Symbol:
Mvb12a
Name:
multivesicular body subunit 12A
RGD ID:
1331926
MGI Page
MGI
Description:
Predicted to enable lipid binding activity and ubiquitin binding activity. Predicted to be involved in several processes, including endosome to lysosome transport via multivesicular body sorting pathway; receptor catabolic process; and regulation of epidermal growth factor receptor signaling pathway. Predicted to be located in centrosome; intracellular membrane-bounded organelle; and vesicle. Predicted to be part of ESCRT I complex. Predicted to be active in cytosol. Is expressed in cerebral cortex ventricular layer and cortical plate. Orthologous to human MVB12A (multivesicular body subunit 12A).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
1110012M11Rik; ESCRT-I complex subunit MVB12A; Fam12; Fam125a; family with sequence similarity 125, member A; MGC99951
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MVB12A (multivesicular body subunit 12A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mvb12a (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mvb12a (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MVB12A (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MVB12A (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mvb12a (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MVB12A (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MVB12A (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mvb12a (multivesicular body subunit 12A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mvb12a (multivesicular body subunit 12A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MVB12A (multivesicular body subunit 12A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mvb12a (multivesicular body subunit 12A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
mvb-12
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Mvb12
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
mvb12a
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,995,552 - 72,000,670 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,995,566 - 72,000,729 (+) Ensembl GRCm39 Ensembl GRCm38 8 71,542,907 - 71,548,026 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 71,542,922 - 71,548,085 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 74,066,829 - 74,071,925 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 74,471,919 - 74,477,015 (+) NCBI MGSCv36 mm8 Celera 8 74,053,836 - 74,058,731 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mvb12a Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MVB12A mRNA CTD PMID:22206623 Mvb12a Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:735220 6480464 Tetrachlorodibenzodioxin results in decreased expression of MVB12A mRNA CTD PMID:21215274|PMID:32109520 Mvb12a Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MVB12A mRNA CTD PMID:21570461 Mvb12a Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of MVB12A mRNA CTD PMID:20188158 Mvb12a Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of MVB12A mRNA CTD PMID:39298647 Mvb12a Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of MVB12A mRNA CTD PMID:28973697 Mvb12a Mouse acrylamide decreases expression ISO RGD:1604253 6480464 Acrylamide results in decreased expression of MVB12A mRNA CTD PMID:32763439 Mvb12a Mouse arsane affects methylation ISO RGD:1604253 6480464 Arsenic affects the methylation of MVB12A gene CTD PMID:25304211 Mvb12a Mouse arsenic atom affects methylation ISO RGD:1604253 6480464 Arsenic affects the methylation of MVB12A gene CTD PMID:25304211 Mvb12a Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MVB12A mRNA CTD PMID:22228805 Mvb12a Mouse benzo[a]pyrene increases methylation ISO RGD:1604253 6480464 Benzo(a)pyrene results in increased methylation of MVB12A 3' UTR CTD PMID:27901495 Mvb12a Mouse beta-lapachone decreases expression ISO RGD:1604253 6480464 beta-lapachone results in decreased expression of MVB12A mRNA CTD PMID:38218311 Mvb12a Mouse bisphenol A increases expression ISO RGD:735220 6480464 bisphenol A results in increased expression of MVB12A mRNA CTD PMID:25181051 Mvb12a Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MVB12A mRNA CTD PMID:33221593 Mvb12a Mouse bisphenol A decreases expression ISO RGD:735220 6480464 bisphenol A results in decreased expression of MVB12A mRNA CTD PMID:33296240 Mvb12a Mouse cadmium dichloride decreases methylation ISO RGD:735220 6480464 Cadmium Chloride results in decreased methylation of MVB12A promoter CTD PMID:22457795 Mvb12a Mouse caffeine increases phosphorylation ISO RGD:1604253 6480464 Caffeine results in increased phosphorylation of MVB12A protein CTD PMID:35688186 Mvb12a Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of MVB12A mRNA CTD PMID:37019170 Mvb12a Mouse cobalt dichloride decreases expression ISO RGD:1604253 6480464 cobaltous chloride results in decreased expression of MVB12A mRNA CTD PMID:19320972 Mvb12a Mouse copper(II) sulfate increases expression ISO RGD:1604253 6480464 Copper Sulfate results in increased expression of MVB12A mRNA CTD PMID:19549813 Mvb12a Mouse cytarabine decreases expression ISO RGD:1604253 6480464 Cytarabine results in decreased expression of MVB12A mRNA CTD PMID:21198554 Mvb12a Mouse Dibutyl phosphate affects expression ISO RGD:1604253 6480464 di-n-butylphosphoric acid affects the expression of MVB12A mRNA CTD PMID:37042841 Mvb12a Mouse dibutyl phthalate increases expression ISO RGD:735220 6480464 Dibutyl Phthalate results in increased expression of MVB12A mRNA CTD PMID:21266533 Mvb12a Mouse disodium selenite increases expression ISO RGD:1604253 6480464 Sodium Selenite results in increased expression of MVB12A mRNA CTD PMID:18175754 Mvb12a Mouse dorsomorphin multiple interactions ISO RGD:1604253 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mvb12a Mouse doxorubicin decreases expression ISO RGD:1604253 6480464 Doxorubicin results in decreased expression of MVB12A mRNA CTD PMID:29803840 Mvb12a Mouse entinostat increases expression ISO RGD:1604253 6480464 entinostat results in increased expression of MVB12A mRNA CTD PMID:27188386 Mvb12a Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of MVB12A mRNA CTD PMID:34813904 Mvb12a Mouse folic acid multiple interactions EXP 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MVB12A mRNA CTD PMID:22206623 Mvb12a Mouse FR900359 affects phosphorylation ISO RGD:1604253 6480464 FR900359 affects the phosphorylation of MVB12A protein CTD PMID:37730182 Mvb12a Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of MVB12A mRNA CTD PMID:34813904 Mvb12a Mouse methylmercury chloride decreases expression ISO RGD:1604253 6480464 methylmercuric chloride results in decreased expression of MVB12A mRNA CTD PMID:27188386 Mvb12a Mouse nickel atom increases expression ISO RGD:1604253 6480464 Nickel results in increased expression of MVB12A mRNA CTD PMID:24768652|PMID:25583101 Mvb12a Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MVB12A more ... CTD PMID:35964746 Mvb12a Mouse panobinostat multiple interactions ISO RGD:1604253 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mvb12a Mouse panobinostat decreases expression ISO RGD:1604253 6480464 panobinostat results in decreased expression of MVB12A mRNA CTD PMID:26272509 Mvb12a Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of MVB12A mRNA CTD PMID:17562736 Mvb12a Mouse paracetamol decreases expression ISO RGD:735220 6480464 Acetaminophen results in decreased expression of MVB12A mRNA CTD PMID:33387578 Mvb12a Mouse phenylmercury acetate decreases expression ISO RGD:1604253 6480464 Phenylmercuric Acetate results in decreased expression of MVB12A mRNA CTD PMID:26272509 Mvb12a Mouse phenylmercury acetate multiple interactions ISO RGD:1604253 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Mvb12a Mouse propanal decreases expression ISO RGD:1604253 6480464 propionaldehyde results in decreased expression of MVB12A mRNA CTD PMID:26079696 Mvb12a Mouse resveratrol multiple interactions ISO RGD:1604253 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of MVB12A mRNA CTD PMID:23557933 Mvb12a Mouse SB 431542 multiple interactions ISO RGD:1604253 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Mvb12a Mouse sodium arsenite multiple interactions ISO RGD:1604253 6480464 sodium arsenite promotes the reaction [MVB12A protein binds to CAPRIN1 protein] CTD PMID:33939924 Mvb12a Mouse temozolomide increases expression ISO RGD:1604253 6480464 Temozolomide results in increased expression of MVB12A mRNA CTD PMID:31758290 Mvb12a Mouse testosterone increases expression ISO RGD:1604253 6480464 Testosterone results in increased expression of MVB12A mRNA CTD PMID:33359661 Mvb12a Mouse tetrachloroethene decreases expression EXP 6480464 Tetrachloroethylene results in decreased expression of MVB12A mRNA CTD PMID:28973375 Mvb12a Mouse thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of MVB12A protein CTD PMID:24648495 Mvb12a Mouse thimerosal decreases expression ISO RGD:1604253 6480464 Thimerosal results in decreased expression of MVB12A mRNA CTD PMID:27188386 Mvb12a Mouse thiram decreases expression ISO RGD:1604253 6480464 Thiram results in decreased expression of MVB12A mRNA CTD PMID:38568856 Mvb12a Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of MVB12A gene CTD PMID:35295148 Mvb12a Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of MVB12A promoter alternative form CTD PMID:35295148 Mvb12a Mouse triphenyl phosphate affects expression ISO RGD:1604253 6480464 triphenyl phosphate affects the expression of MVB12A mRNA CTD PMID:37042841 Mvb12a Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of MVB12A mRNA CTD PMID:33045310 Mvb12a Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of MVB12A mRNA CTD PMID:17963808 Mvb12a Mouse valproic acid increases expression ISO RGD:1604253 6480464 Valproic Acid results in increased expression of MVB12A mRNA CTD PMID:23179753|PMID:27188386 Mvb12a Mouse valproic acid affects expression ISO RGD:1604253 6480464 Valproic Acid affects the expression of MVB12A mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) acrylamide (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) chlorpyrifos (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) cytarabine (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (ISO) disodium selenite (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) fenthion (EXP) folic acid (EXP) FR900359 (ISO) methidathion (EXP) methylmercury chloride (ISO) nickel atom (ISO) nitrates (EXP) panobinostat (ISO) paracetamol (EXP,ISO) phenylmercury acetate (ISO) propanal (ISO) resveratrol (ISO) SB 431542 (ISO) sodium arsenite (ISO) temozolomide (ISO) testosterone (ISO) tetrachloroethene (EXP) thapsigargin (EXP) thimerosal (ISO) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) triptonide (EXP) valproic acid (EXP,ISO)
Mvb12a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 71,995,552 - 72,000,670 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 71,995,566 - 72,000,729 (+) Ensembl GRCm39 Ensembl GRCm38 8 71,542,907 - 71,548,026 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 71,542,922 - 71,548,085 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 74,066,829 - 74,071,925 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 74,471,919 - 74,477,015 (+) NCBI MGSCv36 mm8 Celera 8 74,053,836 - 74,058,731 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.43 NCBI
MVB12A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 17,405,741 - 17,425,332 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 17,405,722 - 17,433,724 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 17,516,550 - 17,536,141 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 17,391,912 - 17,397,140 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 19 17,432,663 - 17,437,892 (+) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 17,096,852 - 17,102,055 (+) NCBI HuRef CHM1_1 19 17,530,417 - 17,535,642 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 17,540,476 - 17,560,094 (+) NCBI T2T-CHM13v2.0
Mvb12a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 18,286,231 - 18,291,096 (+) NCBI GRCr8 mRatBN7.2 16 18,252,227 - 18,257,111 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 18,252,222 - 18,257,539 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 18,303,210 - 18,308,039 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 19,436,449 - 19,441,045 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 18,356,148 - 18,360,977 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 19,973,611 - 19,978,479 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 19,973,636 - 19,978,478 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 19,833,926 - 19,838,784 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 18,726,945 - 18,731,772 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 18,726,942 - 18,731,769 (+) NCBI Celera 16 18,457,206 - 18,462,083 (+) NCBI Celera Cytogenetic Map 16 p14 NCBI
Mvb12a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955524 839,328 - 840,664 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955524 839,328 - 842,160 (-) NCBI ChiLan1.0 ChiLan1.0
MVB12A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 22,289,570 - 22,294,844 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 21,296,143 - 21,301,414 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 16,906,449 - 16,911,717 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 17,880,073 - 17,885,546 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 17,880,073 - 17,894,044 (+) Ensembl panpan1.1 panPan2
MVB12A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 45,365,850 - 45,370,114 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 45,365,852 - 45,370,014 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 45,279,673 - 45,283,942 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 45,853,051 - 45,857,318 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 45,852,450 - 45,857,513 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 45,089,402 - 45,093,830 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 45,499,205 - 45,503,471 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 45,775,232 - 45,779,500 (-) NCBI UU_Cfam_GSD_1.0
Mvb12a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 203,929,003 - 203,932,598 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936596 3,477,690 - 3,481,968 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936596 3,478,142 - 3,481,968 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MVB12A
MVB12A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 15,917,568 - 15,923,168 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 15,917,539 - 15,923,361 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 3,512,867 - 3,519,567 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mvb12a
.
Predicted Target Of
Count of predictions: 231 Count of miRNA genes: 201 Interacting mature miRNAs: 221 Transcripts: ENSMUST00000034272 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10043992 Hbnr11_m Heligmosomoides bakeri nematode resistance 11 (mouse) Not determined 8 66326836 100326976 Mouse 1301013 Capsq4_m capsaicin sensitivity related QTL 4 (mouse) Not determined 8 36630154 93455280 Mouse 1301717 Adip4_m adiposity 4 (mouse) Not determined 8 48090064 82090180 Mouse 1357715 Alaa3_m alopecia areata 3 (mouse) Not determined 8 49245591 83245673 Mouse 11353828 Gf7_m gonadal fat pad weight 7 (mouse) 8 58928107 92928107 Mouse 14746987 Manh64_m mandible shape 64 (mouse) 8 50505958 84505958 Mouse 1558875 Eae31_m experimental allergic encephalomyelitis susceptibility 31 (mouse) Not determined 8 35109930 115563747 Mouse 1357787 Vtbt5_m vertebral trabecular bone trait 5 (mouse) Not determined 8 66084397 100084549 Mouse 10766453 Char11_m P. chabaudi malaria resistance QTL 11 (mouse) 8 48090064 82090180 Mouse 1301506 Aevm1_m autoimmune extremity vasculitis in MRL mice 1 (mouse) Not determined 8 54740461 88740637 Mouse 1301441 Skull11_m skull morphology 11 (mouse) Not determined 8 48190168 82190288 Mouse 1301952 Im3_m immunoregulatory 3 (mouse) Not determined 8 55159258 89159407 Mouse 1301767 Fcsa2_m femoral cross-sectional area 2 (mouse) Not determined 8 71032003 105032123 Mouse 4140967 Bmd39_m bone mineral density 39 (mouse) Not determined 8 32506572 117965439 Mouse 1357708 Orq1_m ovulation rate QTL 1 (mouse) Not determined 8 71740461 124622354 Mouse 4141285 Tgq18_m triglyceride QTL 18 (mouse) Not determined 64186736 98186736 Mouse 4141797 Skmw16_m skeletal muscle weight 16 (mouse) Not determined 8 64666176 98666325 Mouse 14747005 Mancz7_m mandible centroid size 7 (mouse) 8 50505958 84505958 Mouse 27226754 Femd6_m femur midshaft diameter 6, 10 week (mouse) 8 37867154 110326632 Mouse 10043975 Obq31_m obesity QTL 31 (mouse) Not determined 8 59136404 93136404 Mouse 10412287 Carg3_m Candida albicans resistance gene 3 (mouse) Not determined 8 56298872 90298872 Mouse 10766466 Char12_m P. chabaudi malaria resistance QTL 12 (mouse) 8 68722479 83326976 Mouse 11039503 Ccc4_m colitis susceptibility in the Collaborative Cross 4 (mouse) 8 65174237 78002730 Mouse 1301688 Orch6_m autoimmune orchitis resistance 6 (mouse) Not determined 8 61513479 95513605 Mouse 1558780 Idd22_m insulin dependent diabetes susceptibility 22 (mouse) Not determined 8 71829531 105829637 Mouse 12904744 Carcdq1_m cardiac collagen deposition QTL 1 (mouse) 8 40162297 95416226 Mouse 4141395 Char2a_m P. chabaudi malaria resistance QTL 2a (mouse) Not determined 71589427 90929226 Mouse 14700686 Civq3_m cerebral infarct volume QTL 3 (mouse) 8 52334843 86334843 Mouse 4142283 Imraq2_m immune response to AAV2 QTL 2 (mouse) Not determined 8 71032003 105032123 Mouse 4142023 W3q5_m weight 3 weeks QTL 5 (mouse) Not determined 71740461 124622354 Mouse 1301544 Iba3_m induction of brown adipocytes 3 (mouse) Not determined 8 44747914 78748059 Mouse
UniSTS:235924
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 71,547,898 - 71,548,188 UniSTS GRCm38 MGSCv37 8 74,071,797 - 74,072,087 UniSTS GRCm37 Celera 8 74,058,603 - 74,058,893 UniSTS Cytogenetic Map 8 C1 UniSTS
RH140984
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 71,547,764 - 71,547,966 UniSTS GRCm38 MGSCv37 8 74,071,663 - 74,071,865 UniSTS GRCm37 Celera 8 74,058,469 - 74,058,671 UniSTS Cytogenetic Map 8 C1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000034272 ⟹ ENSMUSP00000034272
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,995,574 - 72,000,670 (+) Ensembl GRCm38.p6 Ensembl 8 71,542,930 - 71,548,026 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212234
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,995,583 - 71,996,199 (+) Ensembl GRCm38.p6 Ensembl 8 71,542,939 - 71,543,555 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212326 ⟹ ENSMUSP00000148449
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,995,587 - 71,998,364 (+) Ensembl GRCm38.p6 Ensembl 8 71,542,943 - 71,545,720 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212336
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,999,376 - 72,000,729 (+) Ensembl GRCm38.p6 Ensembl 8 71,546,732 - 71,548,085 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212341
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,995,572 - 71,997,165 (+) Ensembl GRCm38.p6 Ensembl 8 71,542,928 - 71,544,521 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212659
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,997,503 - 71,998,595 (+) Ensembl GRCm38.p6 Ensembl 8 71,544,859 - 71,545,951 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000212954 ⟹ ENSMUSP00000148630
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 8 71,995,566 - 71,998,220 (+) Ensembl GRCm38.p6 Ensembl 8 71,542,922 - 71,545,576 (+) Ensembl
RefSeq Acc Id:
NM_028617 ⟹ NP_082893
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,995,574 - 72,000,670 (+) NCBI GRCm38 8 71,542,930 - 71,548,026 (+) NCBI MGSCv37 8 74,066,829 - 74,071,925 (+) RGD Celera 8 74,053,836 - 74,058,731 (+) RGD cM Map 8 ENTREZGENE
Sequence:
GGTCCCTCCGAGGGCTGTAGCTGCCTTCTGAGCTCCCAGGAAGGATGGATCCCGGGACGGACTCGGCGCCGCTTGCTGGCTTGGTTTGGTCGTCGGCCTCGGCGCCGCCGCCGCCGGGTTTCAGCGCG
hide sequence
RefSeq Acc Id:
XM_011242330 ⟹ XP_011240632
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,995,552 - 72,000,670 (+) NCBI GRCm38 8 71,542,907 - 71,548,026 (+) NCBI
Sequence:
GGGAGTTGTAGTCCGAGGTTCCGGTCCCTCCGAGGGCTGTAGCTGCCTTCTGAGCTCCCAGGAA
hide sequence
RefSeq Acc Id:
XM_030243804 ⟹ XP_030099664
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 8 71,995,552 - 72,000,670 (+) NCBI GRCm38 8 71,542,907 - 71,548,026 (+) NCBI
Sequence:
GGGAGTTGTAGTCCGAGGTTCCGGTCCCTCCGAGGGCTGTAGCTGCCTTCTGAGCTCCCAGGAAGGATGGATCCCGGGACGGACTCGGCGCCGCTTGCTGGCTTGGTTTGGTCGTCGGCCTCGGCGCC
hide sequence
RefSeq Acc Id:
NP_082893 ⟸ NM_028617
- UniProtKB:
Q78HU3 (UniProtKB/Swiss-Prot)
- Sequence:
MDPGTDSAPLAGLVWSSASAPPPPGFSAITCTVEGGTASFGRGFAQKAGYFLCLSTLGIPENPQDNVVVDMQIVMDKGPLPSGFSAVNDPQDIKASVSKKKRMCVKLMPLGTADVVVSDVKLSGKTKT
hide sequence
RefSeq Acc Id:
XP_011240632 ⟸ XM_011242330
- Peptide Label:
isoform X1
- Sequence:
MDPGTDSAPLAGLVWSSASAPPPPGFSAITCTVEGGTASFGRGFAQKAGYFLCLSTLGIPEALA
hide sequence
RefSeq Acc Id:
XP_030099664 ⟸ XM_030243804
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSMUSP00000034272 ⟸ ENSMUST00000034272
Ensembl Acc Id:
ENSMUSP00000148630 ⟸ ENSMUST00000212954
Ensembl Acc Id:
ENSMUSP00000148449 ⟸ ENSMUST00000212326
RGD ID: 8667407 Promoter ID: EPDNEW_M11735 Type: initiation region Name: Mvb12a_1 Description: Mus musculus multivesicular body subunit 12A , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 8 71,542,922 - 71,542,982 EPDNEW
RGD ID: 6842467 Promoter ID: MM_KWN:54794 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day2, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_028617, UC009MDS.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 8 74,066,536 - 74,067,072 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-01-08
Mvb12a
multivesicular body subunit 12A
Fam125a
family with sequence similarity 125, member A
Symbol and/or name change
5135510 APPROVED
