Symbol:
Rad54l
Name:
RAD54 like (S. cerevisiae)
RGD ID:
1321601
MGI Page
MGI
Description:
Predicted to enable ATP-dependent DNA/DNA annealing activity and DNA translocase activity. Acts upstream of or within several processes, including determination of adult lifespan; double-strand break repair via homologous recombination; and response to ionizing radiation. Predicted to be located in nucleoplasm. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Is expressed in several structures, including brain ventricular layer; incisor; metencephalon rest of alar plate marginal layer; submandibular gland primordium; and thymus primordium. Used to study sclerocornea. Human ortholog(s) of this gene implicated in breast cancer; disease of cellular proliferation; non-Hodgkin lymphoma; and pancreatic cancer. Orthologous to human RAD54L (RAD54 like).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DNA repair and recombination protein RAD54-like; mHR54; mRAD54; RAD; RAD54; RAD54 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
RAD54L (RAD54 like) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Rad54l (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Rad54l (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
RAD54L (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
RAD54L (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Rad54l (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
RAD54L (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
RAD54L (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Rad54l (RAD54 like) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Rad54l (RAD54 like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
RAD54L (RAD54 like)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
rad54l (RAD54 like)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
RAD54
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
okr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
rad-54
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
rad54l
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 115,951,458 - 115,980,875 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 115,951,461 - 115,980,887 (-) Ensembl GRCm39 Ensembl GRCm38 4 116,094,261 - 116,123,700 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,094,264 - 116,123,690 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 115,769,560 - 115,796,295 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 115,594,907 - 115,621,591 (-) NCBI MGSCv36 mm8 Celera 4 114,835,105 - 114,861,841 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rad54l Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of RAD54L mRNA CTD PMID:22206623 Rad54l Mouse 1-naphthyl isothiocyanate increases expression ISO RGD:1310600 6480464 1-Naphthylisothiocyanate results in increased expression of RAD54L mRNA CTD PMID:30723492 Rad54l Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO RGD:1310600 6480464 2,2',4,4'-tetrabromodiphenyl ether results in increased expression of RAD54L mRNA CTD PMID:27291303 Rad54l Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO RGD:1321600 6480464 2,5,2',5'-tetrachlorobiphenyl results in decreased expression of RAD54L mRNA CTD PMID:36804509 Rad54l Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1321600 6480464 Tetrachlorodibenzodioxin results in decreased expression of RAD54L mRNA CTD PMID:21802500 Rad54l Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1321600 6480464 Tetrachlorodibenzodioxin affects the expression of RAD54L mRNA CTD PMID:22574217 Rad54l Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RAD54L mRNA CTD PMID:21570461 Rad54l Mouse 2,4-diaminotoluene increases expression EXP 6480464 2,4-diaminotoluene results in increased expression of RAD54L mRNA CTD PMID:20713471 Rad54l Mouse 3-methylcholanthrene increases expression EXP 6480464 Methylcholanthrene results in increased expression of RAD54L mRNA CTD PMID:20713471 Rad54l Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of RAD54L mRNA CTD PMID:39298647 Rad54l Mouse 4-hydroxynon-2-enal decreases expression EXP 6480464 4-hydroxy-2-nonenal results in decreased expression of RAD54L mRNA CTD PMID:19191707 Rad54l Mouse acetamide increases expression ISO RGD:1310600 6480464 acetamide results in increased expression of RAD54L mRNA CTD PMID:31881176 Rad54l Mouse aflatoxin B1 affects expression ISO RGD:1321600 6480464 Aflatoxin B1 affects the expression of RAD54L protein CTD PMID:20106945 Rad54l Mouse aflatoxin B1 decreases methylation ISO RGD:1321600 6480464 Aflatoxin B1 results in decreased methylation of RAD54L exon CTD PMID:30157460 Rad54l Mouse aflatoxin B1 increases expression ISO RGD:1321600 6480464 Aflatoxin B1 results in increased expression of RAD54L mRNA CTD PMID:22100608 Rad54l Mouse Aflatoxin B2 alpha increases methylation ISO RGD:1321600 6480464 aflatoxin B2 results in increased methylation of RAD54L exon CTD PMID:30157460 Rad54l Mouse all-trans-retinoic acid decreases expression ISO RGD:1321600 6480464 Tretinoin results in decreased expression of RAD54L mRNA CTD PMID:33167477 Rad54l Mouse AM-251 decreases expression ISO RGD:1321600 6480464 AM 251 results in decreased expression of RAD54L mRNA CTD PMID:16500647 Rad54l Mouse antimycin A increases expression ISO RGD:1321600 6480464 Antimycin A results in increased expression of RAD54L mRNA CTD PMID:35430258 Rad54l Mouse antimycin A multiple interactions ISO RGD:1321600 6480464 Acetylcysteine inhibits the reaction [Antimycin A results in increased expression of RAD54L mRNA] CTD PMID:35430258 Rad54l Mouse aristolochic acid A decreases expression ISO RGD:1321600 6480464 aristolochic acid I results in decreased expression of RAD54L mRNA CTD PMID:33212167 Rad54l Mouse arsane affects methylation ISO RGD:1321600 6480464 Arsenic affects the methylation of RAD54L gene CTD PMID:25304211 Rad54l Mouse arsane multiple interactions ISO RGD:1321600 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RAD54L more ... CTD PMID:39836092 Rad54l Mouse arsenic atom affects methylation ISO RGD:1321600 6480464 Arsenic affects the methylation of RAD54L gene CTD PMID:25304211 Rad54l Mouse arsenic atom multiple interactions ISO RGD:1321600 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RAD54L more ... CTD PMID:39836092 Rad54l Mouse arsenite(3-) decreases expression EXP 6480464 arsenite results in decreased expression of RAD54L mRNA CTD PMID:18929588 Rad54l Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of RAD54L mRNA CTD PMID:20713471 Rad54l Mouse benzo[a]pyrene increases expression ISO RGD:1321600 6480464 Benzo(a)pyrene results in increased expression of RAD54L mRNA CTD PMID:32234424 Rad54l Mouse benzo[a]pyrene affects methylation ISO RGD:1321600 6480464 Benzo(a)pyrene affects the methylation of RAD54L exon CTD PMID:30157460 Rad54l Mouse benzo[a]pyrene increases methylation ISO RGD:1321600 6480464 Benzo(a)pyrene results in increased methylation of RAD54L promoter CTD PMID:27901495 Rad54l Mouse benzo[a]pyrene decreases expression ISO RGD:1321600 6480464 Benzo(a)pyrene results in decreased expression of RAD54L mRNA CTD PMID:20064835|PMID:21802500 Rad54l Mouse benzo[e]pyrene increases methylation ISO RGD:1321600 6480464 benzo(e)pyrene results in increased methylation of RAD54L exon CTD PMID:30157460 Rad54l Mouse Biflorin affects expression ISO RGD:1321600 6480464 biflorin affects the expression of RAD54L mRNA CTD PMID:27079618 Rad54l Mouse bis(2-chloroethyl) sulfide decreases expression ISO RGD:1321600 6480464 Mustard Gas results in decreased expression of RAD54L mRNA CTD PMID:25102026 Rad54l Mouse bis(2-chloroethyl) sulfide decreases expression EXP 6480464 Mustard Gas results in decreased expression of RAD54L mRNA CTD PMID:19778212 Rad54l Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of RAD54L mRNA CTD PMID:36423848 Rad54l Mouse bisphenol A decreases expression ISO RGD:1310600 6480464 bisphenol A results in decreased expression of RAD54L mRNA CTD PMID:25181051|PMID:34947998 Rad54l Mouse bisphenol A decreases expression ISO RGD:1321600 6480464 bisphenol A results in decreased expression of RAD54L mRNA CTD PMID:29275510 Rad54l Mouse cadmium dichloride decreases expression ISO RGD:1321600 6480464 Cadmium Chloride results in decreased expression of RAD54L mRNA CTD PMID:38568856 Rad54l Mouse calcitriol decreases expression ISO RGD:1321600 6480464 Calcitriol results in decreased expression of RAD54L mRNA CTD PMID:21592394 Rad54l Mouse calcitriol multiple interactions ISO RGD:1321600 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RAD54L mRNA CTD PMID:21592394 Rad54l Mouse cannabidiol decreases expression ISO RGD:1321600 6480464 Cannabidiol results in decreased expression of RAD54L mRNA CTD PMID:36519830 Rad54l Mouse carbon nanotube increases expression EXP 6480464 Nanotubes, Carbon analog results in increased expression of RAD54L mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681 Rad54l Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of RAD54L mRNA CTD PMID:37019170 Rad54l Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of RAD54L mRNA CTD PMID:28472532 Rad54l Mouse cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of RAD54L mRNA CTD PMID:21151649 Rad54l Mouse copper atom multiple interactions ISO RGD:1321600 6480464 [NSC 689534 binds to Copper] which results in decreased expression of RAD54L mRNA CTD PMID:20971185 Rad54l Mouse copper(0) multiple interactions ISO RGD:1321600 6480464 [NSC 689534 binds to Copper] which results in decreased expression of RAD54L mRNA CTD PMID:20971185 Rad54l Mouse copper(II) sulfate decreases expression ISO RGD:1321600 6480464 Copper Sulfate results in decreased expression of RAD54L mRNA CTD PMID:19549813 Rad54l Mouse coumestrol multiple interactions ISO RGD:1321600 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RAD54L mRNA; [Coumestrol co-treated with resveratrol] more ... CTD PMID:19167446 Rad54l Mouse coumestrol increases expression ISO RGD:1321600 6480464 Coumestrol results in increased expression of RAD54L mRNA CTD PMID:19167446 Rad54l Mouse cyclophosphamide decreases expression ISO RGD:1310600 6480464 Cyclophosphamide results in decreased expression of RAD54L mRNA CTD PMID:11056294 Rad54l Mouse DDE increases expression ISO RGD:1321600 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of RAD54L mRNA CTD PMID:38568856 Rad54l Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of RAD54L mRNA CTD PMID:17361019|PMID:21266533 Rad54l Mouse dioxygen decreases expression ISO RGD:1321600 6480464 Oxygen deficiency results in decreased expression of RAD54L mRNA CTD PMID:26516004 Rad54l Mouse doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of RAD54L mRNA CTD PMID:36227756 Rad54l Mouse Enterolactone multiple interactions ISO RGD:1321600 6480464 [Coumestrol co-treated with 2,3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of RAD54L mRNA CTD PMID:19167446 Rad54l Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of RAD54L mRNA CTD PMID:35436446 Rad54l Mouse etoposide increases expression ISO RGD:1321600 6480464 Etoposide results in increased expression of RAD54L protein CTD PMID:16417649 Rad54l Mouse etoposide multiple interactions ISO RGD:1321600 6480464 BRCA1 protein mutant form inhibits the reaction [Etoposide results in increased expression of RAD54L protein] CTD PMID:16417649 Rad54l Mouse geraniol decreases expression ISO RGD:1321600 6480464 geraniol results in decreased expression of RAD54L mRNA CTD PMID:27683099 Rad54l Mouse GSK-J4 decreases expression ISO RGD:1321600 6480464 GSK-J4 results in decreased expression of RAD54L mRNA CTD PMID:29301935 Rad54l Mouse imiquimod decreases expression EXP 6480464 imiquimod results in decreased expression of RAD54L mRNA CTD PMID:21878529 Rad54l Mouse lead(0) affects expression ISO RGD:1321600 6480464 Lead affects the expression of RAD54L mRNA CTD PMID:28903495 Rad54l Mouse lidocaine increases expression ISO RGD:1310600 6480464 Lidocaine results in increased expression of RAD54L mRNA CTD PMID:35283115 Rad54l Mouse MeIQx increases expression ISO RGD:1321600 6480464 2-amino-3,8-dimethylimidazo(4,5-f)quinoxaline results in increased expression of RAD54L mRNA CTD PMID:20816883 Rad54l Mouse methamphetamine increases methylation EXP 6480464 Methamphetamine results in increased methylation of RAD54L promoter CTD PMID:26307267 Rad54l Mouse methapyrilene increases methylation ISO RGD:1321600 6480464 Methapyrilene results in increased methylation of RAD54L exon CTD PMID:30157460 Rad54l Mouse N(4)-hydroxycytidine decreases expression EXP 6480464 N(4)-hydroxycytidine results in decreased expression of RAD54L mRNA CTD PMID:37748715 Rad54l Mouse N-acetyl-L-cysteine multiple interactions ISO RGD:1321600 6480464 Acetylcysteine inhibits the reaction [Antimycin A results in increased expression of RAD54L mRNA] CTD PMID:35430258 Rad54l Mouse niclosamide increases expression ISO RGD:1321600 6480464 Niclosamide results in increased expression of RAD54L mRNA CTD PMID:28284560 Rad54l Mouse okadaic acid increases expression ISO RGD:1321600 6480464 Okadaic Acid results in increased expression of RAD54L mRNA CTD PMID:38832940 Rad54l Mouse oxaliplatin multiple interactions ISO RGD:1310600 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RAD54L mRNA CTD PMID:25729387 Rad54l Mouse oxaliplatin decreases expression ISO RGD:1310600 6480464 oxaliplatin results in decreased expression of RAD54L mRNA CTD PMID:25729387 Rad54l Mouse ozone decreases expression EXP 6480464 Ozone results in decreased expression of RAD54L mRNA CTD PMID:24336422 Rad54l Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ... CTD PMID:27106289|PMID:34911549 Rad54l Mouse paracetamol increases expression ISO RGD:1321600 6480464 Acetaminophen results in increased expression of RAD54L mRNA CTD PMID:22230336 Rad54l Mouse paracetamol increases expression ISO RGD:1310600 6480464 Acetaminophen results in increased expression of RAD54L mRNA CTD PMID:33387578 Rad54l Mouse perfluorooctanoic acid decreases expression ISO RGD:1321600 6480464 perfluorooctanoic acid results in decreased expression of RAD54L mRNA CTD PMID:36326898 Rad54l Mouse phorbol 13-acetate 12-myristate multiple interactions ISO RGD:1321600 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RAD54L mRNA CTD PMID:16979875 Rad54l Mouse propanal decreases expression ISO RGD:1321600 6480464 propionaldehyde results in decreased expression of RAD54L mRNA CTD PMID:26079696 Rad54l Mouse quercetin increases expression ISO RGD:1321600 6480464 Quercetin results in increased expression of RAD54L mRNA CTD PMID:21632981 Rad54l Mouse resveratrol multiple interactions ISO RGD:1321600 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of RAD54L mRNA CTD PMID:19167446 Rad54l Mouse silicon dioxide decreases expression EXP 6480464 Silicon Dioxide results in decreased expression of RAD54L mRNA CTD PMID:19073995 Rad54l Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of RAD54L mRNA CTD PMID:29341224 Rad54l Mouse silicon dioxide decreases expression ISO RGD:1321600 6480464 Silicon Dioxide analog results in decreased expression of RAD54L mRNA CTD PMID:23806026 Rad54l Mouse sodium arsenite affects methylation ISO RGD:1321600 6480464 sodium arsenite affects the methylation of RAD54L gene CTD PMID:28589171 Rad54l Mouse sodium arsenite multiple interactions ISO RGD:1321600 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of RAD54L more ... CTD PMID:39836092 Rad54l Mouse sodium arsenite increases expression ISO RGD:1321600 6480464 sodium arsenite results in increased expression of RAD54L mRNA CTD PMID:34032870 Rad54l Mouse sodium arsenite decreases expression ISO RGD:1321600 6480464 sodium arsenite results in decreased expression of RAD54L mRNA CTD PMID:38568856 Rad54l Mouse sodium arsenite affects expression ISO RGD:1321600 6480464 sodium arsenite affects the expression of RAD54L mRNA CTD PMID:29301061 Rad54l Mouse succimer multiple interactions EXP 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of RAD54L mRNA CTD PMID:21641980 Rad54l Mouse sunitinib decreases expression ISO RGD:1321600 6480464 Sunitinib results in decreased expression of RAD54L mRNA CTD PMID:31533062 Rad54l Mouse testosterone multiple interactions ISO RGD:1321600 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of RAD54L mRNA CTD PMID:21592394 Rad54l Mouse testosterone decreases expression ISO RGD:1321600 6480464 Testosterone results in decreased expression of RAD54L mRNA CTD PMID:21592394 Rad54l Mouse tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of RAD54L mRNA CTD PMID:17484886 Rad54l Mouse thapsigargin decreases expression ISO RGD:1321600 6480464 Thapsigargin results in decreased expression of RAD54L mRNA CTD PMID:22378314 Rad54l Mouse thioacetamide increases expression ISO RGD:1310600 6480464 Thioacetamide results in increased expression of RAD54L mRNA CTD PMID:34492290 Rad54l Mouse topotecan decreases expression ISO RGD:1310600 6480464 Topotecan results in decreased expression of RAD54L mRNA CTD PMID:25729387 Rad54l Mouse topotecan multiple interactions ISO RGD:1310600 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RAD54L mRNA CTD PMID:25729387 Rad54l Mouse trimellitic anhydride increases expression EXP 6480464 trimellitic anhydride results in increased expression of RAD54L mRNA CTD PMID:19042947 Rad54l Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of RAD54L mRNA CTD PMID:33045310 Rad54l Mouse troglitazone decreases expression ISO RGD:1321600 6480464 troglitazone results in decreased expression of RAD54L mRNA CTD PMID:19140230 Rad54l Mouse trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of RAD54L mRNA CTD PMID:35537566 Rad54l Mouse tunicamycin decreases expression ISO RGD:1321600 6480464 Tunicamycin results in decreased expression of RAD54L mRNA CTD PMID:22378314 Rad54l Mouse vinclozolin decreases expression ISO RGD:1310600 6480464 vinclozolin results in decreased expression of RAD54L mRNA CTD PMID:23555832 Rad54l Mouse vincristine decreases expression ISO RGD:1321600 6480464 Vincristine results in decreased expression of RAD54L mRNA CTD PMID:23649840 Rad54l Mouse zaragozic acid A decreases expression ISO RGD:1310600 6480464 squalestatin 1 results in decreased expression of RAD54L mRNA CTD PMID:27225895 Rad54l Mouse zaragozic acid A decreases expression EXP 6480464 squalestatin 1 results in decreased expression of RAD54L mRNA CTD PMID:27225895 Rad54l Mouse zinc atom multiple interactions ISO RGD:1321600 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RAD54L mRNA CTD PMID:16979875 Rad54l Mouse zinc(0) multiple interactions ISO RGD:1321600 6480464 [Zinc co-treated with Tetradecanoylphorbol Acetate] affects the expression of RAD54L mRNA CTD PMID:16979875
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 1-naphthyl isothiocyanate (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (EXP) 3-methylcholanthrene (EXP) 4,4'-sulfonyldiphenol (EXP) 4-hydroxynon-2-enal (EXP) acetamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) AM-251 (ISO) antimycin A (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) Biflorin (ISO) bis(2-chloroethyl) sulfide (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) cadmium dichloride (ISO) calcitriol (ISO) cannabidiol (ISO) carbon nanotube (EXP) chlorpyrifos (EXP) chromium(6+) (EXP) cisplatin (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclophosphamide (ISO) DDE (ISO) dibutyl phthalate (EXP) dioxygen (ISO) doxorubicin (EXP) Enterolactone (ISO) epoxiconazole (EXP) etoposide (ISO) geraniol (ISO) GSK-J4 (ISO) imiquimod (EXP) lead(0) (ISO) lidocaine (ISO) MeIQx (ISO) methamphetamine (EXP) methapyrilene (ISO) N(4)-hydroxycytidine (EXP) N-acetyl-L-cysteine (ISO) niclosamide (ISO) okadaic acid (ISO) oxaliplatin (ISO) ozone (EXP) paracetamol (ISO) perfluorooctanoic acid (ISO) phorbol 13-acetate 12-myristate (ISO) propanal (ISO) quercetin (ISO) resveratrol (ISO) silicon dioxide (EXP,ISO) sodium arsenite (ISO) succimer (EXP) sunitinib (ISO) testosterone (ISO) tetrachloromethane (EXP) thapsigargin (ISO) thioacetamide (ISO) topotecan (ISO) trimellitic anhydride (EXP) triptonide (EXP) troglitazone (ISO) trovafloxacin (EXP) tunicamycin (ISO) vinclozolin (ISO) vincristine (ISO) zaragozic acid A (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Significant effect of homologous recombination DNA repair gene polymorphisms on pancreatic cancer survival.
Li D, etal., Cancer Res. 2006 Mar 15;66(6):3323-30.
3.
Mutations in the RAD54 recombination gene in primary cancers.
Matsuda M, etal., Oncogene. 1999 Jun 3;18(22):3427-30.
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
MGD IEA
MGD IEA
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Rad54l Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 115,951,458 - 115,980,875 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 115,951,461 - 115,980,887 (-) Ensembl GRCm39 Ensembl GRCm38 4 116,094,261 - 116,123,700 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,094,264 - 116,123,690 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 115,769,560 - 115,796,295 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 115,594,907 - 115,621,591 (-) NCBI MGSCv36 mm8 Celera 4 114,835,105 - 114,861,841 (-) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.1 NCBI
RAD54L Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 46,247,688 - 46,278,473 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 46,246,461 - 46,278,480 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 46,713,360 - 46,744,145 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 46,486,004 - 46,516,732 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 46,425,436 - 46,456,165 NCBI Celera 1 45,000,746 - 45,031,525 (+) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 44,829,132 - 44,859,988 (+) NCBI HuRef CHM1_1 1 46,830,372 - 46,861,163 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 46,124,906 - 46,155,694 (+) NCBI T2T-CHM13v2.0
Rad54l Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 134,812,158 - 134,841,821 (-) NCBI GRCr8 mRatBN7.2 5 129,575,431 - 129,605,100 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 129,575,378 - 129,605,070 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,191,515 - 132,221,172 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 133,946,399 - 133,975,757 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 133,968,540 - 133,998,199 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 134,948,511 - 134,978,125 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 134,948,512 - 134,978,125 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 138,732,242 - 138,762,035 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.1 5 136,209,780 - 136,239,533 (+) NCBI Celera 5 128,105,213 - 128,134,839 (-) NCBI Celera Cytogenetic Map 5 q35 NCBI
Rad54l Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955464 11,996,512 - 12,033,490 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955464 11,996,512 - 12,033,525 (-) NCBI ChiLan1.0 ChiLan1.0
RAD54L Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 180,529,512 - 180,575,654 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 179,671,110 - 179,717,249 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 45,549,586 - 45,581,711 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 46,905,598 - 46,936,532 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 46,905,598 - 46,936,259 (+) Ensembl panpan1.1 panPan2
RAD54L Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 14,111,168 - 14,139,819 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 14,111,157 - 14,139,301 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 14,234,015 - 14,262,340 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 14,264,072 - 14,292,635 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 14,264,092 - 14,292,579 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 14,065,329 - 14,093,894 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 14,133,819 - 14,162,383 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 14,203,309 - 14,231,866 (-) NCBI UU_Cfam_GSD_1.0
Rad54l Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 61,455,182 - 61,491,646 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 27,280,573 - 27,316,428 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 27,276,570 - 27,316,427 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RAD54L Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 165,152,978 - 165,184,776 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 165,156,833 - 165,184,641 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 152,636,270 - 152,664,106 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RAD54L Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 86,510,616 - 86,542,426 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 86,507,248 - 86,542,663 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 30,444,520 - 30,476,524 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Rad54l
.
Predicted Target Of
Count of predictions: 1397 Count of miRNA genes: 623 Interacting mature miRNAs: 755 Transcripts: ENSMUST00000102704, ENSMUST00000102705, ENSMUST00000138320, ENSMUST00000139147, ENSMUST00000143089, ENSMUST00000152741 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
13824982 Svwq1_m seminal vesicle weight QTL 1 (mouse) 4 89888237 118857197 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 10047132 Albq19_m albuminuria QTL 19 (mouse) Not determined 4 112824389 146824389 Mouse 12904002 Opfaq9_m open field activity QTL 9 (mouse) 4 92975790 126975790 Mouse 4141623 W6q13_m weight 6 weeks QTL 13 (mouse) Not determined 88982069 140468203 Mouse 12910797 Pwgrq4_m pre-weaning growth rate QTL 4 (mouse) 4 105835310 141433838 Mouse 25314312 Syncl2_m synaptonemal complex length 2 (mouse) 4 65718237 146584457 Mouse 1357726 Lnopy1_m lens opacity 1 (mouse) Not determined 4 85428838 119429037 Mouse 12910794 Pwbwq8_m post-weaning body weight QTL 8 (mouse) 4 105835310 141433838 Mouse 14696689 Gdq2_m grooming duration QTL 2, females (mouse) 4 100857197 124893793 Mouse 1300743 Skull6_m skull morphology 6 (mouse) Not determined 4 111009051 145009280 Mouse 1301382 Arvm2_m autoimmune renal vasculitis 2 (mouse) Not determined 4 107791564 141791756 Mouse 12910813 Pwbwq4_m pre-weaning body weight QTL 4 (mouse) 4 105835310 141433838 Mouse 4141093 W3q17_m weight 3 weeks QTL 17 (mouse) Not determined 88982069 140468203 Mouse 12910808 Pwbwq9_m post-weaning body weight QTL 9 (mouse) 4 105835310 141433838 Mouse 27095939 Ulnl9_m ulna length 9, 16 week (mouse) 4 65318237 118857197 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 1301815 Sles2_m systemic lupus erythmatosus suppressor 2 (mouse) Not determined 4 94957579 150676858 Mouse 1300663 Start2_m startle response 2 (mouse) Not determined 4 107264957 141265153 Mouse 1300918 Stheal4_m soft tissue heal 4 (mouse) Not determined 4 89969627 123969747 Mouse 1301556 Cd4vts1_m CD4 virgin T cell subset 1 (mouse) Not determined 4 85428838 119429037 Mouse 1301823 Bmd7_m bone mineral density 7 (mouse) Not determined 4 88982069 151654550 Mouse 1302204 Spm1_m splenomegaly modifier (mouse) Not determined 4 82244395 116244582 Mouse 10412072 Ssen1_m suseptibility to Sendai virus 1 (mouse) Not determined 4 109658132 133154782 Mouse 1301930 Papg1_m pulmonary adenoma progression 1 (mouse) Not determined 4 85781167 119781279 Mouse 13208562 Wght7_m weight 7 (mouse) 4 90888237 148084457 Mouse 13208565 Bmiq6_m body mass index QTL 6 (mouse) 4 110857197 125893793 Mouse 1300655 Nidds_m non-insulin-dependent diabetes mellitus in SJL (mouse) Not determined 4 115030777 129465915 Mouse 1300781 Lith8_m lithogenic gene 8 (mouse) Not determined 4 107264957 141265153 Mouse 39128212 Lwq21_m liver weight QTL 21 (mouse) 4 88982069 140468203 Mouse 1300689 Dob1_m Dietary obesity 1 (mouse) Body weight 4 101574601 123127211 Mouse 27226716 Metcl2_m metatarsal-calcaneal length 2, 5 week (mouse) 4 88118237 118557197 Mouse 1301847 Fecq2_m fecundity QTL 2 (mouse) Not determined 4 100071971 134072206 Mouse 26884445 Sklq7_m skull length QTL 7, 10 week (mouse) 4 68018237 150884457 Mouse 1301597 Anxty_m anxiety (mouse) Not determined 4 74137574 128009280 Mouse 26884437 Sklq13_m skull length QTL 13, 16 week (mouse) 4 57700000 155684457 Mouse 4141549 W10q10_m weight 10 weeks QTL 10 (mouse) Not determined 88982069 140468203 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1300809 Ccrs2_m corpus callosum hemisphere surface size 2 (mouse) Not determined 4 107264957 141265153 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 1301106 Skts7_m skin tumor susceptibility 7 (mouse) Not determined 4 100071971 134072206 Mouse 1301233 Sbw2_m splenomegaly-NZB x NZW 2 (mouse) Not determined 4 94957579 128009280 Mouse 10755520 Rbc1_m red blood cell count 1 (mouse) 4 108477692 142477692 Mouse 10755521 Hct1_m hematocrit 1 (mouse) 4 108477692 142477692 Mouse 10755522 Hgb1_m hemoglobin 1 (mouse) 4 108477692 142477692 Mouse 27095924 Pglq2_m pelvic girdle length QTL 2, 5 week (mouse) 4 69118237 130727311 Mouse 1301118 Bbaa23_m B.burgdorferi-associated arthritis 23 (mouse) Not determined 4 85781167 119781279 Mouse 11532738 Abd1_m autoimmune biliary disease 1 (mouse) 4 88982069 116271120 Mouse 15039368 Nmrs19_m NAFLD-associated magnetic resonance shift 19 (mouse) 4 90882780 124882780 Mouse 27095917 Scvln14_m sacral vertebrae length 2, 16 week (mouse) 4 68018237 130277062 Mouse 1301731 Cafq2_m caffeine metabolism QTL 2 (mouse) Not determined 4 94732255 128732454 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 15039382 Ltgq7_m liver triglyceride QTL 7 (mouse) 4 105705794 139705794 Mouse 15039377 Bw45_m body weight QTL 45 (mouse) 4 105705794 139705794 Mouse 1300839 Dyscalc2_m dystrophic cardiac calcinosis 2 (mouse) Not determined 4 111009051 145009280 Mouse 12880433 Fgf23lq1_m FGF23 serum level QTL 1 (mouse) 4 101157197 135157197 Mouse 4141001 Tgq17_m triglyceride QTL 17 (mouse) Not determined 112523489 146523489 Mouse 1300580 Lbw2_m lupus NZB x NZW 2 (mouse) Not determined 4 98545539 128009280 Mouse 15039378 Adip30_m adiposity 30 (mouse) 4 105705794 139705794 Mouse 1301867 Idd11_m insulin dependent diabetes susceptibility 11 (mouse) Not determined 4 83604870 117605006 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27095905 Scvln3_m sacral vertebrae length 2, 5 week (mouse) 4 55600000 128993793 Mouse 1357800 Tgq3_m triglyceride QTL 3 (mouse) Not determined 4 107055093 141055180 Mouse 15039385 Mvlq3_m macrovesicular liver lesion QTL 3 (mouse) 4 112182386 146182386 Mouse 11553870 Cmmm_m carcinoma modifier of MSM (mouse) 4 90590668 124590781 Mouse
RH127472
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 116,096,751 - 116,096,976 UniSTS GRCm38 MGSCv37 4 115,769,356 - 115,769,581 UniSTS GRCm37 Celera 4 114,834,901 - 114,835,126 UniSTS Cytogenetic Map 4 D1 UniSTS
AW555107
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 116,096,674 - 116,096,817 UniSTS GRCm38 MGSCv37 4 115,769,279 - 115,769,422 UniSTS GRCm37 Celera 4 114,834,824 - 114,834,967 UniSTS Cytogenetic Map 4 D1 UniSTS Whitehead/MRC_RH 4 1551.49 UniSTS
RH124910
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 116,096,727 - 116,096,807 UniSTS GRCm38 MGSCv37 4 115,769,332 - 115,769,412 UniSTS GRCm37 Celera 4 114,834,877 - 114,834,957 UniSTS Cytogenetic Map 4 D1 UniSTS
RH125906
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 116,096,790 - 116,097,039 UniSTS GRCm38 MGSCv37 4 115,769,395 - 115,769,644 UniSTS GRCm37 Celera 4 114,834,940 - 114,835,189 UniSTS Cytogenetic Map 4 D1 UniSTS Whitehead/MRC_RH 4 1552.81 UniSTS
UniSTS:235013
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 116,096,610 - 116,096,768 UniSTS GRCm38 MGSCv37 4 115,769,215 - 115,769,373 UniSTS GRCm37 Celera 4 114,834,760 - 114,834,918 UniSTS Cytogenetic Map 4 D1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000102704 ⟹ ENSMUSP00000099765
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,954,172 - 115,980,856 (-) Ensembl GRCm38.p6 Ensembl 4 116,096,975 - 116,123,659 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000102705 ⟹ ENSMUSP00000099766
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,954,113 - 115,980,882 (-) Ensembl GRCm38.p6 Ensembl 4 116,096,916 - 116,123,685 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000138320
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,968,497 - 115,969,994 (-) Ensembl GRCm38.p6 Ensembl 4 116,111,300 - 116,112,797 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000139147
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,951,461 - 115,957,255 (-) Ensembl GRCm38.p6 Ensembl 4 116,094,264 - 116,100,058 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000143089
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,975,022 - 115,980,887 (-) Ensembl GRCm38.p6 Ensembl 4 116,117,825 - 116,123,690 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000152741
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 115,967,198 - 115,980,179 (-) Ensembl GRCm38.p6 Ensembl 4 116,110,001 - 116,122,982 (-) Ensembl
RefSeq Acc Id:
NM_001122958 ⟹ NP_001116430
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI GRCm38 4 116,096,955 - 116,123,689 (-) NCBI MGSCv37 4 115,769,560 - 115,796,295 (-) RGD Celera 4 114,835,105 - 114,861,841 (-) RGD cM Map 4 ENTREZGENE
Sequence:
TGGAGGCTCTTAACGCGCGCTTTGGGAAGAGGAAGAATAAGGGGAAAGATACCGGAGTCGCTCTTTGCCTCTCTTCAGCTTCTAAGATTCTCCTCCTCCCAACCTGGATTTTTAACTGGTCCTTCCTG
hide sequence
RefSeq Acc Id:
NM_001122959 ⟹ NP_001116431
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI GRCm38 4 116,096,955 - 116,123,690 (-) NCBI MGSCv37 4 115,769,560 - 115,796,295 (-) RGD Celera 4 114,835,105 - 114,861,841 (-) RGD cM Map 4 ENTREZGENE
Sequence:
CTGGAGGCTCTTAACGCGCGCTTTGGGAAGAGGAAGAATAAGGGGAAAGATACCGGAGTCGCTCTTTGCCTCTCTTCAGCTTCTAAGATTCTCCTCCTCCCAACCTGGATTTTTAACTGGTCCTTCCT
hide sequence
RefSeq Acc Id:
NM_001424844 ⟹ NP_001411773
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NM_001424845 ⟹ NP_001411774
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NM_001424846 ⟹ NP_001411775
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NM_001424847 ⟹ NP_001411776
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NM_001424848 ⟹ NP_001411777
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NM_009015 ⟹ NP_033041
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI GRCm38 4 116,096,955 - 116,123,689 (-) NCBI MGSCv37 4 115,769,560 - 115,796,295 (-) RGD Celera 4 114,835,105 - 114,861,841 (-) RGD cM Map 4 ENTREZGENE
Sequence:
TGGAGGCTCTTAACGCGCGCTTTGGGAAGAGGAAGAATAAGGGGAAAGATACCGGAGTCGCTCT
hide sequence
RefSeq Acc Id:
NR_188962
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 115,951,458 - 115,980,875 (-) NCBI
RefSeq Acc Id:
NP_033041 ⟸ NM_009015
- Peptide Label:
isoform 1
- UniProtKB:
Q8C2C4 (UniProtKB/Swiss-Prot), Q8BSR5 (UniProtKB/Swiss-Prot), Q8K3D4 (UniProtKB/Swiss-Prot), P70270 (UniProtKB/Swiss-Prot)
- Sequence:
MRRSLAPSQLARRKPEDRSSDDEDWQPGTVTPKKRKSSSETQVQECFLSPFRKPLTQLLNRPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSA
hide sequence
RefSeq Acc Id:
NP_001116431 ⟸ NM_001122959
- Peptide Label:
isoform 1
- UniProtKB:
Q8C2C4 (UniProtKB/Swiss-Prot), Q8BSR5 (UniProtKB/Swiss-Prot), Q8K3D4 (UniProtKB/Swiss-Prot), P70270 (UniProtKB/Swiss-Prot)
- Sequence:
MRRSLAPSQLARRKPEDRSSDDEDWQPGTVTPKKRKSSSETQVQECFLSPFRKPLTQLLNRPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSA
hide sequence
RefSeq Acc Id:
NP_001116430 ⟸ NM_001122958
- Peptide Label:
isoform 1
- UniProtKB:
Q8C2C4 (UniProtKB/Swiss-Prot), Q8BSR5 (UniProtKB/Swiss-Prot), Q8K3D4 (UniProtKB/Swiss-Prot), P70270 (UniProtKB/Swiss-Prot)
- Sequence:
MRRSLAPSQLARRKPEDRSSDDEDWQPGTVTPKKRKSSSETQVQECFLSPFRKPLTQLLNRPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEEGALVLYEPPPLSA
hide sequence
Ensembl Acc Id:
ENSMUSP00000099766 ⟸ ENSMUST00000102705
Ensembl Acc Id:
ENSMUSP00000099765 ⟸ ENSMUST00000102704
RefSeq Acc Id:
NP_001411774 ⟸ NM_001424845
- Peptide Label:
isoform 1
- UniProtKB:
Q8K3D4 (UniProtKB/Swiss-Prot), Q8C2C4 (UniProtKB/Swiss-Prot), Q8BSR5 (UniProtKB/Swiss-Prot), P70270 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001411777 ⟸ NM_001424848
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001411776 ⟸ NM_001424847
- Peptide Label:
isoform 2
RefSeq Acc Id:
NP_001411773 ⟸ NM_001424844
- Peptide Label:
isoform 1
- UniProtKB:
Q8K3D4 (UniProtKB/Swiss-Prot), Q8C2C4 (UniProtKB/Swiss-Prot), Q8BSR5 (UniProtKB/Swiss-Prot), P70270 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
NP_001411775 ⟸ NM_001424846
- Peptide Label:
isoform 2
RGD ID: 6836025 Promoter ID: MM_KWN:39129 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_4Hour, Brain, Kidney, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000021123 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 115,771,591 - 115,773,007 (-) MPROMDB
RGD ID: 6836035 Promoter ID: MM_KWN:39131 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, MEF_B4, MEF_B6 Transcripts: NM_001122959, NM_009015, OTTMUST00000021122, OTTMUST00000021125, OTTMUST00000071169, UC008UGD.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 115,796,341 - 115,796,841 (-) MPROMDB
RGD ID: 6884284 Promoter ID: EPDNEW_M5593 Type: initiation region Name: Rad54l_1 Description: Mus musculus RAD54 like , transcript variant 3, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 116,123,678 - 116,123,738 EPDNEW
