Or2y1 (olfactory receptor family 2 subfamily Y member 1)

Advanced Search (OLGA)

Gene: Or2y1 (olfactory receptor family 2 subfamily Y member 1) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Or2y1 (Ensembl: Olr1396)

Name:

olfactory receptor family 2 subfamily Y member 1 (Ensembl:olfactory receptor 1396)

RGD ID:

1333440

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in detection of chemical stimulus involved in sensory perception of smell. Predicted to be active in plasma membrane. Orthologous to human OR2Y1 (olfactory receptor family 2 subfamily Y member 1).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1396; olfactory receptor gene Olr1396; olfactory receptor Olr1396; Olr1396

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	34,255,148 - 34,259,452 (+)	NCBI		GRCr8
mRatBN7.2	10	33,748,781 - 33,759,730 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	10	38,435,115 - 38,436,050 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	6,973,515 - 6,974,450 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	33,428,770 - 33,429,705 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	34,712,870 - 34,713,805 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	34,712,870 - 34,713,805 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	34,484,645 - 34,486,763 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	34,907,729 - 34,908,664 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	34,908,777 - 34,909,713 (+)	NCBI
Celera	10	33,128,373 - 33,129,308 (+)	NCBI		Celera
Cytogenetic Map	10	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

Molecular Function

olfactory receptor activity (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Variants

Variants in Or2y1
181 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	67
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000045600
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	27957626	34490668	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
631531	Iresp2	Immunoglobin response QTL2	6.3		blood immunoglobulin E amount (VT:0002492)	serum immunoglobulin E level (CMO:0002101)	10	22918268	36400810	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	mesenchyme	mesoderm	reproductive system	respiratory system
1	4	5	1	19	1	21	19	16	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001001093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000045600 ⟹ ENSRNOP00000047392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	34,712,870 - 34,713,805 (+)	Ensembl

RefSeq Acc Id:

NM_001001093 ⟹ NP_001001093

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	34,258,313 - 34,259,248 (+)	NCBI
mRatBN7.2	10	33,757,199 - 33,758,134 (+)	NCBI
Rnor_6.0	10	34,712,870 - 34,713,805 (+)	NCBI
Rnor_5.0	10	34,484,645 - 34,486,763 (+)	NCBI
RGSC_v3.4	10	34,907,729 - 34,908,664 (+)	RGD
Celera	10	33,128,373 - 33,129,308 (+)	RGD

Sequence:

show sequence

ATGGACAGTTTCAATGCCACTTTAGAAGAGAGATTCATTTTGGTGGGCTTTTCAGATTGGCCTC
AGCTGGAACTCATCCTTTTTGTTTTTATTTCAATTGTCTACTCCCTAACTCTCTTTGGCAACAC
CGCCATCATAGCTCTCTCCCGAATGGACCTTCGATTACACACCCCCATGTACTTCTTCCTCTCA
CACCTCTCCTTCCTGGACCTCTGCTACACCACCAGCACCGTGCCCCAGCTCCTGATCAACCTGC
ATGGACTTGACAGGATCATCAGCTATGGAAGGTGTGTGGCCCAGCTGTTTATATCTCTTGCTCT
GGGATCCACTGAGTGTGTGCTCCTGGTGGTGATGGCTTTTGACCGCTATGCTGCTGTGTGTCGT
CCACTGCACTACACGACCATCATGCACCCTGTTCTCTGCCAGGCATTGGCCATTGCTTCCTGGG
TAGGAGGCTTCTTGAACTCTCTGATTCAAACAGGACTCATGATGACCATACCGCTCTGTGGACG
CCGACTAAATCATTTCTTCTGTGAGATGCCTGTGCTCCTCAAGTTAGCCTGCAAGGACACAGGA
GATACAGAGGCCAAGATGTTTGTGGCCAGAGCCATAATCTTGGTCTTCCCTGCAACATTAATTC
TTGGCTCCTATGGACACATTGCTAGAGCAGTATTGAAGGTAAAGTCAATGGCTGGCCGCAGAAA
GGCTTTTGGGACATGTGGGTCCCACCTCCTGGTGGTTTCCCTGTTTTATGGCTCAGCCATTTAC
ACATACTTGCAACCCAAGGGTAGTTATTCTGAGAGTGATGGAAAGTTTGTTGCCCTTTTTTATA
CTATAGTGACTCCCATGCTCAACCCTTTGATCTATACCCTGAGGAACAAGGATGTGAAGGGCGC
TCTGTGGAAGGTGCTAGGGAGGAGCACAGGCCAAGAGTAG

hide sequence

RefSeq Acc Id:

XM_039086529 ⟹ XP_038942457

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	34,255,148 - 34,259,452 (+)	NCBI
mRatBN7.2	10	33,748,781 - 33,759,730 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001001093	(Get FASTA)	NCBI Sequence Viewer
	XP_038942457	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001001093 ⟸ NM_001001093

- UniProtKB:

D4A5P2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDSFNATLEERFILVGFSDWPQLELILFVFISIVYSLTLFGNTAIIALSRMDLRLHTPMYFFLS
HLSFLDLCYTTSTVPQLLINLHGLDRIISYGRCVAQLFISLALGSTECVLLVVMAFDRYAAVCR
PLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMTIPLCGRRLNHFFCEMPVLLKLACKDTG
DTEAKMFVARAIILVFPATLILGSYGHIARAVLKVKSMAGRRKAFGTCGSHLLVVSLFYGSAIY
TYLQPKGSYSESDGKFVALFYTIVTPMLNPLIYTLRNKDVKGALWKVLGRSTGQE

hide sequence

Ensembl Acc Id:

ENSRNOP00000047392 ⟸ ENSRNOT00000045600

RefSeq Acc Id:	XP_038942457 ⟸ XM_039086529
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A5P2-F1-model_v2	AlphaFold	D4A5P2	1-311	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1333440	AgrOrtholog
BioCyc Gene	G2FUF-25288	BioCyc
Ensembl Genes	ENSRNOG00000048331	Ensembl
NCBI Gene	405987	ENTREZGENE
PhenoGen	Or2y1	PhenoGen
RatGTEx	ENSRNOG00000048331	RatGTEx
UniProt	D4A5P2	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or2y1	olfactory receptor family 2 subfamily Y member 1	Olr1396	olfactory receptor 1396	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1396	olfactory receptor 1396	Olr1396_predicted	olfactory receptor 1396 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1396_predicted	olfactory receptor 1396 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype