Symbol:
Arid5a
Name:
AT-rich interaction domain 5A
RGD ID:
1322288
MGI Page
MGI
Description:
Enables RNA stem-loop binding activity and chromatin binding activity. Involved in cellular response to lipopolysaccharide; positive regulation of T-helper 17 type immune response; and positive regulation of cytokine production. Acts upstream of or within chondrocyte differentiation; positive regulation of protein acetylation; and positive regulation of transcription by RNA polymerase II. Located in nucleus. Part of transcription regulator complex. Is expressed in several structures, including ear; heart; hemolymphoid system; nervous system; and neural retina. Orthologous to human ARID5A (AT-rich interaction domain 5A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ARID domain-containing protein 5A; AT rich interactive domain 5A (Mrf1 like); AT rich interactive domain 5A (MRF1-like); AT-rich interactive domain-containing protein 5A; D430024K22Rik; MGC36895; modulator recognition factor I; Mrf; Mrf1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 36,346,814 - 36,363,117 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 36,346,814 - 36,363,110 (+) Ensembl GRCm39 Ensembl GRCm38 1 36,307,733 - 36,324,037 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 36,307,733 - 36,324,029 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 36,364,578 - 36,380,874 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 36,252,300 - 36,267,521 (+) NCBI MGSCv36 mm8 Celera 1 36,094,498 - 36,110,796 (+) NCBI Celera Cytogenetic Map 1 B NCBI cM Map 1 15.2 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Arid5a Mouse (+)-schisandrin B multiple interactions ISO RGD:1311041 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARID5A mRNA] CTD PMID:31150632 Arid5a Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of ARID5A mRNA CTD PMID:22206623 Arid5a Mouse 15-acetyldeoxynivalenol increases expression ISO RGD:1322287 6480464 15-acetyldeoxynivalenol results in increased expression of ARID5A mRNA CTD PMID:23792671 Arid5a Mouse 17beta-estradiol multiple interactions ISO RGD:1322287 6480464 ARID5A protein inhibits the reaction [Estradiol results in increased activity of ESR1 protein] CTD PMID:15941852 Arid5a Mouse 17beta-estradiol increases expression ISO RGD:1322287 6480464 Estradiol results in increased expression of ARID5A mRNA CTD PMID:31614463 Arid5a Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ARID5A mRNA CTD PMID:21570461|PMID:26377647 Arid5a Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1311041 6480464 Tetrachlorodibenzodioxin results in increased expression of ARID5A mRNA CTD PMID:33387578|PMID:34747641 Arid5a Mouse 3,3',5,5'-tetrabromobisphenol A increases expression EXP 6480464 tetrabromobisphenol A results in increased expression of ARID5A mRNA CTD PMID:25172293 Arid5a Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1322287 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Arid5a Mouse 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1322287 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Arid5a Mouse 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of ARID5A mRNA CTD PMID:19191707 Arid5a Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of ARID5A mRNA CTD PMID:28973697 Arid5a Mouse acrolein multiple interactions ISO RGD:1322287 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Arid5a Mouse acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of ARID5A mRNA CTD PMID:30807115 Arid5a Mouse afimoxifene multiple interactions ISO RGD:1322287 6480464 ARID5A protein inhibits the reaction [afimoxifene results in increased activity of ESR1 protein] CTD PMID:15941852 Arid5a Mouse aflatoxin B1 decreases expression ISO RGD:1322287 6480464 Aflatoxin B1 results in decreased expression of ARID5A mRNA CTD PMID:22100608 Arid5a Mouse alpha-pinene multiple interactions ISO RGD:1322287 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Arid5a Mouse alpha-Zearalanol multiple interactions ISO RGD:1311041 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ARID5A mRNA CTD PMID:35163327 Arid5a Mouse amiodarone increases expression ISO RGD:1322287 6480464 Amiodarone results in increased expression of ARID5A mRNA CTD PMID:19774075 Arid5a Mouse aristolochic acid A increases expression ISO RGD:1322287 6480464 aristolochic acid I results in increased expression of ARID5A mRNA CTD PMID:33212167 Arid5a Mouse atrazine increases expression ISO RGD:1322287 6480464 Atrazine results in increased expression of ARID5A mRNA CTD PMID:22378314 Arid5a Mouse atrazine affects methylation ISO RGD:1311041 6480464 Atrazine affects the methylation of ARID5A gene CTD PMID:35440735 Arid5a Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ARID5A mRNA CTD PMID:21569818|PMID:22228805 Arid5a Mouse benzo[a]pyrene decreases expression ISO RGD:1322287 6480464 Benzo(a)pyrene results in decreased expression of ARID5A mRNA CTD PMID:32234424 Arid5a Mouse benzo[a]pyrene affects methylation ISO RGD:1322287 6480464 Benzo(a)pyrene affects the methylation of ARID5A promoter CTD PMID:27901495 Arid5a Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ARID5A mRNA CTD PMID:25908611 Arid5a Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:1322287 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of ARID5A more ... CTD PMID:33872906 Arid5a Mouse bisphenol A increases expression ISO RGD:1311041 6480464 bisphenol A results in increased expression of ARID5A mRNA CTD PMID:25181051 Arid5a Mouse bisphenol A decreases expression ISO RGD:1311041 6480464 bisphenol A results in decreased expression of ARID5A mRNA CTD PMID:30816183|PMID:32528016 Arid5a Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ARID5A mRNA CTD PMID:25594700|PMID:30951980 Arid5a Mouse bromobenzene increases expression ISO RGD:1311041 6480464 bromobenzene results in increased expression of ARID5A mRNA CTD PMID:32479839 Arid5a Mouse butanal increases expression ISO RGD:1322287 6480464 butyraldehyde results in increased expression of ARID5A mRNA CTD PMID:26079696 Arid5a Mouse cadmium dichloride decreases expression ISO RGD:1322287 6480464 Cadmium Chloride results in decreased expression of ARID5A mRNA CTD PMID:38568856 Arid5a Mouse caffeine increases phosphorylation ISO RGD:1322287 6480464 Caffeine results in increased phosphorylation of ARID5A protein CTD PMID:35688186 Arid5a Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of ARID5A mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Arid5a Mouse carbon nanotube affects expression EXP 6480464 Nanotubes, Carbon affects the expression of ARID5A mRNA CTD PMID:31978390 Arid5a Mouse cefaloridine increases expression ISO RGD:1311041 6480464 Cephaloridine results in increased expression of ARID5A mRNA CTD PMID:18500788 Arid5a Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of ARID5A mRNA CTD PMID:34289071 Arid5a Mouse dexamethasone multiple interactions ISO RGD:1322287 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Arid5a Mouse Dibutyl phosphate affects expression ISO RGD:1322287 6480464 di-n-butylphosphoric acid affects the expression of ARID5A mRNA CTD PMID:37042841 Arid5a Mouse diclofenac decreases expression EXP 6480464 Diclofenac results in decreased expression of ARID5A mRNA CTD PMID:35537566 Arid5a Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ARID5A mRNA CTD PMID:30529165 Arid5a Mouse disodium selenite increases expression ISO RGD:1322287 6480464 Sodium Selenite results in increased expression of ARID5A mRNA CTD PMID:18175754 Arid5a Mouse doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of ARID5A mRNA CTD PMID:36227756 Arid5a Mouse endosulfan decreases expression ISO RGD:1311041 6480464 Endosulfan results in decreased expression of ARID5A mRNA CTD PMID:29391264 Arid5a Mouse fluoranthene multiple interactions EXP 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of ARID5A mRNA CTD PMID:28329830 Arid5a Mouse FR900359 increases phosphorylation ISO RGD:1322287 6480464 FR900359 results in increased phosphorylation of ARID5A protein CTD PMID:37730182 Arid5a Mouse gentamycin increases expression ISO RGD:1311041 6480464 Gentamicins results in increased expression of ARID5A mRNA CTD PMID:33387578 Arid5a Mouse graphite affects expression ISO RGD:1311041 6480464 Graphite affects the expression of ARID5A mRNA CTD PMID:29933104 Arid5a Mouse indometacin multiple interactions ISO RGD:1322287 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Arid5a Mouse melphalan increases expression ISO RGD:1322287 6480464 Melphalan results in increased expression of ARID5A mRNA CTD PMID:22363485 Arid5a Mouse menadione affects expression ISO RGD:1322287 6480464 Vitamin K 3 affects the expression of ARID5A mRNA CTD PMID:20044591 Arid5a Mouse methoxychlor affects methylation ISO RGD:1311041 6480464 Methoxychlor affects the methylation of ARID5A gene CTD PMID:35440735 Arid5a Mouse methylmercury chloride increases expression ISO RGD:1311041 6480464 methylmercuric chloride results in increased expression of ARID5A mRNA CTD PMID:31378766 Arid5a Mouse mono(2-ethylhexyl) phthalate multiple interactions ISO RGD:1322287 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of ARID5A more ... CTD PMID:33872906 Arid5a Mouse Muraglitazar decreases expression ISO RGD:1311041 6480464 muraglitazar results in decreased expression of ARID5A mRNA CTD PMID:21515302 Arid5a Mouse N-methyl-4-phenylpyridinium increases expression ISO RGD:1322287 6480464 1-Methyl-4-phenylpyridinium results in increased expression of ARID5A mRNA CTD PMID:24810058 Arid5a Mouse naphthalene increases expression EXP 6480464 naphthalene results in increased expression of ARID5A mRNA CTD PMID:18978301 Arid5a Mouse nickel atom increases expression ISO RGD:1322287 6480464 Nickel results in increased expression of ARID5A mRNA CTD PMID:24768652|PMID:25583101 Arid5a Mouse okadaic acid increases expression ISO RGD:1322287 6480464 Okadaic Acid results in increased expression of ARID5A mRNA CTD PMID:38832940 Arid5a Mouse ozone multiple interactions ISO RGD:1322287 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of more ... CTD PMID:32699268 Arid5a Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of ARID5A mRNA CTD PMID:17562736 Arid5a Mouse paracetamol increases expression ISO RGD:1311041 6480464 Acetaminophen results in increased expression of ARID5A mRNA CTD PMID:33387578 Arid5a Mouse pentanal increases expression ISO RGD:1322287 6480464 pentanal results in increased expression of ARID5A mRNA CTD PMID:26079696 Arid5a Mouse perfluorooctanoic acid multiple interactions ISO RGD:1311041 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of ARID5A mRNA CTD PMID:35163327 Arid5a Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of ARID5A mRNA] CTD PMID:19482888 Arid5a Mouse phenobarbital affects expression ISO RGD:1322287 6480464 Phenobarbital affects the expression of ARID5A mRNA CTD PMID:19159669 Arid5a Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ARID5A mRNA CTD PMID:19482888 Arid5a Mouse pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of ARID5A mRNA CTD PMID:28903501 Arid5a Mouse raloxifene multiple interactions ISO RGD:1322287 6480464 ARID5A protein inhibits the reaction [Raloxifene Hydrochloride results in increased activity of ESR1 protein] CTD PMID:15941852 Arid5a Mouse silicon dioxide increases expression ISO RGD:1322287 6480464 Silicon Dioxide analog results in increased expression of ARID5A mRNA CTD PMID:25895662 Arid5a Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of ARID5A mRNA CTD PMID:19073995|PMID:33720480 Arid5a Mouse Soman increases expression ISO RGD:1311041 6480464 Soman results in increased expression of ARID5A mRNA CTD PMID:19281266 Arid5a Mouse sunitinib decreases expression ISO RGD:1322287 6480464 Sunitinib results in decreased expression of ARID5A mRNA CTD PMID:31533062 Arid5a Mouse Tesaglitazar decreases expression ISO RGD:1311041 6480464 tesaglitazar results in decreased expression of ARID5A mRNA CTD PMID:21515302 Arid5a Mouse tetrachloromethane multiple interactions ISO RGD:1311041 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of ARID5A mRNA] CTD PMID:31150632 Arid5a Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of ARID5A mRNA CTD PMID:31919559 Arid5a Mouse tetrachloromethane increases expression ISO RGD:1311041 6480464 Carbon Tetrachloride results in increased expression of ARID5A mRNA CTD PMID:31150632 Arid5a Mouse thioacetamide increases expression ISO RGD:1311041 6480464 Thioacetamide results in increased expression of ARID5A mRNA CTD PMID:34492290 Arid5a Mouse thiram increases expression ISO RGD:1322287 6480464 Thiram results in increased expression of ARID5A mRNA CTD PMID:38568856 Arid5a Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of ARID5A mRNA CTD PMID:27760801 Arid5a Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of ARID5A gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Arid5a Mouse trichloroethene increases expression ISO RGD:1311041 6480464 Trichloroethylene results in increased expression of ARID5A mRNA CTD PMID:33387578 Arid5a Mouse triphenyl phosphate affects expression ISO RGD:1322287 6480464 triphenyl phosphate affects the expression of ARID5A mRNA CTD PMID:37042841 Arid5a Mouse Triptolide increases expression EXP 6480464 triptolide results in increased expression of ARID5A mRNA CTD PMID:32835833 Arid5a Mouse triptonide affects expression EXP 6480464 triptonide affects the expression of ARID5A mRNA CTD PMID:33045310 Arid5a Mouse troglitazone decreases expression ISO RGD:1311041 6480464 troglitazone results in decreased expression of ARID5A mRNA CTD PMID:21515302 Arid5a Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of ARID5A mRNA CTD PMID:35537566 Arid5a Mouse tungsten decreases expression EXP 6480464 Tungsten results in decreased expression of ARID5A mRNA CTD PMID:30912803 Arid5a Mouse valproic acid increases methylation ISO RGD:1322287 6480464 Valproic Acid results in increased methylation of ARID5A gene CTD PMID:29154799 Arid5a Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ARID5A mRNA CTD PMID:21427059 Arid5a Mouse valproic acid increases expression ISO RGD:1322287 6480464 Valproic Acid results in increased expression of ARID5A mRNA CTD PMID:29154799
(+)-schisandrin B (ISO) 1,2-dimethylhydrazine (EXP) 15-acetyldeoxynivalenol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',5,5'-tetrabromobisphenol A (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (EXP) 4-hydroxyphenyl retinamide (EXP) acrolein (ISO) acrylamide (EXP) afimoxifene (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) alpha-Zearalanol (ISO) amiodarone (ISO) aristolochic acid A (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bromobenzene (ISO) butanal (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) cefaloridine (ISO) chlorpyrifos (EXP) dexamethasone (ISO) Dibutyl phosphate (ISO) diclofenac (EXP) dioxygen (EXP) disodium selenite (ISO) doxorubicin (EXP) endosulfan (ISO) fluoranthene (EXP) FR900359 (ISO) gentamycin (ISO) graphite (ISO) indometacin (ISO) melphalan (ISO) menadione (ISO) methoxychlor (ISO) methylmercury chloride (ISO) mono(2-ethylhexyl) phthalate (ISO) Muraglitazar (ISO) N-methyl-4-phenylpyridinium (ISO) naphthalene (EXP) nickel atom (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) pentanal (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) pregnenolone 16alpha-carbonitrile (EXP) raloxifene (ISO) silicon dioxide (EXP,ISO) Soman (ISO) sunitinib (ISO) Tesaglitazar (ISO) tetrachloromethane (EXP,ISO) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trichloroethene (ISO) triphenyl phosphate (ISO) Triptolide (EXP) triptonide (EXP) troglitazone (ISO) trovafloxacin (EXP) tungsten (EXP) valproic acid (EXP,ISO)
Arid5a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 36,346,814 - 36,363,117 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 36,346,814 - 36,363,110 (+) Ensembl GRCm39 Ensembl GRCm38 1 36,307,733 - 36,324,037 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 36,307,733 - 36,324,029 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 36,364,578 - 36,380,874 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 36,252,300 - 36,267,521 (+) NCBI MGSCv36 mm8 Celera 1 36,094,498 - 36,110,796 (+) NCBI Celera Cytogenetic Map 1 B NCBI cM Map 1 15.2 NCBI
ARID5A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 96,536,752 - 96,552,638 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 96,536,743 - 96,552,638 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 97,202,489 - 97,218,375 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 96,566,191 - 96,582,098 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 91,643,676 - 91,659,583 (+) NCBI Celera Cytogenetic Map 2 q11.2 NCBI HuRef 2 91,163,667 - 91,180,142 (+) NCBI HuRef CHM1_1 2 97,207,299 - 97,223,202 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 97,043,371 - 97,059,257 (+) NCBI T2T-CHM13v2.0
Arid5a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 46,030,513 - 46,058,729 (+) NCBI GRCr8 mRatBN7.2 9 38,534,612 - 38,549,467 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 38,534,590 - 38,547,597 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 47,046,170 - 47,061,006 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 52,153,491 - 52,168,275 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 50,435,379 - 50,450,163 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 42,871,907 - 42,886,725 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 42,871,950 - 42,884,855 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 42,526,010 - 42,540,829 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 35,239,813 - 35,244,452 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 35,208,479 - 35,245,017 (+) NCBI Celera 9 36,310,858 - 36,315,497 (+) NCBI Celera Cytogenetic Map 9 q21 NCBI
Arid5a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955470 3,950,750 - 3,965,750 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955470 3,951,010 - 3,964,391 (+) NCBI ChiLan1.0 ChiLan1.0
ARID5A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 12 31,755,836 - 31,771,847 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2A 31,758,599 - 31,774,604 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2A 102,762,076 - 102,778,072 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2A 97,459,684 - 97,475,655 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2A 97,459,690 - 97,475,651 (+) Ensembl panpan1.1 panPan2
ARID5A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 34,320,791 - 34,333,660 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 34,321,177 - 34,333,621 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 34,091,654 - 34,104,579 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 35,091,079 - 35,104,010 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 35,091,084 - 35,104,106 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 34,215,957 - 34,228,876 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 34,278,026 - 34,290,944 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 34,496,157 - 34,509,082 (-) NCBI UU_Cfam_GSD_1.0
Arid5a
ARID5A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 46,701,632 - 46,714,113 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 46,701,628 - 46,714,121 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 48,848,384 - 48,860,871 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ARID5A
Arid5a
.
Predicted Target Of
Count of predictions: 7245 Count of miRNA genes: 916 Interacting mature miRNAs: 1303 Transcripts: ENSMUST00000097778, ENSMUST00000115029, ENSMUST00000115031, ENSMUST00000115032, ENSMUST00000116629, ENSMUST00000124280, ENSMUST00000126413, ENSMUST00000137906, ENSMUST00000140218, ENSMUST00000141121, ENSMUST00000142319, ENSMUST00000145179, ENSMUST00000147123, ENSMUST00000150747 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 1301011 Cplaq4_m circadian period of locomotor activity 4 (mouse) Not determined 1 9673442 43673601 Mouse 1357524 W6q14_m weight 6 weeks QTL 14 (mouse) Not determined 1 34760138 73976915 Mouse 1301073 Orch5_m autoimmune orchitis resistance 5 (mouse) Not determined 1 19065351 53065454 Mouse 1357651 Lgq5_m late growth QTL 5 (mouse) Not determined 1 34760138 73976915 Mouse 1301275 Sle10_m systematic lupus erythematosus susceptibility 10 (mouse) Not determined 1 2882194 36882352 Mouse 11100001 Col4a1m1_m collagen, type IV, alpha 1 modifier 1 (mouse) 1 25550191 62946882 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1301471 Obq2_m obesity QTL 2 (mouse) Not determined 1 3941620 37941887 Mouse 12880407 V125Dq2_m vitamin D active form serum level QTL 2 (mouse) 1 19339081 53339081 Mouse 1357824 Estoq4_m embryo survival total QTL 4 (mouse) Not determined 1 34760138 73976915 Mouse 1357506 W10q6_m weight 10 weeks QTL 6 (mouse) Not determined 1 34760138 73976915 Mouse 39128207 Lwq16_m liver weight QTL 16 (mouse) 1 34760138 73976915 Mouse 10043970 Obq23_m obesity QTL 23 (mouse) Not determined 1 5012665 39012665 Mouse 1558860 W10q7_m weight 10 weeks QTL 7 (mouse) Not determined 1 34760138 150193871 Mouse 12880409 V125Dq1_m vitamin D active form serum level QTL 1 (mouse) 1 26039160 60039160 Mouse 4142433 Hbnr1_m Heligmosomoides bakeri nematode resistance 1 (mouse) Not determined 25550191 58273271 Mouse 1357488 Splq3_m spleen weight QTL 3 (mouse) Not determined 1 34760138 150193871 Mouse 15092046 Wngrme1_m week nine growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1301370 Adip1_m adiposity 1 (mouse) Not determined 1 2882194 36882352 Mouse 15092044 Wtgrme1_m week ten growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1301240 Sluc15_m susceptibility to lung cancer 15 (mouse) Not determined 1 19065351 53065454 Mouse 1357759 W3q12_m weight 3 weeks QTL 12 (mouse) Not determined 1 34760138 73976915 Mouse 14700685 Civq2_m cerebral infarct volume QTL 2 (mouse) 1 11340482 45340482 Mouse 1357753 Kidq2_m kidney weight QTL 2 (mouse) Not determined 1 34760138 150193871 Mouse 1301756 Pgia1_m proteoglycan induced arthritis 1 (mouse) Not determined 1 19065351 53065454 Mouse 15092055 Lgrme1_m late growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092050 Wsegrme1_m week seven growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092051 Wegrme1_m week eight growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 15092048 Wsigrme1_m week six growth rate, maternal effect 1 (mouse) 1 3280142 37782236 Mouse 1357475 w3q13_m weight 3 weeks QTL 13 (mouse) Not determined 1 23109591 73976915 Mouse
Arid5a
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 B UniSTS cM Map 1 15.2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000097778 ⟹ ENSMUSP00000095385
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,359,607 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,320,526 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000115029 ⟹ ENSMUSP00000110681
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,850 - 36,362,069 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,769 - 36,322,988 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000115031 ⟹ ENSMUSP00000110683
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,360,152 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,321,071 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000115032 ⟹ ENSMUSP00000110684
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,362,072 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,322,991 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000116629 ⟹ ENSMUSP00000136037
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,359,609 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,320,528 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000124280
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,358,968 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,319,887 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000126413 ⟹ ENSMUSP00000115490
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,814 - 36,358,284 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,733 - 36,319,203 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000137906 ⟹ ENSMUSP00000117810
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,363,110 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,324,029 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140218
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,860 - 36,355,659 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,779 - 36,316,578 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000141121
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,356,108 - 36,357,213 (+) Ensembl GRCm38.p6 Ensembl 1 36,317,027 - 36,318,132 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142319 ⟹ ENSMUSP00000119953
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,356,523 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,317,442 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145179
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,358,295 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,319,214 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147123
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,355,073 - 36,357,217 (+) Ensembl GRCm38.p6 Ensembl 1 36,315,992 - 36,318,136 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000150747
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,835 - 36,357,369 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,754 - 36,318,288 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000192874
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 36,346,839 - 36,351,852 (+) Ensembl GRCm38.p6 Ensembl 1 36,307,758 - 36,312,771 (+) Ensembl
RefSeq Acc Id:
NM_001172205 ⟹ NP_001165676
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI MGSCv37 1 36,364,578 - 36,380,874 (+) RGD Celera 1 36,094,498 - 36,110,796 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGAGGGTCTCTGCATAGCGACGCGCGCTCTCGCTGGGCCATGGCAGCACCTCCGGCCAAAGGGAACA
hide sequence
RefSeq Acc Id:
NM_001172206 ⟹ NP_001165677
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI MGSCv37 1 36,364,578 - 36,380,874 (+) RGD Celera 1 36,094,498 - 36,110,796 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGAGGGTCTCTGCATAGCGACGCGCGCTCTCGCTGGGCCATGGCACCTCCGGCCAAAGGGAACACAG
hide sequence
RefSeq Acc Id:
NM_001290726 ⟹ NP_001277655
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI Celera 1 36,094,498 - 36,110,796 (+) NCBI
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGA
hide sequence
RefSeq Acc Id:
NM_001290727 ⟹ NP_001277656
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI Celera 1 36,094,498 - 36,110,796 (+) NCBI
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGAGGGTCTCTGCATAGCGACGCGCGCTCTCGCTGGGCCATGGCACCTCCGGCCAAAGGGAACACAG
hide sequence
RefSeq Acc Id:
NM_145996 ⟹ NP_666108
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI MGSCv37 1 36,364,578 - 36,380,874 (+) RGD Celera 1 36,094,498 - 36,110,796 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGAGGGTCTCTGCATAGCGACGCGCGCTCTCGCTGGGCCATGGCAGCACCTCCGGCCAAAGGGAACA
hide sequence
RefSeq Acc Id:
NR_033310
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,346,814 - 36,363,110 (+) NCBI GRCm38 1 36,307,733 - 36,324,029 (+) NCBI MGSCv37 1 36,364,578 - 36,380,874 (+) RGD Celera 1 36,094,498 - 36,110,796 (+) RGD cM Map 1 ENTREZGENE
Sequence:
AGTCGAGCGGCGCCGGTAGTCAGTCGCGCCGAGAGCGCTGGGACAGGACGGCTGTGCGTGTAGA
hide sequence
RefSeq Acc Id:
XM_017319751 ⟹ XP_017175240
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 36,350,880 - 36,363,117 (+) NCBI GRCm38 1 36,307,872 - 36,324,037 (+) NCBI
Sequence:
GTCTTTCTGGTAGGCGAGCCCTGTGAAAGGGGTCGAGACCCACAGGTTGTGAACCCGTGCCTAT
hide sequence
RefSeq Acc Id:
NP_666108 ⟸ NM_145996
- Peptide Label:
isoform 3
- UniProtKB:
Q3U108 (UniProtKB/Swiss-Prot)
- Sequence:
MAAPPAKGNTEQSEEGDLPQLPVSPKPDDEQSRSQSPTQLQVTGRRLWKNVYDELGGSPGSTSAATCTRRHYERLVLPYVRHLKGEDDKPLPPTKPRKQYKMAKELRGDDGTTEKLKKAKDSEERRVE
hide sequence
RefSeq Acc Id:
NP_001165676 ⟸ NM_001172205
- Peptide Label:
isoform 1
- UniProtKB:
Q8BYB5 (UniProtKB/Swiss-Prot), Q8BI45 (UniProtKB/Swiss-Prot), Q3UDZ6 (UniProtKB/Swiss-Prot), Q3UDA3 (UniProtKB/Swiss-Prot), Q3U0S2 (UniProtKB/Swiss-Prot), Q3U0F0 (UniProtKB/Swiss-Prot), Q3TZS4 (UniProtKB/Swiss-Prot), Q8R2W1 (UniProtKB/Swiss-Prot), Q3U108 (UniProtKB/Swiss-Prot)
- Sequence:
MAAPPAKGNTEQSEEGDLPQLPVSPKPDDEQSRSQSPTQLQDSPEAGGEQEEEQAFLVSLYKFM
hide sequence
RefSeq Acc Id:
NP_001165677 ⟸ NM_001172206
- Peptide Label:
isoform 2
- UniProtKB:
Q3U108 (UniProtKB/Swiss-Prot)
- Sequence:
MAPPAKGNTEQSEEGDLPQLPVSPKPDDEQSRSQSPTQLQDSPEAGGEQEEEQAFLVSLYKFMK
hide sequence
RefSeq Acc Id:
NP_001277655 ⟸ NM_001290726
- Peptide Label:
isoform 5
- UniProtKB:
D3Z0W0 (UniProtKB/TrEMBL)
- Sequence:
MLKGGRPDLCVVNSLIELQKLKLHVDAEHQTAPPAKGNTEQSEEGDLPQLPVSPKPDDEQSRSQ
hide sequence
RefSeq Acc Id:
NP_001277656 ⟸ NM_001290727
- Peptide Label:
isoform 6
- UniProtKB:
Q3U108 (UniProtKB/Swiss-Prot)
- Sequence:
MAKELRGDDGTTEKLKKAKDSEERRVEQTTPGKTKSDATGQTQLPCQGSSRDSTEQLGPVSGPS
hide sequence
RefSeq Acc Id:
XP_017175240 ⟸ XM_017319751
- Peptide Label:
isoform X1
- UniProtKB:
D3Z0W0 (UniProtKB/TrEMBL)
- Sequence:
MLKGGRPDLCVVNSLIELQKLKLHVDAEHQTAPPAKGNTEQSEEGDLPQLPVSPKPDDEQSRSQSPTQLQDSPEAGGEQEEEQAFLVSLYKFMKERHTPIERVPHLGFKQINLWKIYKAVEKLGAYEL
hide sequence
Ensembl Acc Id:
ENSMUSP00000115490 ⟸ ENSMUST00000126413
Ensembl Acc Id:
ENSMUSP00000110681 ⟸ ENSMUST00000115029
Ensembl Acc Id:
ENSMUSP00000110683 ⟸ ENSMUST00000115031
Ensembl Acc Id:
ENSMUSP00000110684 ⟸ ENSMUST00000115032
Ensembl Acc Id:
ENSMUSP00000117810 ⟸ ENSMUST00000137906
Ensembl Acc Id:
ENSMUSP00000119953 ⟸ ENSMUST00000142319
Ensembl Acc Id:
ENSMUSP00000095385 ⟸ ENSMUST00000097778
Ensembl Acc Id:
ENSMUSP00000136037 ⟸ ENSMUST00000116629
RGD ID: 6873424 Promoter ID: EPDNEW_M163 Type: multiple initiation site Name: Arid5a_1 Description: Mus musculus AT rich interactive domain 5A (MRF1-like) , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M164 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 36,307,754 - 36,307,814 EPDNEW
RGD ID: 6873426 Promoter ID: EPDNEW_M164 Type: single initiation site Name: Arid5a_2 Description: Mus musculus AT rich interactive domain 5A (MRF1-like) , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M163 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 36,308,002 - 36,308,062 EPDNEW
RGD ID: 6817371 Promoter ID: MM_KWN:421 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: ENSMUST00000097779, ENSMUST00000115029, NM_001172205, NM_001172206, NM_145996, NR_033310, OTTMUST00000051019, OTTMUST00000051021, OTTMUST00000051022, OTTMUST00000051023, OTTMUST00000051025, UC007APW.1, UC007APY.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 36,364,434 - 36,364,934 (+) MPROMDB
RGD ID: 6817370 Promoter ID: MM_KWN:422 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Lung Transcripts: ENSMUST00000115030 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 36,368,131 - 36,368,977 (+) MPROMDB
RGD ID: 6817376 Promoter ID: MM_KWN:423 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Lung Transcripts: OTTMUST00000051026 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 36,371,876 - 36,372,982 (+) MPROMDB
RGD ID: 6817375 Promoter ID: MM_KWN:424 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour Transcripts: OTTMUST00000051027 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 36,372,931 - 36,373,431 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-06-27
Arid5a
AT-rich interaction domain 5A
Arid5a
AT rich interactive domain 5A (MRF1-like)
Symbol and/or name change
5135510 APPROVED
