Symbol:
Pals2
Name:
protein associated with LIN7 2, MAGUK family member
RGD ID:
1323498
MGI Page
MGI
Description:
Predicted to enable guanylate kinase activity. Predicted to be involved in GDP metabolic process and GMP metabolic process. Located in plasma membrane. Is expressed in heart. Orthologous to human PALS2 (protein associated with LIN7 2, MAGUK p55 family member).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
dlgh4 protein; Fibroblast growth factor-inducible protein 15; MAGUK p55 subfamily member 6; membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 6); membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6); Mpp6; P; P55; P55t; protein associated with Lin-7 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Pals2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pals2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pals2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pals2 (protein associated with LIN7 2, MAGUK p55 family member) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MPP2 (MAGUK p55 scaffold protein 2) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Pals2 (protein associated with LIN7 2, MAGUK p55 family member)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PALS2 (protein associated with LIN7 2, MAGUK p55 family member)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mpp6b (membrane protein, palmitoylated 6b (MAGUK p55 subfamily member 6))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
mpp6a (membrane protein, palmitoylated 6a (MAGUK p55 subfamily member 6))
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
vari
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
magu-3
Alliance
DIOPT (Ensembl Compara|PANTHER)
Xenopus tropicalis (tropical clawed frog):
pals2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 50,087,206 - 50,176,134 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 50,087,221 - 50,175,919 (+) Ensembl GRCm39 Ensembl GRCm38 6 50,110,228 - 50,199,154 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 50,110,241 - 50,198,939 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 50,060,240 - 50,148,597 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 50,039,963 - 50,128,169 (+) NCBI MGSCv36 mm8 Celera 6 50,618,750 - 50,708,304 (+) NCBI Celera Cytogenetic Map 6 B2.3 NCBI cM Map 6 24.13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pals2 Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1323497 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PALS2 mRNA CTD PMID:22079256 Pals2 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1,2-Dimethylhydrazine results in decreased expression of PALS2 mRNA CTD PMID:22206623 Pals2 Mouse 17alpha-ethynylestradiol increases expression ISO RGD:1311833 6480464 Ethinyl Estradiol results in increased expression of PALS2 mRNA CTD PMID:29097150 Pals2 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PALS2 mRNA CTD PMID:17555576 Pals2 Mouse 17beta-estradiol multiple interactions ISO RGD:1323497 6480464 EGF protein promotes the reaction [Estradiol results in increased expression of PALS2 mRNA] CTD PMID:24758408 Pals2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PALS2 mRNA CTD PMID:39298647 Pals2 Mouse 17beta-estradiol increases expression ISO RGD:1323497 6480464 Estradiol results in increased expression of PALS2 mRNA CTD PMID:23019147|PMID:24758408 Pals2 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2,3',4,4',5-pentachlorobiphenyl results in increased expression of PALS2 mRNA CTD PMID:31388691 Pals2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1323497 6480464 Tetrachlorodibenzodioxin results in decreased expression of PALS2 mRNA CTD PMID:21632981 Pals2 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1311833 6480464 Tetrachlorodibenzodioxin results in decreased expression of PALS2 mRNA CTD PMID:21215274 Pals2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PALS2 promoter] CTD PMID:19654925 Pals2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PALS2 mRNA CTD PMID:21570461 Pals2 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PALS2 mRNA CTD PMID:32553695 Pals2 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of MPP6 mRNA CTD PMID:38648751 Pals2 Mouse 2-methylcholine affects expression ISO RGD:1323497 6480464 beta-methylcholine affects the expression of PALS2 mRNA CTD PMID:21179406 Pals2 Mouse 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1311833 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PALS2 mRNA CTD PMID:30071829 Pals2 Mouse 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of PALS2 mRNA CTD PMID:20713471 Pals2 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of PALS2 mRNA CTD PMID:39298647 Pals2 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of PALS2 mRNA CTD PMID:28973697 Pals2 Mouse 5-aza-2'-deoxycytidine affects expression ISO RGD:1323497 6480464 Decitabine affects the expression of PALS2 mRNA CTD PMID:23300844 Pals2 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1311833 6480464 Propylthiouracil results in decreased expression of PALS2 mRNA CTD PMID:24780913 Pals2 Mouse acetamide decreases expression ISO RGD:1311833 6480464 acetamide results in decreased expression of PALS2 mRNA CTD PMID:31881176 Pals2 Mouse aflatoxin B1 decreases methylation ISO RGD:1323497 6480464 Aflatoxin B1 results in decreased methylation of PALS2 gene CTD PMID:27153756 Pals2 Mouse all-trans-retinoic acid decreases expression ISO RGD:1323497 6480464 Tretinoin results in decreased expression of PALS2 mRNA CTD PMID:21934132 Pals2 Mouse all-trans-retinoic acid multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of MPP6 mRNA CTD PMID:36189433 Pals2 Mouse all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of MPP6 mRNA CTD PMID:36189433 Pals2 Mouse antirheumatic drug increases expression ISO RGD:1323497 6480464 Antirheumatic Agents results in increased expression of PALS2 mRNA CTD PMID:24449571 Pals2 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PALS2 mRNA CTD PMID:23650126 Pals2 Mouse benzo[a]pyrene decreases expression ISO RGD:1323497 6480464 Benzo(a)pyrene results in decreased expression of PALS2 mRNA CTD PMID:20064835 Pals2 Mouse benzo[a]pyrene affects methylation ISO RGD:1323497 6480464 Benzo(a)pyrene affects the methylation of PALS2 5' UTR CTD PMID:27901495 Pals2 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene results in increased activity of AHR protein] which results in increased expression of PALS2 more ... CTD PMID:32553695 Pals2 Mouse benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of PALS2 intron CTD PMID:27901495 Pals2 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene metabolite results in increased expression of PALS2 mRNA; Benzo(a)pyrene results in increased expression of more ... CTD PMID:20713471|PMID:22228805|PMID:32553695 Pals2 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1323497 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PALS2 mRNA CTD PMID:19150397 Pals2 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of MPP6 mRNA CTD PMID:33754040 Pals2 Mouse bisphenol A increases expression ISO RGD:1311833 6480464 bisphenol A results in increased expression of PALS2 mRNA CTD PMID:30816183|PMID:34947998 Pals2 Mouse bisphenol A decreases expression ISO RGD:1323497 6480464 bisphenol A results in decreased expression of PALS2 protein CTD PMID:37567409 Pals2 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PALS2 mRNA CTD PMID:33221593 Pals2 Mouse bisphenol A increases methylation ISO RGD:1311833 6480464 bisphenol A results in increased methylation of PALS2 gene CTD PMID:28505145 Pals2 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PALS2 mRNA alternative form CTD PMID:31020848 Pals2 Mouse bisphenol A decreases expression ISO RGD:1311833 6480464 bisphenol A results in decreased expression of PALS2 mRNA CTD PMID:25181051 Pals2 Mouse bisphenol A affects response to substance EXP 6480464 PALS2 mRNA alternative form affects the susceptibility to bisphenol A CTD PMID:31020848 Pals2 Mouse Bisphenol B increases expression ISO RGD:1323497 6480464 bisphenol B results in increased expression of PALS2 protein CTD PMID:34186270 Pals2 Mouse bisphenol F increases expression ISO RGD:1323497 6480464 bisphenol F results in increased expression of PALS2 protein CTD PMID:34186270 Pals2 Mouse cadmium dichloride decreases expression ISO RGD:1323497 6480464 Cadmium Chloride results in decreased expression of PALS2 mRNA CTD PMID:25851441 Pals2 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of PALS2 mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Pals2 Mouse CGP 52608 multiple interactions ISO RGD:1323497 6480464 CGP 52608 promotes the reaction [RORA protein binds to PALS2 gene] CTD PMID:28238834 Pals2 Mouse chlordecone decreases expression EXP 6480464 Chlordecone results in decreased expression of PALS2 mRNA CTD PMID:33711761 Pals2 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of PALS2 mRNA CTD PMID:37019170 Pals2 Mouse cisplatin affects expression ISO RGD:1323497 6480464 Cisplatin affects the expression of PALS2 mRNA CTD PMID:23300844 Pals2 Mouse Cuprizon increases expression ISO RGD:1311833 6480464 Cuprizone results in increased expression of PALS2 mRNA CTD PMID:27523638 Pals2 Mouse cyclosporin A increases expression ISO RGD:1323497 6480464 Cyclosporine results in increased expression of PALS2 mRNA CTD PMID:25562108 Pals2 Mouse cyclosporin A decreases expression ISO RGD:1311833 6480464 Cyclosporine results in decreased expression of PALS2 mRNA CTD PMID:21865292 Pals2 Mouse cytarabine decreases expression ISO RGD:1323497 6480464 Cytarabine results in decreased expression of PALS2 mRNA CTD PMID:21198554 Pals2 Mouse diethylstilbestrol increases expression ISO RGD:1323497 6480464 Diethylstilbestrol results in increased expression of PALS2 mRNA CTD PMID:36621641 Pals2 Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PALS2 mRNA CTD PMID:30529165 Pals2 Mouse diuron increases expression ISO RGD:1311833 6480464 Diuron results in increased expression of PALS2 mRNA CTD PMID:25152437 Pals2 Mouse ethyl methanesulfonate decreases expression ISO RGD:1323497 6480464 Ethyl Methanesulfonate results in decreased expression of PALS2 mRNA CTD PMID:23649840 Pals2 Mouse formaldehyde decreases expression ISO RGD:1323497 6480464 Formaldehyde results in decreased expression of PALS2 mRNA CTD PMID:23649840 Pals2 Mouse furan decreases expression ISO RGD:1311833 6480464 furan results in decreased expression of PALS2 mRNA CTD PMID:27387713 Pals2 Mouse furan increases methylation ISO RGD:1311833 6480464 furan results in increased methylation of PALS2 gene CTD PMID:22079235|PMID:27387713 Pals2 Mouse Indeno[1,2,3-cd]pyrene decreases expression EXP 6480464 indeno(1,2,3-cd)pyrene results in decreased expression of PALS2 mRNA CTD PMID:26377693 Pals2 Mouse indole-3-methanol multiple interactions ISO RGD:1311833 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of PALS2 mRNA CTD PMID:22129741 Pals2 Mouse ivermectin decreases expression ISO RGD:1323497 6480464 Ivermectin results in decreased expression of PALS2 protein CTD PMID:32959892 Pals2 Mouse lead diacetate decreases expression ISO RGD:1311833 6480464 lead acetate results in decreased expression of PALS2 mRNA CTD PMID:11578147 Pals2 Mouse methapyrilene decreases expression ISO RGD:1311833 6480464 Methapyrilene results in decreased expression of PALS2 mRNA CTD PMID:30467583 Pals2 Mouse methyl methanesulfonate decreases expression ISO RGD:1323497 6480464 Methyl Methanesulfonate results in decreased expression of PALS2 mRNA CTD PMID:23649840 Pals2 Mouse methylmercury chloride decreases expression ISO RGD:1323497 6480464 methylmercuric chloride results in decreased expression of PALS2 mRNA CTD PMID:23179753|PMID:28001369 Pals2 Mouse mono(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of MPP6 mRNA CTD PMID:36189433 Pals2 Mouse N-nitrosodiethylamine multiple interactions ISO RGD:1311833 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of PALS2 mRNA CTD PMID:22129741 Pals2 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:34911549 Pals2 Mouse p-toluidine decreases expression ISO RGD:1311833 6480464 4-toluidine results in decreased expression of PALS2 mRNA CTD PMID:27638505 Pals2 Mouse paracetamol increases expression ISO RGD:1323497 6480464 Acetaminophen results in increased expression of PALS2 mRNA CTD PMID:26690555 Pals2 Mouse paracetamol increases expression ISO RGD:1311833 6480464 Acetaminophen results in increased expression of MPP6 mRNA CTD PMID:33387578 Pals2 Mouse paraquat increases expression ISO RGD:1311833 6480464 Paraquat results in increased expression of MPP6 mRNA CTD PMID:32680482 Pals2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of MPP6 mRNA CTD PMID:36331819 Pals2 Mouse phenobarbital affects expression ISO RGD:1323497 6480464 Phenobarbital affects the expression of PALS2 mRNA CTD PMID:19159669 Pals2 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PALS2 mRNA CTD PMID:23091169 Pals2 Mouse potassium chromate decreases expression ISO RGD:1323497 6480464 potassium chromate(VI) results in decreased expression of PALS2 mRNA CTD PMID:22079256 Pals2 Mouse potassium chromate multiple interactions ISO RGD:1323497 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PALS2 mRNA CTD PMID:22079256 Pals2 Mouse quercetin decreases expression ISO RGD:1323497 6480464 Quercetin results in decreased expression of PALS2 mRNA CTD PMID:21632981 Pals2 Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of PALS2 mRNA CTD PMID:21641980 Pals2 Mouse sunitinib increases expression ISO RGD:1323497 6480464 Sunitinib results in increased expression of PALS2 mRNA CTD PMID:31533062 Pals2 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PALS2 mRNA CTD PMID:17555576 Pals2 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PALS2 mRNA CTD PMID:31919559 Pals2 Mouse thioacetamide decreases expression ISO RGD:1311833 6480464 Thioacetamide results in decreased expression of PALS2 mRNA CTD PMID:34492290 Pals2 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of PALS2 mRNA CTD PMID:23557971 Pals2 Mouse trichostatin A increases expression ISO RGD:1323497 6480464 trichostatin A results in increased expression of PALS2 mRNA CTD PMID:24935251 Pals2 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of PALS2 mRNA CTD PMID:33045310 Pals2 Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of MPP6 mRNA CTD PMID:35537566 Pals2 Mouse valproic acid affects expression ISO RGD:1323497 6480464 Valproic Acid affects the expression of PALS2 mRNA CTD PMID:25979313 Pals2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PALS2 mRNA CTD PMID:17963808 Pals2 Mouse vinclozolin affects expression ISO RGD:1311833 6480464 vinclozolin affects the expression of PALS2 mRNA CTD PMID:19015723
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxyphenyl retinamide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (EXP,ISO) antirheumatic drug (ISO) Aroclor 1254 (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlordecone (EXP) chlorpyrifos (EXP) cisplatin (ISO) Cuprizon (ISO) cyclosporin A (ISO) cytarabine (ISO) diethylstilbestrol (ISO) dioxygen (EXP) diuron (ISO) ethyl methanesulfonate (ISO) formaldehyde (ISO) furan (ISO) Indeno[1,2,3-cd]pyrene (EXP) indole-3-methanol (ISO) ivermectin (ISO) lead diacetate (ISO) methapyrilene (ISO) methyl methanesulfonate (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (EXP) N-nitrosodiethylamine (ISO) ozone (EXP) p-toluidine (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP,ISO) potassium chromate (ISO) quercetin (ISO) succimer (EXP) sunitinib (ISO) tamoxifen (EXP) tetrachloromethane (EXP) thioacetamide (ISO) titanium dioxide (EXP) trichostatin A (ISO) triptonide (EXP) trovafloxacin (EXP) valproic acid (EXP,ISO) vinclozolin (ISO)
Pals2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 50,087,206 - 50,176,134 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 50,087,221 - 50,175,919 (+) Ensembl GRCm39 Ensembl GRCm38 6 50,110,228 - 50,199,154 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 50,110,241 - 50,198,939 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 50,060,240 - 50,148,597 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 50,039,963 - 50,128,169 (+) NCBI MGSCv36 mm8 Celera 6 50,618,750 - 50,708,304 (+) NCBI Celera Cytogenetic Map 6 B2.3 NCBI cM Map 6 24.13 NCBI
PALS2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 24,573,452 - 24,694,193 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 24,573,268 - 24,694,193 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 24,613,071 - 24,733,812 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 24,579,610 - 24,694,023 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 24,386,324 - 24,500,737 NCBI Celera 7 24,601,884 - 24,715,973 (+) NCBI Celera Cytogenetic Map 7 p15.3 NCBI HuRef 7 24,544,555 - 24,612,058 (+) NCBI HuRef CHM1_1 7 24,614,653 - 24,729,063 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 24,711,447 - 24,832,205 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 24,664,991 - 24,779,052 (+) NCBI
Pals2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 80,504,298 - 80,584,951 (+) NCBI GRCr8 mRatBN7.2 4 79,173,488 - 79,257,542 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 79,124,806 - 79,254,140 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 84,389,410 - 84,474,228 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 80,164,949 - 80,249,755 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 78,605,243 - 78,690,062 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 79,846,506 - 79,928,977 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 79,846,521 - 79,926,703 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 144,471,089 - 144,602,046 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 78,343,494 - 78,424,470 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 78,619,775 - 78,684,435 (+) NCBI Celera 4 74,082,633 - 74,162,987 (+) NCBI Celera Cytogenetic Map 4 q24 NCBI
Pals2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955410 26,610,758 - 26,697,553 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955410 26,593,123 - 26,697,553 (+) NCBI ChiLan1.0 ChiLan1.0
PALS2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 29,430,673 - 29,550,813 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 77,755,407 - 77,873,508 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 25,248,710 - 25,368,829 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 24,853,266 - 24,973,190 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 24,899,798 - 24,967,402 (+) Ensembl panpan1.1 panPan2
PALS2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 38,095,892 - 38,206,730 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 38,095,716 - 38,213,418 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 37,645,606 - 37,756,631 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 38,032,148 - 38,142,984 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 38,031,672 - 38,142,243 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 38,145,746 - 38,256,586 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 37,838,258 - 37,949,172 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 38,180,110 - 38,291,374 (+) NCBI UU_Cfam_GSD_1.0
Pals2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 82,276,116 - 82,439,288 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936478 1,554,293 - 1,647,787 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936478 1,554,314 - 1,647,787 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PALS2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 47,593,049 - 47,710,570 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 47,589,547 - 47,711,433 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 52,549,819 - 52,660,892 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PALS2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 33,681,859 - 33,785,699 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 33,682,127 - 33,737,196 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 70,861,748 - 70,976,955 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pals2
.
Predicted Target Of
Count of predictions: 658 Count of miRNA genes: 363 Interacting mature miRNAs: 398 Transcripts: ENSMUST00000036225, ENSMUST00000036236, ENSMUST00000166318, ENSMUST00000167063, ENSMUST00000167319, ENSMUST00000167628, ENSMUST00000171601 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142271 Egq8_m early growth QTL 8 (mouse) Not determined 4503823 96633110 Mouse 1301266 Lmr4_m leishmaniasis resistance 4 (mouse) Not determined 6 42093358 76093500 Mouse 4140989 Spqq2_m sperm quality QTL 2 (mouse) Not determined 17711598 51711719 Mouse 12910785 Pwgrq16_m post-weaning growth rate QTL 16 (mouse) 6 43803747 77788506 Mouse 11252142 Mom12_m Modifier of Min 12 (mouse) 6 33872261 67872400 Mouse 4140983 Srilp_m sleep response to influenza, light phase (mouse) Not determined 48703490 75424693 Mouse 12910798 Pwgrq5_m pre-weaning growth rate QTL 5 (mouse) 6 43803747 77788506 Mouse 1300767 Aliq4_m acute lung injury QTL 4 (mouse) Not determined 6 36273332 70273435 Mouse 4142259 Tabw2_m tally ho associated body weight 2 (mouse) Not determined 46912919 136400690 Mouse 25314319 Histh6_m histamine hypersensitivity 6 (mouse) 6 48696934 125336963 Mouse 4142126 W3q3_m weight 3 weeks QTL 3 (mouse) Not determined 4503823 96633110 Mouse 14746995 Manh60_m mandible shape 60 (mouse) 6 37202662 71202662 Mouse 12910807 Pwbwq11_m post-weaning body weight QTL 11 (mouse) 6 43803747 77788506 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 1357442 Dbts1_m diabetes 1 (mouse) Not determined 6 18234147 73364675 Mouse 12910802 Pwbwq12_m post-weaning body weight QTL 12 (mouse) 6 43803747 77788506 Mouse 4141094 Hrtr1_m heart rate 1 (mouse) Not determined 36741463 70741463 Mouse 1300618 Pgia19_m proteoglycan induced arthritis 19 (mouse) Not determined 6 45290993 87403016 Mouse 4141988 Obrq3_m obesity resistance QTL 3 (mouse) Not determined 28290993 62291115 Mouse 12910809 Pwbwq10_m post-weaning body weight QTL 10 (mouse) 6 43803747 77788506 Mouse 12910820 Ogrq3_m overall growth rate QTL 3 (mouse) 6 43803747 77788506 Mouse 26884414 Bzwq12_m bi-zygomatic width QTL 12, 16 week (mouse) 6 3400000 139076998 Mouse 4142361 W10q11_m weight 10 weeks QTL 11 (mouse) Not determined 4503823 96633110 Mouse 4142232 W6q4_m weight 6 weeks QTL 4 (mouse) Not determined 4503823 96633110 Mouse 12904940 Edlmmq5_m extensor digitorum longus muscle mass QTL 5 (mouse) 6 19616346 53616346 Mouse 12904943 Tammq4_m tibialis anterior muscle mass QTL 4 (mouse) 6 19616346 53616346 Mouse 10412213 Sxbq2_m SGC/Knj cross B6 QTL 2 (mouse) Not determined 6 19912685 71299759 Mouse 4141454 Obrq4_m obesity resistance QTL 4 (mouse) Not determined 31703499 65703611 Mouse 12904952 Gmmq4_m gastrocnemius muscle mass QTL 4 (mouse) 6 19616346 53616346 Mouse 13208564 Bmiq7_m body mass index QTL 7 (mouse) 6 24999999 79976983 Mouse 26884441 Sklq3_m skull length QTL 3, 5 week (mouse) 6 7600000 80576983 Mouse 1301850 Fglu_m fasting glucose (mouse) Not determined 6 17711598 51711719 Mouse 1300959 Lxw2_m lupus BXSB x NZW 2 (mouse) Not determined 6 33872261 67872400 Mouse 1301724 Pcd4ts1_m p-glycoprotein positive CD4 T cell subset 1 (mouse) Not determined 6 17711598 51711719 Mouse 10412107 Desp4_m despair 4 (mouse) Not determined 6 20049830 54049830 Mouse 1301962 Eila2_m ethanol induced locomotor activity 2 (mouse) Not determined 6 48703490 125333748 Mouse 1301326 Trbv4c2_m T cell receptor beta variable 4 (mouse) Not determined 6 40868230 71356155 Mouse 1300556 Cia6_m collagen induced arthritis QTL 6 (mouse) Not determined 6 4464884 87403016 Mouse 1558984 Cplaq9_m circadian period of locomotor activity 9 (mouse) Not determined 6 38646560 92584431 Mouse 10412157 Fl1n_m fatty liver 1 in NSY (mouse) Not determined 6 45290993 128811995 Mouse 25440480 Moaq2_m modifier of alien QTL 2 (mouse) 6 3050001 117476961 Mouse 4141782 Mrdq5_m modifier of retinal degeneration QTL 5 (mouse) Not determined 32827585 78215957 Mouse 12880424 V25Dq4_m vitamin D inactive form serum level QTL 4 (mouse) 6 41576985 75576985 Mouse 12880425 V25Dq5_m vitamin D inactive form serum level QTL 5 (mouse) 6 32676980 66676980 Mouse 11040600 Lmr4c_m leishmaniasis resistance 4c (mouse) 6 42093358 76093500 Mouse 11040601 Lmr4a_m leishmaniasis resistance 4a (mouse) 6 42093358 76093500 Mouse 14700690 Ccs6_m colon cancer susceptibility 6 (mouse) 6 23776934 57776934 Mouse 11533915 Mts4_m mammary tumor susceptibility 4 (mouse) 6 42093358 76093500 Mouse 10043885 Cia6c_m collagen induced arthritis QTL 6c (mouse) Not determined 6 44442805 71096451 Mouse 1357539 Bsbob3_m BSB obesity 3 (mouse) Not determined 6 36448456 70448576 Mouse 27226726 Tibmd7_m tibia midshaft diameter 7, 16 week (mouse) 6 17699999 53476985 Mouse
RH133592
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 50,111,369 - 50,111,579 UniSTS GRCm38 MGSCv37 6 50,061,368 - 50,061,578 UniSTS GRCm37 Celera 6 50,619,965 - 50,620,175 UniSTS Cytogenetic Map 6 B2.3 UniSTS
16.MMHAP31FLF1.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 50,122,729 - 50,122,887 UniSTS GRCm38 MGSCv37 6 50,072,728 - 50,072,886 UniSTS GRCm37 Celera 6 50,631,316 - 50,631,474 UniSTS Cytogenetic Map 6 B2.3 UniSTS Whitehead_YAC 6 UniSTS
U42384
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 50,200,414 - 50,200,495 UniSTS GRCm38 MGSCv37 6 50,150,413 - 50,150,494 UniSTS GRCm37 Celera 6 50,710,133 - 50,710,214 UniSTS Celera 6 48,043,012 - 48,043,093 UniSTS Cytogenetic Map 6 B2.3 UniSTS Whitehead/MRC_RH 6 472.33 UniSTS
Fin15
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 6 50,200,283 - 50,200,406 UniSTS GRCm38 MGSCv37 6 50,150,282 - 50,150,405 UniSTS GRCm37 Celera 6 50,710,002 - 50,710,125 UniSTS Celera 6 48,043,101 - 48,043,224 UniSTS Cytogenetic Map 6 B2.3 UniSTS cM Map 6 22.5 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000036225 ⟹ ENSMUSP00000038772
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,363 - 50,175,404 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,383 - 50,198,424 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000036236 ⟹ ENSMUSP00000039314
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,229 - 50,175,567 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,249 - 50,198,587 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000166318 ⟹ ENSMUSP00000125880
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,221 - 50,175,578 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,241 - 50,198,598 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000167063
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,157,280 - 50,173,538 (+) Ensembl GRCm38.p6 Ensembl 6 50,180,300 - 50,196,558 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000167319
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,171,396 - 50,175,307 (+) Ensembl GRCm38.p6 Ensembl 6 50,194,416 - 50,198,327 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000167628 ⟹ ENSMUSP00000129355
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,840 - 50,157,593 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,860 - 50,180,613 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000171601 ⟹ ENSMUSP00000129004
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,387 - 50,140,615 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,407 - 50,163,635 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000203415
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,260 - 50,090,782 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,280 - 50,113,802 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000204545 ⟹ ENSMUSP00000144737
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 50,087,258 - 50,175,919 (+) Ensembl GRCm38.p6 Ensembl 6 50,110,278 - 50,198,939 (+) Ensembl
RefSeq Acc Id:
NM_001164733 ⟹ NP_001158205
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI GRCm38 6 50,110,241 - 50,198,598 (+) ENTREZGENE MGSCv37 6 50,060,240 - 50,148,597 (+) RGD Celera 6 50,618,750 - 50,708,304 (+) RGD cM Map 6 ENTREZGENE
Sequence:
GGAGCGCGCCCCGGCGGCGACGGCGGGAGCGGAGCGGCTGAGAGAGGCTGGCCGCGCGGGCCGGCGGGCAGCGGCAGCGCCCGGAGCCGGGCGAAGGGCGAGGCCGGCGGGGACGGCGGAAGTCGCCC
hide sequence
RefSeq Acc Id:
NM_001164734 ⟹ NP_001158206
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI GRCm38 6 50,110,241 - 50,198,598 (+) ENTREZGENE MGSCv37 6 50,060,240 - 50,148,597 (+) RGD Celera 6 50,618,750 - 50,708,304 (+) RGD cM Map 6 ENTREZGENE
Sequence:
GGAGCGCGCCCCGGCGGCGACGGCGGGAGCGGAGCGGCTGAGAGAGGCTGGCCGCGCGGGCCGG
hide sequence
RefSeq Acc Id:
NM_001361247 ⟹ NP_001348176
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,842 - 50,176,134 (+) NCBI GRCm38 6 50,110,860 - 50,198,598 (+) NCBI
Sequence:
GCTGGACACATTTGCCTGAAAGCAGAAAGGTGCCTGCCTTCTCTTCCCCCACTTCTATTTTGGCCGGACGGCAGGCCGGAGGGGAGTAGATGCAAGATCGGACAGCGCGGTGACAGCTTGTGGATTGG
hide sequence
RefSeq Acc Id:
NM_001361248 ⟹ NP_001348177
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,842 - 50,176,134 (+) NCBI GRCm38 6 50,110,860 - 50,198,598 (+) NCBI
Sequence:
GCTGGACACATTTGCCTGAAAGCAGAAAGGTGCCTGCCTTCTCTTCCCCCACTTCTATTTTGGC
hide sequence
RefSeq Acc Id:
NM_001411352 ⟹ NP_001398281
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411353 ⟹ NP_001398282
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,842 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411356 ⟹ NP_001398285
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411358 ⟹ NP_001398287
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,842 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411359 ⟹ NP_001398288
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411360 ⟹ NP_001398289
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411362 ⟹ NP_001398291
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411366 ⟹ NP_001398295
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_001411367 ⟹ NP_001398296
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI
RefSeq Acc Id:
NM_019939 ⟹ NP_064323
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,220 - 50,176,134 (+) NCBI GRCm38 6 50,110,241 - 50,198,598 (+) ENTREZGENE MGSCv37 6 50,060,240 - 50,148,597 (+) RGD Celera 6 50,618,750 - 50,708,304 (+) RGD cM Map 6 ENTREZGENE
Sequence:
GGAGCGCGCCCCGGCGGCGACGGCGGGAGCGGAGCGGCTGAGAGAGGCTGGCCGCGCGGGCCGG
hide sequence
RefSeq Acc Id:
XM_030255518 ⟹ XP_030111378
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,087,206 - 50,176,134 (+) NCBI GRCm38 6 50,110,228 - 50,199,154 (+) NCBI
Sequence:
CGCGCGAGGCCGGGAGGAGCGCGCCCCGGCGGCGACGGCGGGAGCGGAGCGGCTGAGAGAGGCTGGCCGCGCGGGCCGGCGGGCAGCGGCAGCGCCCGGAGCCGGGCGAAGGGCGAGGCCGGCGGGGA
hide sequence
RefSeq Acc Id:
XM_036152240 ⟹ XP_036008133
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 50,114,725 - 50,176,134 (+) NCBI
Sequence:
GGCAAAAGTGAAGCTAAGGGACTTGGATTTGCAAACCTACACACACGCCAACAGGCTCAAGGTG
hide sequence
RefSeq Acc Id:
NP_064323 ⟸ NM_019939
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
- Sequence:
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIR
hide sequence
RefSeq Acc Id:
NP_001158205 ⟸ NM_001164733
- Peptide Label:
isoform a
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
- Sequence:
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEIL
hide sequence
RefSeq Acc Id:
NP_001158206 ⟸ NM_001164734
- Peptide Label:
isoform a
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
- Sequence:
MQQVLENLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELVNEILEDITPLISVDENVAELVGILKEPHFQSLLEAHDIVASKCYDSPPSSPEMNIPSLNNQLPVDAIR
hide sequence
RefSeq Acc Id:
XP_030111378 ⟸ XM_030255518
- Peptide Label:
isoform X3
RefSeq Acc Id:
NP_001348177 ⟸ NM_001361248
- Peptide Label:
isoform a
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001348176 ⟸ NM_001361247
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000125880 ⟸ ENSMUST00000166318
Ensembl Acc Id:
ENSMUSP00000129004 ⟸ ENSMUST00000171601
Ensembl Acc Id:
ENSMUSP00000144737 ⟸ ENSMUST00000204545
Ensembl Acc Id:
ENSMUSP00000039314 ⟸ ENSMUST00000036236
Ensembl Acc Id:
ENSMUSP00000038772 ⟸ ENSMUST00000036225
Ensembl Acc Id:
ENSMUSP00000129355 ⟸ ENSMUST00000167628
RefSeq Acc Id:
XP_036008133 ⟸ XM_036152240
- Peptide Label:
isoform X1
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398281 ⟸ NM_001411352
- Peptide Label:
isoform a
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398285 ⟸ NM_001411356
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398291 ⟸ NM_001411362
- Peptide Label:
isoform c
RefSeq Acc Id:
NP_001398288 ⟸ NM_001411359
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398289 ⟸ NM_001411360
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398295 ⟸ NM_001411366
- Peptide Label:
isoform d
RefSeq Acc Id:
NP_001398296 ⟸ NM_001411367
- Peptide Label:
isoform e
RefSeq Acc Id:
NP_001398282 ⟸ NM_001411353
- Peptide Label:
isoform a
- UniProtKB:
Q9JLB1 (UniProtKB/Swiss-Prot), Q9JLB0 (UniProtKB/Swiss-Prot), Q9WV37 (UniProtKB/Swiss-Prot), Q3UN60 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398287 ⟸ NM_001411358
- Peptide Label:
isoform b
- UniProtKB:
B9EHZ5 (UniProtKB/TrEMBL)
RGD ID: 6839652 Promoter ID: MM_KWN:45961 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Liver Transcripts: NM_001164733, NM_001164734, NM_019939, UC009BWW.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 50,060,316 - 50,060,937 (+) MPROMDB
RGD ID: 6889676 Promoter ID: EPDNEW_M8289 Type: initiation region Name: Mpp6_1 Description: Mus musculus membrane protein, palmitoylated 6 , transcript variant5, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M8290 EPDNEW_M8291 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 50,110,242 - 50,110,302 EPDNEW
RGD ID: 6889678 Promoter ID: EPDNEW_M8290 Type: initiation region Name: Mpp6_2 Description: Mus musculus membrane protein, palmitoylated 6 , transcript variant5, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M8289 EPDNEW_M8291 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 50,110,867 - 50,110,927 EPDNEW
RGD ID: 6889680 Promoter ID: EPDNEW_M8291 Type: single initiation site Name: Mpp6_3 Description: Mus musculus membrane protein, palmitoylated 6 , transcript variant5, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M8289 EPDNEW_M8290 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 50,129,358 - 50,129,418 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-04-19
Pals2
protein associated with LIN7 2, MAGUK family member
Mpp6
membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)
Symbol and/or name updated
27372883 PROVISIONAL
