EXP) alpha-pinene (EXP) AM-251 (EXP) amphetamine (ISO) Aroclor 1254 (ISO) arsenite(3-) (ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[e]pyrene (EXP) bisphenol A (EXP) bisphenol AF (EXP) Brodifacoum (ISO) carbon nanotube (ISO) CGP 52608 (EXP) choline (ISO) clofibrate (ISO) cobalt dichloride (EXP) copper(II) sulfate (EXP) deoxynivalenol (ISO) doxorubicin (EXP) enzyme inhibitor (EXP) folic acid (ISO) formaldehyde (EXP) FR900359 (EXP) hexadecanoic acid (EXP) hydrogen peroxide (EXP) ivermectin (EXP) L-methionine (ISO) lead(0) (EXP) methapyrilene (EXP) methyl methanesulfonate (EXP) N-methyl-4-phenylpyridinium (ISO) nickel atom (EXP) Nutlin-3 (EXP) ozone (EXP,ISO) paracetamol (EXP) perfluorooctanoic acid (EXP) pirinixic acid (ISO) potassium chromate (EXP) progesterone (EXP) rotenone (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) tacrolimus hydrate (ISO) tamibarotene (EXP) thioacetamide (ISO) titanium dioxide (ISO) toluene 2,4-diisocyanate (ISO) trichostatin A (EXP) trimellitic anhydride (ISO) triptonide (ISO) tunicamycin (EXP) valproic acid (EXP,ISO) venlafaxine hydrochloride (EXP)
RCC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 28,506,043 - 28,538,989 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 28,505,943 - 28,539,300 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 28,832,555 - 28,865,501 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 28,717,332 - 28,738,194 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 28,653,183 - 28,686,118 NCBI Celera 1 27,228,232 - 27,261,474 (+) NCBI Celera Cytogenetic Map 1 p35.3 NCBI HuRef 1 27,086,264 - 27,119,463 (+) NCBI HuRef CHM1_1 1 28,947,946 - 28,981,201 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 28,347,999 - 28,380,949 (+) NCBI T2T-CHM13v2.0
Rcc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 132,059,230 - 132,073,061 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 132,059,230 - 132,080,916 (-) Ensembl GRCm39 Ensembl GRCm38 4 132,331,919 - 132,345,750 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 132,331,919 - 132,353,605 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 131,887,838 - 131,901,577 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 131,603,999 - 131,617,738 (-) NCBI MGSCv36 mm8 Celera 4 130,492,831 - 130,506,571 (-) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 65.2 NCBI
Rcc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 149,810,037 - 149,828,475 (-) NCBI GRCr8 mRatBN7.2 5 144,526,025 - 144,544,445 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 144,526,025 - 144,544,577 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 147,226,563 - 147,244,220 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 148,996,458 - 149,014,116 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 148,984,701 - 149,002,345 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 150,508,840 - 150,531,062 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 150,509,040 - 150,525,254 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 154,176,026 - 154,193,188 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 5 142,957,255 - 142,974,902 (-) NCBI Celera Cytogenetic Map 5 q36 NCBI
Rcc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 7,612,784 - 7,643,275 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 7,612,784 - 7,643,275 (+) NCBI ChiLan1.0 ChiLan1.0
RCC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 198,307,052 - 198,329,284 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 197,426,225 - 197,448,484 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 27,784,488 - 27,806,728 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 28,819,422 - 28,841,266 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 28,820,815 - 28,841,773 (+) Ensembl panpan1.1 panPan2
RCC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 71,948,159 - 71,972,902 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 71,948,165 - 71,964,353 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 68,524,663 - 68,540,842 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 72,507,102 - 72,531,854 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 72,507,108 - 72,530,338 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 69,335,321 - 69,351,510 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 70,343,443 - 70,359,626 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 71,341,326 - 71,357,632 (-) NCBI UU_Cfam_GSD_1.0
Rcc1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 46,804,062 - 46,822,132 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 12,635,175 - 12,647,231 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 12,635,175 - 12,646,907 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RCC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 85,546,024 - 85,565,866 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 85,540,766 - 85,565,869 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 79,351,068 - 79,378,340 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RCC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 104,256,895 - 104,279,948 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 104,257,877 - 104,278,458 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 12,221,461 - 12,246,700 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rcc1
.
Predicted Target Of
Count of predictions: 3961 Count of miRNA genes: 1013 Interacting mature miRNAs: 1240 Transcripts: ENST00000373831, ENST00000373832, ENST00000373833, ENST00000398958, ENST00000411533, ENST00000419074, ENST00000427469, ENST00000429051, ENST00000430407, ENST00000434290, ENST00000478232, ENST00000486790 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
597144279 GWAS1240353_H COVID-19 QTL GWAS1240353 (human) 0.0000006 COVID-19 1 28511063 28511064 Human 1576329 MYI9_H Myocardial infarction susceptibility QTL 9 (human) 12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 597131733 GWAS1227807_H pulse pressure measurement QTL GWAS1227807 (human) 6e-14 pulse pressure measurement pulse pressure (CMO:0000292) 1 28511686 28511687 Human 406919559 GWAS568535_H systolic blood pressure QTL GWAS568535 (human) 3e-10 systolic blood pressure systolic blood pressure (CMO:0000004) 1 28510931 28510932 Human 1576325 MYI1_H Myocardial infarction susceptibility QTL 1 (human) 11.68 1e-12 Myocardial infarction susceptibility early-onset 1 7585503 33585503 Human 1643380 BW316_H Body weight QTL 316 (human) 2.62 0.0002 Body weight BMI 1 7585503 33585503 Human 597195734 GWAS1291808_H systolic blood pressure QTL GWAS1291808 (human) 2e-11 systolic blood pressure systolic blood pressure (CMO:0000004) 1 28511686 28511687 Human 406967103 GWAS616079_H nighttime rest measurement QTL GWAS616079 (human) 0.000002 sleep behavior trait (VT:0001501) 1 28514428 28514429 Human
D1S3211
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,864,710 - 28,864,911 UniSTS GRCh37 Build 36 1 28,737,297 - 28,737,498 RGD NCBI36 Celera 1 27,260,476 - 27,260,677 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,118,465 - 27,118,666 UniSTS
RH103048
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,865,517 - 28,865,648 UniSTS GRCh37 Build 36 1 28,738,104 - 28,738,235 RGD NCBI36 Celera 1 27,261,283 - 27,261,414 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,119,272 - 27,119,403 UniSTS GeneMap99-GB4 RH Map 1 95.57 UniSTS
SHGC-74505
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,833,773 - 28,833,884 UniSTS GRCh37 Build 36 1 28,706,360 - 28,706,471 RGD NCBI36 Celera 1 27,229,550 - 27,229,661 RGD Cytogenetic Map 1 p35.3 UniSTS Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,087,582 - 27,087,693 UniSTS TNG Radiation Hybrid Map 1 13442.0 UniSTS GeneMap99-GB4 RH Map 1 95.4 UniSTS NCBI RH Map 1 165.8 UniSTS
G67872
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,861,574 - 28,861,811 UniSTS GRCh37 Build 36 1 28,734,161 - 28,734,398 RGD NCBI36 Celera 1 27,257,340 - 27,257,577 RGD Cytogenetic Map 1 p35.3 UniSTS Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,115,329 - 27,115,566 UniSTS
A009U10
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,835,935 - 28,836,070 UniSTS GRCh37 GRCh37 15 41,606,481 - 41,607,968 UniSTS GRCh37 Build 36 1 28,708,522 - 28,708,657 RGD NCBI36 Celera 15 18,374,458 - 18,375,945 UniSTS Celera 1 27,231,712 - 27,231,847 RGD Cytogenetic Map 1 p36.1 UniSTS Cytogenetic Map 15 q15.1 UniSTS HuRef 1 27,089,744 - 27,089,879 UniSTS GeneMap99-GB4 RH Map 1 95.57 UniSTS NCBI RH Map 1 142.5 UniSTS
SHGC-56851
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,865,559 - 28,865,655 UniSTS GRCh37 Build 36 1 28,738,146 - 28,738,242 RGD NCBI36 Celera 1 27,261,325 - 27,261,421 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,119,314 - 27,119,410 UniSTS
SHGC-32496
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,837,247 - 28,837,372 UniSTS GRCh37 Build 36 1 28,709,834 - 28,709,959 RGD NCBI36 Celera 1 27,233,024 - 27,233,149 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,091,056 - 27,091,181 UniSTS Whitehead-RH Map 1 94.5 UniSTS GeneMap99-G3 RH Map 1 1780.0 UniSTS
RH68391
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,837,195 - 28,837,372 UniSTS GRCh37 Build 36 1 28,709,782 - 28,709,959 RGD NCBI36 Celera 1 27,232,972 - 27,233,149 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,091,004 - 27,091,181 UniSTS GeneMap99-GB4 RH Map 1 95.57 UniSTS
SHGC-36606
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,865,364 - 28,865,468 UniSTS GRCh37 Build 36 1 28,737,951 - 28,738,055 RGD NCBI36 Celera 1 27,261,130 - 27,261,234 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,119,119 - 27,119,223 UniSTS
G34830
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,865,269 - 28,865,404 UniSTS GRCh37 Build 36 1 28,737,856 - 28,737,991 RGD NCBI36 Celera 1 27,261,035 - 27,261,170 RGD Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,119,024 - 27,119,159 UniSTS
PRDX3-1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 120,931,911 - 120,933,385 UniSTS GRCh37 GRCh37 1 28,852,888 - 28,853,111 UniSTS GRCh37 Celera 10 114,661,490 - 114,662,964 UniSTS Celera 1 27,248,665 - 27,248,888 UniSTS HuRef 1 27,106,697 - 27,106,920 UniSTS HuRef 10 114,561,343 - 114,562,817 UniSTS
G32835
Human Assembly Chr Position (strand) Source JBrowse GRCh37 1 28,835,935 - 28,836,070 UniSTS GRCh37 Celera 1 27,231,712 - 27,231,847 UniSTS Cytogenetic Map 1 p36.1 UniSTS HuRef 1 27,089,744 - 27,089,879 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2252
4973
1726
2351
6
624
1951
465
2269
7304
6471
53
3734
1
852
1744
1616
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000373831 ⟹ ENSP00000362937
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,518,257 - 28,538,164 (+) Ensembl
Ensembl Acc Id:
ENST00000373832 ⟹ ENSP00000362938
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,518,136 - 28,538,983 (+) Ensembl
Ensembl Acc Id:
ENST00000373833 ⟹ ENSP00000362939
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,506,057 - 28,539,300 (+) Ensembl
Ensembl Acc Id:
ENST00000398958 ⟹ ENSP00000381931
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,505,943 - 28,539,196 (+) Ensembl
Ensembl Acc Id:
ENST00000411533 ⟹ ENSP00000413644
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,518,266 - 28,536,875 (+) Ensembl
Ensembl Acc Id:
ENST00000419074 ⟹ ENSP00000402260
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,510,077 - 28,536,026 (+) Ensembl
Ensembl Acc Id:
ENST00000427469 ⟹ ENSP00000402740
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,505,990 - 28,535,899 (+) Ensembl
Ensembl Acc Id:
ENST00000429051
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,531,935 - 28,535,905 (+) Ensembl
Ensembl Acc Id:
ENST00000430407 ⟹ ENSP00000394650
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,518,695 - 28,536,293 (+) Ensembl
Ensembl Acc Id:
ENST00000434290 ⟹ ENSP00000405258
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,506,056 - 28,535,919 (+) Ensembl
Ensembl Acc Id:
ENST00000478232
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,536,093 - 28,537,898 (+) Ensembl
Ensembl Acc Id:
ENST00000486790 ⟹ ENSP00000472057
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,518,626 - 28,531,818 (+) Ensembl
Ensembl Acc Id:
ENST00000649185 ⟹ ENSP00000497402
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,505,980 - 28,538,968 (+) Ensembl
Ensembl Acc Id:
ENST00000683442 ⟹ ENSP00000508074
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 1 28,506,043 - 28,538,989 (+) Ensembl
RefSeq Acc Id:
NM_001048194 ⟹ NP_001041659
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,518,226 - 28,538,989 (+) NCBI GRCh37 1 28,832,455 - 28,865,708 (+) ENTREZGENE Build 36 1 28,717,332 - 28,738,194 (+) NCBI Archive HuRef 1 27,086,264 - 27,119,463 (+) ENTREZGENE CHM1_1 1 28,960,278 - 28,981,201 (+) NCBI T2T-CHM13v2.0 1 28,360,182 - 28,380,949 (+) NCBI
Sequence:
AGAGGCCTGCAGAGCGCATGCTCTGGGGCAGTTCGCGGCCCGGCGGGGAGCGCCGGAGTTCCTTGTGGCCGACGTGCACCAAGGACAGGAAGATGTCACCCAAGCGCATAGCTAAAAGAAGGTCCCCC
hide sequence
RefSeq Acc Id:
NM_001048195 ⟹ NP_001041660
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,518,226 - 28,538,989 (+) NCBI GRCh37 1 28,832,455 - 28,865,708 (+) ENTREZGENE Build 36 1 28,717,332 - 28,738,194 (+) NCBI Archive HuRef 1 27,086,264 - 27,119,463 (+) ENTREZGENE CHM1_1 1 28,960,278 - 28,981,201 (+) NCBI T2T-CHM13v2.0 1 28,360,182 - 28,380,949 (+) NCBI
Sequence:
AGAGGCCTGCAGAGCGCATGCTCTGGGGCAGTTCGCGGCCCGGCGGGGAGCGCCGGAGTTCCTT
hide sequence
RefSeq Acc Id:
NM_001048199 ⟹ NP_001041664
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,506,043 - 28,538,989 (+) NCBI GRCh37 1 28,832,455 - 28,865,708 (+) NCBI HuRef 1 27,086,264 - 27,119,463 (+) NCBI CHM1_1 1 28,947,946 - 28,981,201 (+) NCBI T2T-CHM13v2.0 1 28,347,999 - 28,380,949 (+) NCBI
Sequence:
CCTTTTTGGAGACAGATTCGCAGTGGTCGCTTCTTCTCCTTGGATTTGTTAAGGATTCCAAGTA
hide sequence
RefSeq Acc Id:
NM_001269 ⟹ NP_001260
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,518,226 - 28,538,989 (+) NCBI GRCh37 1 28,832,455 - 28,865,708 (+) ENTREZGENE Build 36 1 28,717,332 - 28,738,194 (+) NCBI Archive HuRef 1 27,086,264 - 27,119,463 (+) ENTREZGENE CHM1_1 1 28,960,278 - 28,981,201 (+) NCBI T2T-CHM13v2.0 1 28,360,182 - 28,380,949 (+) NCBI
Sequence:
AGAGGCCTGCAGAGCGCATGCTCTGGGGCAGTTCGCGGCCCGGCGGGGAGCGCCGGAGTTCCTT
hide sequence
RefSeq Acc Id:
NM_001381865 ⟹ NP_001368794
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,506,043 - 28,538,989 (+) NCBI T2T-CHM13v2.0 1 28,347,999 - 28,380,949 (+) NCBI
Sequence:
CCTTTTTGGAGACAGATTCGCAGTGGTCGCTTCTTCTCCTTGGATTTGTTAAGGATTCCAAGTAACTCTTATTTGGAGAGAAGACGATCTGCACTTCGCATTTTGGCATTGACATTTAATTTTAGGGT
hide sequence
RefSeq Acc Id:
NM_001381866 ⟹ NP_001368795
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 1 28,506,043 - 28,538,989 (+) NCBI T2T-CHM13v2.0 1 28,347,999 - 28,380,949 (+) NCBI
Sequence:
CCTTTTTGGAGACAGATTCGCAGTGGTCGCTTCTTCTCCTTGGATTTGTTAAGGATTCCAAGTAACTCTTATTTGGAGAGAAGACGATCTGCACTTCGCATTTTGGCATTGACATTTAATTTTAGGGT
hide sequence
RefSeq Acc Id:
NP_001041659 ⟸ NM_001048194
- Peptide Label:
isoform a
- UniProtKB:
A0A0S2Z404 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
- Sequence:
MSPKRIAKRRSPPADAIPKSKKVKDTRAAASRRVPGARSCQGACGPSPPDQKTRPVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEG
hide sequence
RefSeq Acc Id:
NP_001041660 ⟸ NM_001048195
- Peptide Label:
isoform b
- UniProtKB:
A0A0S2Z3I4 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
- Sequence:
MSPKRIAKRRSPPADAIPKSKKVKDTRAAASRRVPGARSCQVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMV
hide sequence
RefSeq Acc Id:
NP_001260 ⟸ NM_001269
- Peptide Label:
isoform c
- UniProtKB:
Q16269 (UniProtKB/Swiss-Prot), Q6NT97 (UniProtKB/Swiss-Prot), P18754 (UniProtKB/Swiss-Prot), Q5T081 (UniProtKB/TrEMBL), A0A0S2Z3J1 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
- Sequence:
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVS
hide sequence
RefSeq Acc Id:
NP_001041664 ⟸ NM_001048199
- Peptide Label:
isoform c
- UniProtKB:
Q16269 (UniProtKB/Swiss-Prot), Q6NT97 (UniProtKB/Swiss-Prot), P18754 (UniProtKB/Swiss-Prot), Q5T081 (UniProtKB/TrEMBL), A0A0S2Z3J1 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
- Sequence:
MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGD
hide sequence
RefSeq Acc Id:
NP_001368794 ⟸ NM_001381865
- Peptide Label:
isoform c
- UniProtKB:
Q16269 (UniProtKB/Swiss-Prot), P18754 (UniProtKB/Swiss-Prot), Q6NT97 (UniProtKB/Swiss-Prot), A0A0S2Z3J1 (UniProtKB/TrEMBL), Q5T081 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001368795 ⟸ NM_001381866
- Peptide Label:
isoform c
- UniProtKB:
Q16269 (UniProtKB/Swiss-Prot), P18754 (UniProtKB/Swiss-Prot), Q6NT97 (UniProtKB/Swiss-Prot), A0A0S2Z3J1 (UniProtKB/TrEMBL), Q5T081 (UniProtKB/TrEMBL), C9JW69 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000381931 ⟸ ENST00000398958
Ensembl Acc Id:
ENSP00000497402 ⟸ ENST00000649185
Ensembl Acc Id:
ENSP00000413644 ⟸ ENST00000411533
Ensembl Acc Id:
ENSP00000362937 ⟸ ENST00000373831
Ensembl Acc Id:
ENSP00000362939 ⟸ ENST00000373833
Ensembl Acc Id:
ENSP00000362938 ⟸ ENST00000373832
Ensembl Acc Id:
ENSP00000402740 ⟸ ENST00000427469
Ensembl Acc Id:
ENSP00000402260 ⟸ ENST00000419074
Ensembl Acc Id:
ENSP00000394650 ⟸ ENST00000430407
Ensembl Acc Id:
ENSP00000472057 ⟸ ENST00000486790
Ensembl Acc Id:
ENSP00000405258 ⟸ ENST00000434290
Ensembl Acc Id:
ENSP00000508074 ⟸ ENST00000683442
RGD ID: 6854730 Promoter ID: EPDNEW_H530 Type: initiation region Name: RCC1_1 Description: regulator of chromosome condensation 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H531 EPDNEW_H532 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 28,506,044 - 28,506,104 EPDNEW
RGD ID: 6854732 Promoter ID: EPDNEW_H531 Type: initiation region Name: RCC1_3 Description: regulator of chromosome condensation 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H530 EPDNEW_H532 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 28,507,367 - 28,507,427 EPDNEW
RGD ID: 6854734 Promoter ID: EPDNEW_H532 Type: initiation region Name: RCC1_2 Description: regulator of chromosome condensation 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_H530 EPDNEW_H531 Experiment Methods: Single-end sequencing. Position: Human Assembly Chr Position (strand) Source GRCh38 1 28,518,252 - 28,518,312 EPDNEW
RGD ID: 6787138 Promoter ID: HG_KWN:1638 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000010325, UC001BQD.2 Position: Human Assembly Chr Position (strand) Source Build 36 1 28,707,621 - 28,709,907 (+) MPROMDB
RGD ID: 6785365 Promoter ID: HG_KWN:1640 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: ENST00000373832, NM_001048194, NM_001048195, OTTHUMT00000010326, OTTHUMT00000010328, OTTHUMT00000346590 Position: Human Assembly Chr Position (strand) Source Build 36 1 28,716,691 - 28,717,552 (+) MPROMDB
RGD ID: 6786402 Promoter ID: HG_KWN:1642 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, Lymphoblastoid Transcripts: OTTHUMT00000010329 Position: Human Assembly Chr Position (strand) Source Build 36 1 28,730,946 - 28,731,446 (+) MPROMDB
RGD ID: 6786403 Promoter ID: HG_KWN:1643 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3 Transcripts: OTTHUMT00000092194 Position: Human Assembly Chr Position (strand) Source Build 36 1 28,734,221 - 28,735,022 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-03-16
RCC1
regulator of chromosome condensation 1
SNHG3-RCC1
SNHG3-RCC1 readthrough transcript
Data merged from RGD:1642405
737654 PROVISIONAL
