Symbol:
Polr3c
Name:
polymerase (RNA) III (DNA directed) polypeptide C
RGD ID:
1323061
MGI Page
MGI
Description:
Predicted to enable single-stranded DNA binding activity. Predicted to be involved in positive regulation of innate immune response and positive regulation of interferon-beta production. Predicted to be located in nucleoplasm. Predicted to be part of RNA polymerase III complex. Orthologous to human POLR3C (RNA polymerase III subunit C).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
4933407E01Rik; DNA-directed RNA polymerase III subunit C; DNA-directed RNA polymerase III subunit RPC3; RNA polymerase III subunit C3; RP; RPC; RPC3; RPC62
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
POLR3C (RNA polymerase III subunit C) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Polr3c (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Polr3c (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
POLR3C (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
POLR3C (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Polr3c (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
POLR3C (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
POLR3C (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Polr3c (RNA polymerase III subunit C) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Polr3c (RNA polymerase III subunit C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
POLR3C (RNA polymerase III subunit C)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
polr3c (polymerase (RNA) III (DNA directed) polypeptide C)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
CG12267
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
RPC82
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Caenorhabditis elegans (roundworm):
let-611
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 96,618,836 - 96,634,803 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 96,618,806 - 96,634,944 (-) Ensembl GRCm39 Ensembl GRCm38 3 96,711,520 - 96,727,498 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 96,711,490 - 96,727,628 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 96,515,818 - 96,531,362 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 96,796,895 - 96,813,033 (-) NCBI MGSCv36 mm8 Celera 3 98,120,927 - 98,136,493 (-) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 41.96 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Polr3c Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of POLR3C mRNA CTD PMID:22206623 Polr3c Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of POLR3C mRNA] CTD PMID:22206623 Polr3c Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Polr3c Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO POLR3C (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Polr3c Mouse 2,4-dinitrotoluene affects expression ISO Polr3c (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of POLR3C mRNA CTD PMID:21346803 Polr3c Mouse 2-hydroxypropanoic acid decreases expression ISO POLR3C (Homo sapiens) 6480464 Lactic Acid results in decreased expression of POLR3C mRNA CTD PMID:30851411 Polr3c Mouse 3,3',5,5'-tetrabromobisphenol A decreases expression ISO POLR3C (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of POLR3C protein CTD PMID:31675489 Polr3c Mouse 4-amino-2,6-dinitrotoluene affects expression ISO Polr3c (Rattus norvegicus) 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of POLR3C mRNA CTD PMID:21346803 Polr3c Mouse acrylamide increases expression ISO POLR3C (Homo sapiens) 6480464 Acrylamide results in increased expression of POLR3C mRNA CTD PMID:32763439 Polr3c Mouse all-trans-retinoic acid decreases expression ISO POLR3C (Homo sapiens) 6480464 Tretinoin results in decreased expression of POLR3C mRNA CTD PMID:33167477 Polr3c Mouse atrazine decreases expression ISO POLR3C (Homo sapiens) 6480464 Atrazine results in decreased expression of POLR3C mRNA CTD PMID:22378314 Polr3c Mouse benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of POLR3C exon and Benzo(a)pyrene results in increased methylation of POLR3C intron CTD PMID:27901495 Polr3c Mouse bisphenol A decreases expression ISO Polr3c (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of POLR3C mRNA CTD PMID:25181051 Polr3c Mouse bisphenol A decreases expression ISO POLR3C (Homo sapiens) 6480464 bisphenol A results in decreased expression of POLR3C protein CTD PMID:31675489 Polr3c Mouse cadmium atom multiple interactions ISO POLR3C (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of POLR3C mRNA CTD PMID:35301059 Polr3c Mouse cadmium dichloride increases expression ISO Polr3c (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of POLR3C mRNA CTD PMID:33453195 Polr3c Mouse cadmium dichloride multiple interactions ISO POLR3C (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of POLR3C mRNA CTD PMID:35301059 Polr3c Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of POLR3C mRNA CTD PMID:29279043 Polr3c Mouse cyclosporin A increases expression ISO POLR3C (Homo sapiens) 6480464 Cyclosporine results in increased expression of POLR3C mRNA CTD PMID:20106945 and PMID:25562108 Polr3c Mouse decabromodiphenyl ether increases expression ISO POLR3C (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of POLR3C protein CTD PMID:31675489 Polr3c Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of POLR3C mRNA CTD PMID:30529165 Polr3c Mouse flutamide increases expression ISO Polr3c (Rattus norvegicus) 6480464 Flutamide results in increased expression of POLR3C mRNA CTD PMID:24136188 Polr3c Mouse folic acid multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in decreased expression of POLR3C mRNA] CTD PMID:22206623 Polr3c Mouse FR900359 affects phosphorylation ISO POLR3C (Homo sapiens) 6480464 FR900359 affects the phosphorylation of POLR3C protein CTD PMID:37730182 Polr3c Mouse methyl methanesulfonate increases expression ISO POLR3C (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of POLR3C mRNA CTD PMID:23649840 Polr3c Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of POLR3C mRNA CTD PMID:35964746 Polr3c Mouse perfluorononanoic acid increases expression ISO POLR3C (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of POLR3C mRNA CTD PMID:32588087 Polr3c Mouse phenobarbital affects expression ISO POLR3C (Homo sapiens) 6480464 Phenobarbital affects the expression of POLR3C mRNA CTD PMID:19159669 Polr3c Mouse quercetin increases expression ISO POLR3C (Homo sapiens) 6480464 Quercetin results in increased expression of POLR3C protein CTD PMID:19207037 Polr3c Mouse rac-lactic acid decreases expression ISO POLR3C (Homo sapiens) 6480464 Lactic Acid results in decreased expression of POLR3C mRNA CTD PMID:30851411 Polr3c Mouse sodium arsenite decreases expression ISO POLR3C (Homo sapiens) 6480464 sodium arsenite results in decreased expression of POLR3C mRNA CTD PMID:28595984 and PMID:34032870 Polr3c Mouse sodium arsenite increases expression ISO POLR3C (Homo sapiens) 6480464 sodium arsenite results in increased expression of POLR3C mRNA CTD PMID:38568856 Polr3c Mouse T-2 toxin increases expression ISO POLR3C (Homo sapiens) 6480464 T-2 Toxin results in increased expression of POLR3C mRNA CTD PMID:34581912 Polr3c Mouse thioacetamide increases expression ISO Polr3c (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of POLR3C mRNA CTD PMID:23411599 Polr3c Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of POLR3C promoter alternative form CTD PMID:35295148 Polr3c Mouse triphenyl phosphate affects expression ISO POLR3C (Homo sapiens) 6480464 triphenyl phosphate affects the expression of POLR3C mRNA CTD PMID:37042841 Polr3c Mouse tunicamycin increases expression ISO POLR3C (Homo sapiens) 6480464 Tunicamycin results in increased expression of POLR3C mRNA CTD PMID:22378314 Polr3c Mouse valproic acid decreases methylation ISO POLR3C (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of POLR3C gene CTD PMID:29154799
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4-amino-2,6-dinitrotoluene (ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) atrazine (ISO) benzo[a]pyrene (EXP) bisphenol A (ISO) cadmium atom (ISO) cadmium dichloride (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) dioxygen (EXP) flutamide (ISO) folic acid (EXP) FR900359 (ISO) methyl methanesulfonate (ISO) nitrates (EXP) perfluorononanoic acid (ISO) phenobarbital (ISO) quercetin (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) T-2 toxin (ISO) thioacetamide (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) tunicamycin (ISO) valproic acid (ISO)
1.
Cell growth- and differentiation-dependent regulation of RNA polymerase III transcription.
Dumay-Odelot H, etal., Cell Cycle. 2010 Sep 15;9(18):3687-99. Epub 2010 Sep 1.
2.
Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.
Hu P, etal., Mol Cell Biol. 2002 Nov;22(22):8044-55.
3.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Polr3c Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 96,618,836 - 96,634,803 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 96,618,806 - 96,634,944 (-) Ensembl GRCm39 Ensembl GRCm38 3 96,711,520 - 96,727,498 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 96,711,490 - 96,727,628 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 96,515,818 - 96,531,362 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 96,796,895 - 96,813,033 (-) NCBI MGSCv36 mm8 Celera 3 98,120,927 - 98,136,493 (-) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 41.96 NCBI
POLR3C Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 145,824,200 - 145,844,402 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 145,824,053 - 145,844,402 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 145,590,666 - 145,610,913 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 144,303,962 - 144,322,241 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 143,081,648 - 143,099,928 NCBI Celera 1 119,795,949 - 119,814,224 (-) NCBI Celera Cytogenetic Map 1 q21.1 NCBI HuRef 1 119,556,179 - 119,574,446 (-) NCBI HuRef CHM1_1 1 147,192,355 - 147,210,631 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 144,941,003 - 144,961,205 (+) NCBI T2T-CHM13v2.0
Polr3c Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 186,935,038 - 186,950,962 (-) NCBI GRCr8 mRatBN7.2 2 184,246,201 - 184,262,150 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 184,246,204 - 184,262,208 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 191,917,143 - 191,932,613 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 189,710,614 - 189,726,210 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 184,549,704 - 184,565,173 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 198,836,282 - 198,852,368 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 198,836,285 - 198,852,161 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 218,323,216 - 218,339,302 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 191,511,970 - 191,527,849 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 191,474,726 - 191,490,603 (-) NCBI Celera 2 176,770,713 - 176,786,592 (-) NCBI Celera Cytogenetic Map 2 q34 NCBI
Polr3c Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955568 243,073 - 261,418 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955568 242,834 - 263,053 (-) NCBI ChiLan1.0 ChiLan1.0
POLR3C Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 103,215,715 - 103,234,689 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 102,804,442 - 102,822,966 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 121,917,371 - 121,935,976 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 113,733,846 - 113,752,486 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 113,733,846 - 113,752,486 (+) Ensembl panpan1.1 panPan2
POLR3C Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 58,634,299 - 58,646,056 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 58,636,244 - 58,645,838 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 58,102,454 - 58,114,110 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 59,631,014 - 59,642,722 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 59,633,068 - 59,642,718 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 58,503,834 - 58,515,493 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 58,564,812 - 58,576,460 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 59,291,372 - 59,303,029 (+) NCBI UU_Cfam_GSD_1.0
Polr3c
POLR3C Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 99,479,372 - 99,494,142 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 99,480,213 - 99,494,137 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 109,123,503 - 109,134,738 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POLR3C Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 12,901,879 - 12,919,748 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 12,901,898 - 12,919,783 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 15,581,292 - 15,599,651 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Polr3c
.
Predicted Target Of
Count of predictions: 810 Count of miRNA genes: 455 Interacting mature miRNAs: 514 Transcripts: ENSMUST00000029741, ENSMUST00000125183, ENSMUST00000128918, ENSMUST00000137009, ENSMUST00000141377, ENSMUST00000154679 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 1301971 Cia5_m collagen induced arthritis QTL 5 (mouse) Not determined 3 66046658 100046795 Mouse 1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 1301398 Rapop3_m radiation-induced apoptosis 3 (mouse) Not determined 3 90511217 100464137 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1301791 Char4_m P. chabaudi malaria resistance QTL 4 (mouse) Not determined 3 69625509 100655290 Mouse 11049572 Lmr11c_m leishmaniasis resistance 11c (mouse) 3 72139967 106140094 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 10766455 Sle22_m systematic lupus erythematosus susceptibility 22 (mouse) 3 90376936 124377072 Mouse 14747001 Mancz4_m mandible centroid size 4 (mouse) 3 90378017 124378017 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 11251721 Ewc3_m ethanol withdrawal and consumption 3 (mouse) 3 69568554 103568554 Mouse 1300982 Lmr11_m leishmaniasis resistance 11 (mouse) Not determined 3 72139967 106140094 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1301349 Pgia26_m proteoglycan induced arthritis 26 (mouse) Not determined 3 92251533 126251650 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 1302052 Etohcta4_m ethanol conditioned taste aversion 4 (mouse) Not determined 3 91000105 125008748 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 1301422 Sle11_m systematic lupus erythematosus susceptibility 11 (mouse) Not determined 3 70208904 104209042 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
D10Mit157.2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 6 D1 UniSTS Cytogenetic Map 16 B4 UniSTS Cytogenetic Map 18 E2 UniSTS Cytogenetic Map 4 C3 UniSTS Cytogenetic Map 7 B2 UniSTS Cytogenetic Map 4 D2.3 UniSTS Cytogenetic Map 11 E1 UniSTS Cytogenetic Map 14 E2.2 UniSTS Cytogenetic Map 4 C7 UniSTS Cytogenetic Map 2 H4 UniSTS Cytogenetic Map 1 F UniSTS Cytogenetic Map 6 C3 UniSTS Cytogenetic Map 11 D UniSTS Cytogenetic Map 3 G2 UniSTS Cytogenetic Map 17 A1 UniSTS Cytogenetic Map 9 F2 UniSTS Cytogenetic Map 12 F1 UniSTS Cytogenetic Map 19 C2 UniSTS Cytogenetic Map 3 B UniSTS Cytogenetic Map 8 C1 UniSTS Cytogenetic Map 18 A2 UniSTS Cytogenetic Map 3 F2 UniSTS Cytogenetic Map 14 C3 UniSTS Cytogenetic Map 8 E1 UniSTS Cytogenetic Map 8 E2 UniSTS Cytogenetic Map 5 B1 UniSTS Cytogenetic Map 18 B1 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 14 C2 UniSTS Cytogenetic Map 6 A1 UniSTS Cytogenetic Map 10 B4 UniSTS Cytogenetic Map 13 D2.1 UniSTS Cytogenetic Map 5 E5 UniSTS Cytogenetic Map 11 B1.3 UniSTS Cytogenetic Map 4 D1 UniSTS Cytogenetic Map 9 A5.2 UniSTS Cytogenetic Map 3 F1 UniSTS Cytogenetic Map 17 E3 UniSTS Cytogenetic Map 11 B3 UniSTS Cytogenetic Map 1 H4 UniSTS Cytogenetic Map 6 A3 UniSTS Cytogenetic Map 5 E4-E5 UniSTS Cytogenetic Map 15 E1 UniSTS Cytogenetic Map 13 D UniSTS Cytogenetic Map 14 B UniSTS Cytogenetic Map 14 D1 UniSTS Cytogenetic Map 7 B4 UniSTS Cytogenetic Map 8 D3 UniSTS Cytogenetic Map X D UniSTS Cytogenetic Map 17 A3.3 UniSTS Cytogenetic Map 7 E2 UniSTS Cytogenetic Map 1 H2.3 UniSTS Cytogenetic Map 7 A2 UniSTS Cytogenetic Map 7 F3 UniSTS Cytogenetic Map 9 F1 UniSTS Cytogenetic Map 10 C1 UniSTS Cytogenetic Map 4 E2 UniSTS Cytogenetic Map 16 A1 UniSTS Cytogenetic Map 8 B3.3 UniSTS Cytogenetic Map 8 D2 UniSTS Cytogenetic Map 3 D UniSTS Cytogenetic Map 15 D2 UniSTS Cytogenetic Map 17 B1 UniSTS Cytogenetic Map 7 A3 UniSTS Cytogenetic Map 15 F1 UniSTS Cytogenetic Map 16 B2 UniSTS Cytogenetic Map 7 C UniSTS Cytogenetic Map 3 F2.1 UniSTS Cytogenetic Map 6 F3 UniSTS Cytogenetic Map 1 C4 UniSTS Cytogenetic Map 11 E2 UniSTS Cytogenetic Map 11 B5 UniSTS Cytogenetic Map 9 F3 UniSTS Cytogenetic Map 2 B UniSTS Cytogenetic Map 13 B3 UniSTS Cytogenetic Map 9 A4 UniSTS Cytogenetic Map 5 A3 UniSTS Cytogenetic Map 2 H1 UniSTS Cytogenetic Map 16 B1 UniSTS Cytogenetic Map 1 A5 UniSTS Cytogenetic Map 11 C UniSTS Cytogenetic Map 9 E1 UniSTS Cytogenetic Map 6 G1 UniSTS Cytogenetic Map X A2 UniSTS Cytogenetic Map 13 B1 UniSTS Cytogenetic Map 5 E2 UniSTS Cytogenetic Map 12 C1 UniSTS Cytogenetic Map 5 F UniSTS Cytogenetic Map 4 D3 UniSTS Cytogenetic Map 10 C2 UniSTS Cytogenetic Map 9 B UniSTS Cytogenetic Map 5 G2 UniSTS Cytogenetic Map 7 F1 UniSTS Cytogenetic Map 12 C3 UniSTS Cytogenetic Map 10 A4 UniSTS Cytogenetic Map 8 A2 UniSTS Cytogenetic Map 18 A1 UniSTS Cytogenetic Map 12 A1.1 UniSTS Cytogenetic Map 1 C2 UniSTS Cytogenetic Map 11 B2 UniSTS Cytogenetic Map 6 E3 UniSTS Cytogenetic Map 5 C3.3 UniSTS Cytogenetic Map 1 B UniSTS Cytogenetic Map 17 A3.1 UniSTS Cytogenetic Map 7 A1 UniSTS Cytogenetic Map 2 E5 UniSTS Cytogenetic Map 11 A1 UniSTS Cytogenetic Map 4 B1 UniSTS Cytogenetic Map 15 A2 UniSTS Cytogenetic Map 8 C3 UniSTS Cytogenetic Map 2 A3 UniSTS Cytogenetic Map 5 G3 UniSTS Cytogenetic Map 4 A3 UniSTS Cytogenetic Map 2 H3 UniSTS Cytogenetic Map 8 A1 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 16 A3 UniSTS Cytogenetic Map 10 B1 UniSTS Cytogenetic Map 19 A UniSTS Cytogenetic Map 10 A1 UniSTS Cytogenetic Map 13 D1 UniSTS Cytogenetic Map 4 A1 UniSTS Cytogenetic Map 9 A3 UniSTS Cytogenetic Map 17 C UniSTS Cytogenetic Map 1 D UniSTS Cytogenetic Map 5 E3 UniSTS Cytogenetic Map 15 D3 UniSTS Cytogenetic Map 2 H2 UniSTS Cytogenetic Map 7 D3 UniSTS Cytogenetic Map 2 A1 UniSTS Cytogenetic Map 14 C1 UniSTS Cytogenetic Map 14 E5 UniSTS Cytogenetic Map 10 C UniSTS Cytogenetic Map 18 B2 UniSTS Cytogenetic Map 2 F1 UniSTS Cytogenetic Map 10 D3 UniSTS Cytogenetic Map 17 A2 UniSTS Cytogenetic Map 2 C3 UniSTS Cytogenetic Map 1 C3 UniSTS Cytogenetic Map 17 B2 UniSTS Cytogenetic Map 5 B2 UniSTS Cytogenetic Map 5 G1 UniSTS Cytogenetic Map 4 C6 UniSTS Cytogenetic Map 13 C3 UniSTS Cytogenetic Map 2 E1 UniSTS Cytogenetic Map 17 A3.2-A3.3 UniSTS Cytogenetic Map 19 C3 UniSTS Cytogenetic Map 7 E3 UniSTS Cytogenetic Map 13 C1 UniSTS Cytogenetic Map 9 E3.1 UniSTS Cytogenetic Map 15 E3 UniSTS Cytogenetic Map 6 B1 UniSTS Cytogenetic Map X E3 UniSTS Cytogenetic Map 4 C4 UniSTS Cytogenetic Map 3 E3 UniSTS Cytogenetic Map 11 A4 UniSTS Cytogenetic Map 4 C5 UniSTS Cytogenetic Map 18 B3 UniSTS Cytogenetic Map 9 A2 UniSTS Cytogenetic Map 7 E1 UniSTS Cytogenetic Map 5 D-E1 UniSTS Cytogenetic Map 5 B3 UniSTS Cytogenetic Map 13 A2-A3 UniSTS Cytogenetic Map 5 A2 UniSTS Cytogenetic Map 4 B3 UniSTS Cytogenetic Map 1 E4 UniSTS Cytogenetic Map 17 E4 UniSTS Cytogenetic Map 1 G2 UniSTS Cytogenetic Map 15 B3.1 UniSTS Cytogenetic Map 12 E UniSTS Cytogenetic Map X A5 UniSTS Cytogenetic Map 6 A3.3 UniSTS Cytogenetic Map 6 G3 UniSTS Cytogenetic Map 6 F2 UniSTS Cytogenetic Map 5 C1 UniSTS Cytogenetic Map 4 D2.1 UniSTS Cytogenetic Map 4 A5 UniSTS Cytogenetic Map 3 F2.2 UniSTS Cytogenetic Map 1 E3-E4 UniSTS Cytogenetic Map 9 F1-F3 UniSTS Cytogenetic Map 1 C1.1 UniSTS Cytogenetic Map 14 D2 UniSTS Cytogenetic Map 12 A2 UniSTS Cytogenetic Map 17 A3-B UniSTS Cytogenetic Map 7 F5 UniSTS Cytogenetic Map 14 A3 UniSTS Cytogenetic Map 5 G1.1 UniSTS Cytogenetic Map X F2-F4 UniSTS Cytogenetic Map 7 D2 UniSTS Cytogenetic Map 2 F3 UniSTS Cytogenetic Map 10 A3 UniSTS Cytogenetic Map X A7.3 UniSTS Cytogenetic Map 9 F1-F2 UniSTS Cytogenetic Map 13 A3.2 UniSTS Cytogenetic Map 10 A2 UniSTS Cytogenetic Map 1 C1 UniSTS Cytogenetic Map 1 A1 UniSTS Cytogenetic Map 12 D3 UniSTS Cytogenetic Map 1 A3-A5 UniSTS Cytogenetic Map 2 A2 UniSTS Cytogenetic Map 3 A1 UniSTS Cytogenetic Map X A3.3 UniSTS Cytogenetic Map 16 A-B1 UniSTS Cytogenetic Map 1 D2.3 UniSTS Cytogenetic Map 6 B2.3 UniSTS Cytogenetic Map 2 G3 UniSTS Cytogenetic Map X A2-A3.1 UniSTS Cytogenetic Map 9 A5.3 UniSTS Cytogenetic Map 14 A2-B UniSTS Cytogenetic Map 8 E1-E2 UniSTS Cytogenetic Map 8 A3 UniSTS Cytogenetic Map 1 G3-H1 UniSTS Cytogenetic Map 8 B3-C1 UniSTS Cytogenetic Map 19 C1 UniSTS Cytogenetic Map 8 C5 UniSTS Cytogenetic Map 8 A4 UniSTS Cytogenetic Map 15 F3 UniSTS Cytogenetic Map 14 E4 UniSTS Cytogenetic Map 4 D2.2 UniSTS Cytogenetic Map X F5 UniSTS cM Map 10 40.0 UniSTS Whitehead Genetic 10 33.9 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000029741 ⟹ ENSMUSP00000029741
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,618,806 - 96,634,944 (-) Ensembl GRCm38.p6 Ensembl 3 96,711,490 - 96,727,628 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000125183 ⟹ ENSMUSP00000123513
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,630,739 - 96,634,791 (-) Ensembl GRCm38.p6 Ensembl 3 96,723,423 - 96,727,475 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000128918 ⟹ ENSMUSP00000119236
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,623,767 - 96,631,135 (-) Ensembl GRCm38.p6 Ensembl 3 96,716,451 - 96,723,819 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000137009
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,626,039 - 96,634,792 (-) Ensembl GRCm38.p6 Ensembl 3 96,718,723 - 96,727,476 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000141377 ⟹ ENSMUSP00000115300
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,630,736 - 96,634,770 (-) Ensembl GRCm38.p6 Ensembl 3 96,723,420 - 96,727,454 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000154679 ⟹ ENSMUSP00000122435
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 96,618,839 - 96,634,757 (-) Ensembl GRCm38.p6 Ensembl 3 96,711,523 - 96,727,441 (-) Ensembl
RefSeq Acc Id:
NM_028925 ⟹ NP_083201
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,839 - 96,634,791 (-) NCBI GRCm38 3 96,711,895 - 96,727,439 (-) NCBI MGSCv37 3 96,515,818 - 96,531,362 (-) RGD Celera 3 98,120,927 - 98,136,493 (-) RGD cM Map 3 ENTREZGENE
Sequence:
TCTAAGAAGGGGCGATGGGAAGCTCATGAGCTGAGGCTGCTGGCCTCGGGAGGACAACATTTGGAGCTTCTAAATTAGCCCCGACCCTGAGTTCTGAGGCTCTAAGAACGATGACTCAAGCAGAGATT
hide sequence
RefSeq Acc Id:
XM_006502187 ⟹ XP_006502250
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,836 - 96,634,795 (-) NCBI GRCm38 3 96,711,520 - 96,727,498 (-) NCBI
Sequence:
TGCTCTGACCCTTCCGCGTCCGCCTGGATGGTGCTCTACTTCTAAGAAGGGGCGATGGGAAGCT
hide sequence
RefSeq Acc Id:
XM_006502188 ⟹ XP_006502251
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,836 - 96,634,795 (-) NCBI GRCm38 3 96,711,520 - 96,727,498 (-) NCBI
Sequence:
TGCTCTGACCCTTCCGCGTCCGCCTGGATGGTGCTCTACTTCTAAGAAGGGGCGATGGGAAGCTCATGAGCTGAGGCTGCTGGCCTCGGGAGGACAACATTTGGAGCTTCTAAATTAGCCCCGACCCT
hide sequence
RefSeq Acc Id:
XM_030252855 ⟹ XP_030108715
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,836 - 96,634,795 (-) NCBI GRCm38 3 96,711,520 - 96,727,498 (-) NCBI
Sequence:
TGCTCTGACCCTTCCGCGTCCGCCTGGATGGTGCTCTACTTCTAAGAAGGGGCGATGGGAAGCTCATGAGCTGAGGCTGCTGGCCTCGGGAGGACAACATTTGGAGCTTCTAAATTAGCCCCGACCCT
hide sequence
RefSeq Acc Id:
XR_375595
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,836 - 96,634,803 (-) NCBI GRCm38 3 96,711,520 - 96,727,498 (-) NCBI
Sequence:
GCGGCCCGTGCTCTGACCCTTCCGCGTCCGCCTGGATGGTGCTCTACTTCTAAGAAGGGGCGATGGGAAGCTCATGAGCTGAGGCTGCTGGCCTCGGGAGGACAACATTTGGAGCTTCTAAATTAGCC
hide sequence
RefSeq Acc Id:
XR_867239
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 96,618,836 - 96,634,803 (-) NCBI GRCm38 3 96,711,520 - 96,727,498 (-) NCBI
Sequence:
GCGGCCCGTGCTCTGACCCTTCCGCGTCCGCCTGGATGGTGCTCTACTTCTAAGAAGGGGCGATGGGAAGCTCATGAGCTGAGGCTGCTGGCCTCGGGAGGACAACATTTGGAGCTTCTAAATTAGCC
hide sequence
RefSeq Acc Id:
NP_083201 ⟸ NM_028925
- UniProtKB:
Q8R0I2 (UniProtKB/Swiss-Prot), Q9D483 (UniProtKB/Swiss-Prot), B2RX77 (UniProtKB/TrEMBL)
- Sequence:
MTQAEIKLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHHNLVLYHVHKRGVVEYEAQCSRVLRMLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSAVVKKVADR
hide sequence
RefSeq Acc Id:
XP_006502251 ⟸ XM_006502188
- Peptide Label:
isoform X2
- Sequence:
MLRYPRYIYTTKTLYGDTGELIVEELLLNGKMTMSAVVKKVADRLTETMEDGKTMDYAEVSNAF
hide sequence
RefSeq Acc Id:
XP_006502250 ⟸ XM_006502187
- Peptide Label:
isoform X1
- UniProtKB:
Q8R0I2 (UniProtKB/Swiss-Prot), Q9D483 (UniProtKB/Swiss-Prot), B2RX77 (UniProtKB/TrEMBL)
- Sequence:
MTQAEIKLCSLLLQEHFGEIVEKIGVHLVRTGSQPLRVIAHDTKASLDQVKKALCVLIHHNLVL
hide sequence
RefSeq Acc Id:
XP_030108715 ⟸ XM_030252855
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSMUSP00000123513 ⟸ ENSMUST00000125183
Ensembl Acc Id:
ENSMUSP00000029741 ⟸ ENSMUST00000029741
Ensembl Acc Id:
ENSMUSP00000122435 ⟸ ENSMUST00000154679
Ensembl Acc Id:
ENSMUSP00000119236 ⟸ ENSMUST00000128918
Ensembl Acc Id:
ENSMUSP00000115300 ⟸ ENSMUST00000141377
RGD ID: 6833716 Promoter ID: MM_KWN:35416 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, Kidney Transcripts: ENSMUST00000083735, OTTMUST00000085234 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 96,527,456 - 96,527,956 (-) MPROMDB
RGD ID: 6834264 Promoter ID: MM_KWN:35417 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, ES_Cell, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000085229, OTTMUST00000085230, OTTMUST00000085231, OTTMUST00000085233, UC008QOC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 96,531,301 - 96,532,272 (-) MPROMDB
RGD ID: 6881712 Promoter ID: EPDNEW_M4307 Type: initiation region Name: Polr3c_1 Description: Mus musculus polymerase III polypeptide C , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 96,727,473 - 96,727,533 EPDNEW
