Symbol:
Fktn
Name:
fukutin
RGD ID:
1320792
MGI Page
MGI
Description:
Enables phosphotransferase activity, for other substituted phosphate groups. Acts upstream of or within several processes, including brain development; glycoprotein metabolic process; and skeletal muscle fiber differentiation. Located in Golgi membrane. Is expressed in several structures, including central nervous system; future brain; genitourinary system; sensory organ; and spinal ganglion. Used to study Fukuyama congenital muscular dystrophy and muscular dystrophy-dystroglycanopathy type B1. Human ortholog(s) of this gene implicated in dilated cardiomyopathy (multiple) and muscular dystrophy (multiple). Orthologous to human FKTN (fukutin).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
D830030O17Rik; Fcmd; Fukut; Fukuyama type congenital muscular dystrophy (fukutin); Fukuyama type congenital muscular dystrophy homolog; ribitol-5-phosphate transferase; ribitol-5-phosphate transferase FKTN
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FKTN (fukutin) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Fktn (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fktn (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FKTN (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FKTN (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fktn (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FKTN (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FKTN (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fktn (fukutin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fktn (fukutin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FKTN (fukutin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fktn (fukutin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T07A5.1
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
T07D3.4
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
W02B3.4
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
Y22D7AL.11
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
MNN14
Alliance
DIOPT (Ensembl Compara|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
MNN4
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
W02B3.7
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fktn
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 53,713,745 - 53,765,785 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 53,713,998 - 53,777,890 (+) Ensembl GRCm39 Ensembl GRCm38 4 53,714,107 - 53,765,785 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 53,713,998 - 53,777,890 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 53,727,054 - 53,776,143 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 53,735,282 - 53,784,371 (+) NCBI MGSCv36 mm8 Celera 4 53,671,147 - 53,720,238 (+) NCBI Celera Cytogenetic Map 4 B2 NCBI cM Map 4 28.74 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fktn Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FKTN mRNA CTD PMID:36331819 Fktn Mouse 1,2-dichloroethane increases expression EXP 6480464 ethylene dichloride results in increased expression of FKTN mRNA CTD PMID:28960355 Fktn Mouse 17beta-estradiol decreases expression ISO Fktn (Rattus norvegicus) 6480464 Estradiol results in decreased expression of FKTN mRNA CTD PMID:32145629 Fktn Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of FKTN mRNA CTD PMID:21354282 Fktn Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Fktn (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of FKTN mRNA CTD PMID:33387578 Fktn Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FKTN mRNA CTD PMID:21570461 Fktn Mouse 2,4-dinitrotoluene affects expression ISO Fktn (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of FKTN mRNA CTD PMID:21346803 Fktn Mouse 2-methylcholine affects expression ISO FKTN (Homo sapiens) 6480464 beta-methylcholine affects the expression of FKTN mRNA CTD PMID:21179406 Fktn Mouse 3,4-methylenedioxymethamphetamine increases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of FKTN mRNA CTD PMID:20188158 Fktn Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of FKTN mRNA CTD PMID:18648102 Fktn Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of FKTN mRNA CTD PMID:33297965 and PMID:39298647 Fktn Mouse 6-propyl-2-thiouracil decreases expression ISO Fktn (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of FKTN mRNA CTD PMID:30047161 Fktn Mouse acetamide decreases expression ISO Fktn (Rattus norvegicus) 6480464 acetamide results in decreased expression of FKTN mRNA CTD PMID:31881176 Fktn Mouse acrolein multiple interactions ISO FKTN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of FKTN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of FKTN mRNA CTD PMID:32699268 Fktn Mouse acrylamide decreases expression ISO Fktn (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of FKTN mRNA CTD PMID:28959563 Fktn Mouse acrylamide decreases expression ISO FKTN (Homo sapiens) 6480464 Acrylamide results in decreased expression of FKTN mRNA CTD PMID:32763439 Fktn Mouse aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of FKTN mRNA CTD PMID:19770486 Fktn Mouse aflatoxin B1 decreases methylation ISO FKTN (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FKTN gene CTD PMID:27153756 Fktn Mouse aflatoxin M1 decreases expression ISO FKTN (Homo sapiens) 6480464 Aflatoxin M1 results in decreased expression of FKTN mRNA CTD PMID:30928695 Fktn Mouse alpha-pinene multiple interactions ISO FKTN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of FKTN mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of and results in increased oxidation of FKTN mRNA CTD PMID:32699268 Fktn Mouse amitrole decreases expression ISO Fktn (Rattus norvegicus) 6480464 Amitrole results in decreased expression of FKTN mRNA CTD PMID:30047161 Fktn Mouse amphetamine decreases expression ISO Fktn (Rattus norvegicus) 6480464 Amphetamine results in decreased expression of FKTN mRNA CTD PMID:30779732 Fktn Mouse aristolochic acid A decreases expression ISO FKTN (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of FKTN mRNA CTD PMID:33212167 Fktn Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of FKTN mRNA CTD PMID:23650126 Fktn Mouse arsenite(3-) multiple interactions ISO FKTN (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to FKTN mRNA] CTD PMID:32406909 Fktn Mouse atrazine affects methylation ISO Fktn (Rattus norvegicus) 6480464 Atrazine affects the methylation of FKTN gene CTD PMID:35440735 Fktn Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of FKTN mRNA CTD PMID:22228805 Fktn Mouse beta-lapachone decreases expression ISO FKTN (Homo sapiens) 6480464 beta-lapachone results in decreased expression of FKTN mRNA CTD PMID:38218311 Fktn Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FKTN mRNA CTD PMID:26063408 Fktn Mouse bisphenol A affects expression ISO Fktn (Rattus norvegicus) 6480464 bisphenol A affects the expression of FKTN mRNA CTD PMID:32145629 Fktn Mouse bisphenol A increases expression ISO Fktn (Rattus norvegicus) 6480464 bisphenol A results in increased expression of FKTN mRNA CTD PMID:25181051 and PMID:34947998 Fktn Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of FKTN mRNA CTD PMID:38685157 Fktn Mouse butanal decreases expression ISO FKTN (Homo sapiens) 6480464 butyraldehyde results in decreased expression of FKTN mRNA CTD PMID:26079696 Fktn Mouse cadmium dichloride increases expression ISO FKTN (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of FKTN mRNA CTD PMID:26472689 Fktn Mouse CGP 52608 multiple interactions ISO FKTN (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FKTN gene] CTD PMID:28238834 Fktn Mouse chloropicrin increases expression ISO FKTN (Homo sapiens) 6480464 chloropicrin results in increased expression of FKTN mRNA CTD PMID:26352163 Fktn Mouse chlorpyrifos decreases expression ISO Fktn (Rattus norvegicus) 6480464 Chlorpyrifos results in decreased expression of FKTN mRNA CTD PMID:18668222 Fktn Mouse cyclosporin A decreases expression ISO FKTN (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FKTN mRNA CTD PMID:25562108 Fktn Mouse DDT decreases methylation ISO Fktn (Rattus norvegicus) 6480464 DDT results in decreased methylation of FKTN gene CTD PMID:31682807 Fktn Mouse Dibutyl phosphate affects expression ISO FKTN (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of FKTN mRNA CTD PMID:37042841 Fktn Mouse dicrotophos decreases expression ISO FKTN (Homo sapiens) 6480464 dicrotophos results in decreased expression of FKTN mRNA CTD PMID:28302478 Fktn Mouse doxorubicin decreases expression ISO FKTN (Homo sapiens) 6480464 Doxorubicin results in decreased expression of FKTN mRNA CTD PMID:29803840 Fktn Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of FKTN mRNA CTD PMID:35436446 Fktn Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of FKTN mRNA CTD PMID:34813904 Fktn Mouse folic acid decreases expression ISO FKTN (Homo sapiens) 6480464 Folic Acid results in decreased expression of FKTN mRNA CTD PMID:21867686 Fktn Mouse formaldehyde decreases expression ISO FKTN (Homo sapiens) 6480464 Formaldehyde results in decreased expression of FKTN mRNA CTD PMID:23649840 Fktn Mouse hydrogen peroxide affects expression ISO FKTN (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of FKTN mRNA CTD PMID:21179406 Fktn Mouse hypochlorous acid increases expression EXP 6480464 Hypochlorous Acid results in increased expression of FKTN mRNA CTD PMID:19376150 Fktn Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FKTN mRNA CTD PMID:36331819 Fktn Mouse lipopolysaccharide multiple interactions ISO FKTN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FKTN mRNA CTD PMID:35811015 Fktn Mouse lipopolysaccharide increases expression ISO FKTN (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of FKTN mRNA CTD PMID:35811015 Fktn Mouse methimazole decreases expression ISO Fktn (Rattus norvegicus) 6480464 Methimazole results in decreased expression of FKTN mRNA CTD PMID:30047161 Fktn Mouse methylmercury chloride decreases expression ISO FKTN (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of FKTN mRNA CTD PMID:28001369 Fktn Mouse ozone multiple interactions ISO FKTN (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of and results in increased oxidation of FKTN mRNA more ... CTD PMID:32699268 Fktn Mouse paracetamol decreases expression ISO FKTN (Homo sapiens) 6480464 Acetaminophen results in decreased expression of FKTN mRNA CTD PMID:26690555 Fktn Mouse paracetamol increases expression ISO Fktn (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of FKTN mRNA CTD PMID:33387578 Fktn Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of FKTN mRNA CTD PMID:23892564 Fktn Mouse pentanal decreases expression ISO FKTN (Homo sapiens) 6480464 pentanal results in decreased expression of FKTN mRNA CTD PMID:26079696 Fktn Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of FKTN mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FKTN mRNA CTD PMID:36331819 Fktn Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of FKTN mRNA CTD PMID:23091169 Fktn Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO FKTN (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FKTN mRNA CTD PMID:35811015 Fktn Mouse silicon dioxide increases expression ISO FKTN (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of FKTN mRNA CTD PMID:34973136 Fktn Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of FKTN mRNA CTD PMID:27131904 Fktn Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of FKTN mRNA CTD PMID:27131904 Fktn Mouse sodium arsenate increases expression EXP 6480464 sodium arsenate results in increased expression of FKTN mRNA CTD PMID:21795629 Fktn Mouse sulfadimethoxine decreases expression ISO Fktn (Rattus norvegicus) 6480464 Sulfadimethoxine results in decreased expression of FKTN mRNA CTD PMID:30047161 Fktn Mouse sunitinib increases expression ISO FKTN (Homo sapiens) 6480464 Sunitinib results in increased expression of FKTN mRNA CTD PMID:31533062 Fktn Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FKTN mRNA CTD PMID:17484886 Fktn Mouse thioacetamide decreases expression ISO Fktn (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of FKTN mRNA CTD PMID:34492290 Fktn Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of FKTN gene CTD PMID:35295148 Fktn Mouse triphenyl phosphate increases expression ISO Fktn (Rattus norvegicus) 6480464 triphenyl phosphate results in increased expression of FKTN mRNA CTD PMID:30589522 Fktn Mouse triphenyl phosphate affects expression ISO FKTN (Homo sapiens) 6480464 triphenyl phosphate affects the expression of FKTN mRNA CTD PMID:37042841 Fktn Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of FKTN mRNA CTD PMID:28973697 Fktn Mouse valproic acid affects expression ISO FKTN (Homo sapiens) 6480464 Valproic Acid affects the expression of FKTN mRNA CTD PMID:25979313 Fktn Mouse vinclozolin affects expression ISO Fktn (Rattus norvegicus) 6480464 vinclozolin affects the expression of FKTN mRNA CTD PMID:19015723
(1->4)-beta-D-glucan (EXP) 1,2-dichloroethane (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (EXP,ISO) aflatoxin M1 (ISO) alpha-pinene (ISO) amitrole (ISO) amphetamine (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (EXP) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) chloropicrin (ISO) chlorpyrifos (ISO) cyclosporin A (ISO) DDT (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) epoxiconazole (EXP) fenthion (EXP) folic acid (ISO) formaldehyde (ISO) hydrogen peroxide (ISO) hypochlorous acid (EXP) inulin (EXP) lipopolysaccharide (ISO) methimazole (ISO) methylmercury chloride (ISO) ozone (ISO) paracetamol (ISO) pentachlorophenol (EXP) pentanal (ISO) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) silver atom (EXP) silver(0) (EXP) sodium arsenate (EXP) sulfadimethoxine (ISO) sunitinib (ISO) tetrachloromethane (EXP) thioacetamide (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) troglitazone (EXP) valproic acid (ISO) vinclozolin (ISO)
1.
Founder Fukutin mutation causes Walker-Warburg syndrome in four Ashkenazi Jewish families.
Chang W, etal., Prenat Diagn. 2009 Jun;29(6):560-9. doi: 10.1002/pd.2238.
2.
Functional requirements for fukutin-related protein in the Golgi apparatus.
Esapa CT, etal., Hum Mol Genet 2002 Dec 15;11(26):3319-31.
3.
Development of rabbit monoclonal antibodies for detection of alpha-dystroglycan in normal and dystrophic tissue.
Fortunato MJ, etal., PLoS One. 2014 May 13;9(5):e97567. doi: 10.1371/journal.pone.0097567. eCollection 2014.
4.
Fukutin gene mutations in steroid-responsive limb girdle muscular dystrophy.
Godfrey C, etal., Ann Neurol. 2006 Nov;60(5):603-10.
5.
Selective deficiency of alpha-dystroglycan in Fukuyama-type congenital muscular dystrophy.
Hayashi YK, etal., Neurology. 2001 Jul 10;57(1):115-21.
6.
An ancient retrotransposal insertion causes Fukuyama-type congenital muscular dystrophy.
Kobayashi K, etal., Nature. 1998 Jul 23;394(6691):388-92.
7.
Novel mutations and genotype-phenotype relationships in 107 families with Fukuyama-type congenital muscular dystrophy (FCMD).
Kondo-Iida E, etal., Hum Mol Genet. 1999 Nov;8(12):2303-9.
8.
MGDs mouse GO annotations
MGD data from the GO Consortium
9.
MGD IEA
MGD IEA
10.
Fukutin gene mutations cause dilated cardiomyopathy with minimal muscle weakness.
Murakami T, etal., Ann Neurol. 2006 Nov;60(5):597-602.
11.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
12.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
13.
Further evidence of Fukutin mutations as a cause of childhood onset limb-girdle muscular dystrophy without mental retardation.
Puckett RL, etal., Neuromuscul Disord. 2009 May;19(5):352-6. doi: 10.1016/j.nmd.2009.03.001. Epub 2009 Apr 1.
14.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
15.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
16.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
17.
Fukutin protein is expressed in neurons of the normal developing human brain but is reduced in Fukuyama-type congenital muscular dystrophy brain.
Saito Y, etal., Ann Neurol. 2000 Jun;47(6):756-64.
18.
Four Caucasian patients with mutations in the fukutin gene and variable clinical phenotype.
Vuillaumier-Barrot S, etal., Neuromuscul Disord. 2009 Mar;19(3):182-8. doi: 10.1016/j.nmd.2008.12.005.
19.
Fukutin mutations in non-Japanese patients with congenital muscular dystrophy: less severe mutations predominate in patients with a non-Walker-Warburg phenotype.
Yis U, etal., Neuromuscul Disord. 2011 Jan;21(1):20-30. doi: 10.1016/j.nmd.2010.08.007. Epub 2010 Oct 18.
Fktn Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 53,713,745 - 53,765,785 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 53,713,998 - 53,777,890 (+) Ensembl GRCm39 Ensembl GRCm38 4 53,714,107 - 53,765,785 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 53,713,998 - 53,777,890 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 53,727,054 - 53,776,143 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 53,735,282 - 53,784,371 (+) NCBI MGSCv36 mm8 Celera 4 53,671,147 - 53,720,238 (+) NCBI Celera Cytogenetic Map 4 B2 NCBI cM Map 4 28.74 NCBI
FKTN Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 105,558,130 - 105,641,118 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 105,558,122 - 105,653,820 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 108,320,411 - 108,403,399 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 107,360,232 - 107,443,220 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 105,399,978 - 105,482,953 NCBI Celera 9 78,825,571 - 78,908,566 (+) NCBI Celera Cytogenetic Map 9 q31.2 NCBI HuRef 9 77,921,830 - 78,004,880 (+) NCBI HuRef CHM1_1 9 108,467,406 - 108,550,392 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 117,732,799 - 117,815,798 (+) NCBI T2T-CHM13v2.0
Fktn Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 73,134,746 - 73,191,772 (+) NCBI GRCr8 mRatBN7.2 5 68,339,803 - 68,396,412 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 68,340,028 - 68,396,409 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 70,227,762 - 70,281,805 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 72,044,733 - 72,098,826 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 72,016,575 - 72,070,620 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 70,522,001 - 70,578,270 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 70,528,688 - 70,578,273 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 74,697,518 - 74,754,106 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 71,155,051 - 71,208,525 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 71,168,040 - 71,211,945 (+) NCBI Celera 5 67,234,078 - 67,287,987 (+) NCBI Celera Cytogenetic Map 5 q24 NCBI
Fktn Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 20,933,662 - 20,994,793 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 20,933,662 - 20,994,793 (-) NCBI ChiLan1.0 ChiLan1.0
FKTN Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 33,736,875 - 33,835,805 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 33,739,744 - 33,839,021 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 76,723,071 - 76,821,611 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 104,849,447 - 104,926,414 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 104,849,496 - 104,925,422 (+) Ensembl panpan1.1 panPan2
FKTN Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 61,394,002 - 61,462,056 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 61,405,034 - 61,461,396 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 59,854,900 - 59,922,736 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 62,541,606 - 62,598,262 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 62,530,493 - 62,597,602 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 61,048,756 - 61,131,662 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 61,079,051 - 61,135,687 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 61,760,632 - 61,835,969 (+) NCBI UU_Cfam_GSD_1.0
Fktn Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 176,585,787 - 176,685,702 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936559 6,581,622 - 6,581,948 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 Ensembl NW_004936559 6,619,531 - 6,670,727 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936559 6,612,318 - 6,680,690 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FKTN
FKTN Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 33,872,165 - 33,964,105 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 33,900,362 - 33,953,377 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 8,677,300 - 8,770,035 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fktn
.
Predicted Target Of
Count of predictions: 2724 Count of miRNA genes: 764 Interacting mature miRNAs: 1030 Transcripts: ENSMUST00000061771, ENSMUST00000107638, ENSMUST00000128667 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301586 Stheal3_m soft tissue heal 3 (mouse) Not determined 4 28658442 62658566 Mouse 11532714 Sluc43_m susceptibility to lung cancer 43 (mouse) 4 46642108 123127211 Mouse 39128211 Lwq22_m liver weight QTL 22 (mouse) 4 17892616 88982216 Mouse 25314308 Mlh1fc1_m MLH1 foci count 1 (mouse) 4 48500000 76918237 Mouse 26884434 Zlq1_m zygomatic length QTL 1, 5 week (mouse) 4 53700000 103257197 Mouse 1301786 Bpq3_m blood pressure QTL 3 (mouse) Not determined 4 42402240 76402381 Mouse 10412178 Habiir2_m hyperoxic acute lung injury imprinted region 2 (mouse) Not determined 4 39452126 63283678 Mouse 1300574 Im2_m immunoregulatory 2 (mouse) Not determined 4 28077682 62077816 Mouse 1301213 Lgth3_m body length 3 (mouse) Not determined 4 50100262 84100408 Mouse 4142318 Lyr2_m lymphoma resistance 2 (mouse) Not determined 14010457 63283678 Mouse 1301697 Sluc18_m susceptibility to lung cancer 18 (mouse) Not determined 4 22373448 56373612 Mouse 1357895 Ctrcts_m cataract severity (mouse) Not determined 4 45709925 138342753 Mouse 1357453 Kidq4_m kidney weight QTL 4 (mouse) Not determined 4 17892616 88982216 Mouse 1558794 Agnm1_m autoimmune glomerulonephritis in MRL 1 (mouse) Not determined 4 46332646 55755867 Mouse 13207572 Spir2_m Streptococcus pneumoniae infection resistance 2 (mouse) 4 50682795 88510637 Mouse 4142047 Mvwf3_m modifier of von Willebrand factor 3 (mouse) Not determined 14010457 117072206 Mouse 11567249 Elorr3_m ethanol induced loss of righting response 3 (mouse) 4 3722677 156268235 Mouse 1357877 Synch1_m synechia 1 (mouse) Not determined 4 28709925 62710107 Mouse 10449022 Aanq1_m aristolochic acid nephrotoxicity QTL 1 (mouse) 4 46603826 80603826 Mouse 13432173 Actrse1_m activity response to saline/ethanol 1 (mouse) 4 53287128 56987128 Mouse 1300977 Mopkd1_m modifier of polycystic kidney disease progression 1 (mouse) Not determined 4 36550839 70550967 Mouse 1301941 Mmtg1_m modifier of mammary tumor growth 1 (mouse) Not determined 4 45658442 83099157 Mouse 4141911 W6q15_m weight 6 weeks QTL 15 (mouse) Not determined 17892616 88982216 Mouse 1302075 Bdln6_m body length 6 (mouse) Not determined 4 22373448 56373612 Mouse 12879977 Bod2_m bone length and organs 2 (mouse) 4 46283531 80283678 Mouse 1301437 Scon1_m sucrose consumption 1 (mouse) Not determined 4 22373448 56373612 Mouse 10043880 Adip23_m adiposity 23 (mouse) Not determined 4 46283531 80283678 Mouse 13432189 Actrse2_m activity response to saline/ethanol 2 (mouse) 4 52987128 54587128 Mouse 1300769 Pcyts2_m plasmacytoma susceptibility 2 (mouse) Not determined 4 22111944 56112145 Mouse 1301792 Hdlq10_m HDL QTL 10 (mouse) Not determined 4 35859707 69859853 Mouse 1558948 Ath8_m atherosclerosis 8 (mouse) Not determined 4 45658442 105156995 Mouse 4141900 Skts-fp1_m skin tumor susceptibility in FVB and PWK 1 (mouse) Not determined 4 53550839 124055180 Mouse 1301990 Arvm1_m autoimmune renal vasculitis 1 (mouse) Not determined 4 29332646 63332776 Mouse 1300966 Pabr2_m plasma apolipoprotein B (human) regulator 2 (mouse) Not determined 4 46332646 105801860 Mouse 1302116 Bbaa1_m B.burgdorferi-associated arthritis 1 (mouse) Not determined 4 38250930 72251078 Mouse 1301995 Lprm1_m lymphoproliferation modifier 1 (mouse) Not determined 4 50100262 84100408 Mouse 1302058 Hrtfm3_m heart failure modifier 3 (mouse) Not determined 4 22111944 56112145 Mouse 1301033 Abbp2_m A/J and C57BL/6 blood pressure 2 (mouse) Not determined 4 53550839 93763305 Mouse 26884449 Sklq2_m skull length QTL 2, 5 week (mouse) 4 36700000 128993793 Mouse 27226724 Tibw2_m tibia width 2, proximal, 10 week (mouse) 4 43000000 108357197 Mouse 11532688 Mh_m modifier of hemostasis (mouse) 4 48304775 82304775 Mouse
Fktn
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 4 53,720,007 - 53,720,209 UniSTS GRCm38 MGSCv37 4 53,732,879 - 53,733,081 UniSTS GRCm37 Celera 4 53,676,973 - 53,677,175 UniSTS Cytogenetic Map 4 B2 UniSTS cM Map 4 22.0 UniSTS
Fktn
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 4 B2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000061771 ⟹ ENSMUSP00000061489
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 53,720,005 - 53,763,271 (+) Ensembl GRCm38.p6 Ensembl 4 53,720,005 - 53,763,271 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107638 ⟹ ENSMUSP00000138774
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 53,714,163 - 53,762,787 (+) Ensembl GRCm38.p6 Ensembl 4 53,714,163 - 53,762,787 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000128667 ⟹ ENSMUSP00000114699
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 53,713,998 - 53,765,785 (+) Ensembl GRCm38.p6 Ensembl 4 53,713,998 - 53,765,785 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000221657 ⟹ ENSMUSP00000152867
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 53,714,188 - 53,765,785 (+) Ensembl GRCm38.p6 Ensembl 4 53,714,188 - 53,765,785 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000222290 ⟹ ENSMUSP00000152154
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 4 53,714,163 - 53,777,890 (+) Ensembl GRCm38.p6 Ensembl 4 53,714,163 - 53,777,890 (+) Ensembl
RefSeq Acc Id:
NM_001363126 ⟹ NP_001350055
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,154 - 53,765,785 (+) NCBI GRCm38 4 53,714,154 - 53,765,785 (+) NCBI
Sequence:
AGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGAAGTATCTCTGGTCACAGGAAACAAGATTCTGTTTCATGAAGAAGATGAAAACAACTGGGCTACTGTTAAAAACCACCCAAGAGAA
hide sequence
RefSeq Acc Id:
NM_001363127 ⟹ NP_001350056
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,154 - 53,765,785 (+) NCBI GRCm38 4 53,714,154 - 53,765,785 (+) NCBI
Sequence:
AGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGAAGTATCTCTGGTCACAGGAAA
hide sequence
RefSeq Acc Id:
NM_001363128 ⟹ NP_001350057
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,154 - 53,765,785 (+) NCBI GRCm38 4 53,714,154 - 53,765,785 (+) NCBI
Sequence:
AGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGGTAAGATGAGGGCACCGGGGCCGGGTAGCCGAGCCTGGGCGTGGGCGGGTTCCTTCAGGCACTGTCGCTGGTCTACTGGTATACCC
hide sequence
RefSeq Acc Id:
NM_139309 ⟹ NP_647470
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,154 - 53,765,785 (+) NCBI GRCm38 4 53,714,154 - 53,765,785 (+) NCBI MGSCv37 4 53,727,054 - 53,776,143 (+) RGD Celera 4 53,671,147 - 53,720,238 (+) RGD cM Map 4 ENTREZGENE
Sequence:
AGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGAAGTATCTCTGGTCACAGGAAA
hide sequence
RefSeq Acc Id:
NR_156448
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,154 - 53,765,785 (+) NCBI GRCm38 4 53,714,154 - 53,765,785 (+) NCBI
Sequence:
AGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGAAGTATCTCTGGTCACAGGAAACAAGATTCTGTTTCATGAAGAAGATGAAAACAACTGGGCTACTGTTAAAAACCACCCAAGAGAA
hide sequence
RefSeq Acc Id:
XM_006537941 ⟹ XP_006538004
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,765,785 (+) NCBI GRCm38 4 53,714,194 - 53,765,785 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCA
hide sequence
RefSeq Acc Id:
XM_006537943 ⟹ XP_006538006
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,765,785 (+) NCBI GRCm38 4 53,714,190 - 53,761,301 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCAACTTCATGAGTACTTGCATCACTACATAGTGCTCTTCCCCATTCTGTCCCCAATAGCAGAATGT
hide sequence
RefSeq Acc Id:
XM_030253578 ⟹ XP_030109438
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,106 - 53,765,785 (+) NCBI GRCm38 4 53,714,107 - 53,765,785 (+) NCBI
Sequence:
AGCAACAGCCAGCGTACGCCGCTGCGCGCTTGACCGCTTCTTTGCGACAGTTGCCGTAAAGCGA
hide sequence
RefSeq Acc Id:
XR_003954949
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,765,784 (+) NCBI GRCm38 4 53,714,181 - 53,765,784 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCA
hide sequence
RefSeq Acc Id:
XR_003954950
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,106 - 53,765,784 (+) NCBI GRCm38 4 53,714,107 - 53,765,784 (+) NCBI
Sequence:
AGCAACAGCCAGCGTACGCCGCTGCGCGCTTGACCGCTTCTTTGCGACAGTTGCCGTAAAGCGAGGCCTCCGCCGCAGCTCTAGAGTTAGAAGTATCTCTGGTCACAGGAAACAAGATTCTGTTTCAT
hide sequence
RefSeq Acc Id:
XR_003954951
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,765,784 (+) NCBI GRCm38 4 53,714,188 - 53,765,784 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCAACTTCATGAGTACTTGCATCACTACATAGTGCTCTTCCCCATTCTGTCCCCAATAGCAGAATGT
hide sequence
RefSeq Acc Id:
XR_003954952
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,714,106 - 53,765,784 (+) NCBI GRCm38 4 53,714,107 - 53,765,784 (+) NCBI
Sequence:
AGCAACAGCCAGCGTACGCCGCTGCGCGCTTGACCGCTTCTTTGCGACAGTTGCCGTAAAGCGA
hide sequence
RefSeq Acc Id:
XR_004941904
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,748,480 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCA
hide sequence
RefSeq Acc Id:
XR_004941905
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,765,784 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCAACTTCATGAGTACTTGCATCACTACATAGTGCTCTTCCCCATTCTGTCCCCAATAGCAGAATGT
hide sequence
RefSeq Acc Id:
XR_881064
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,742,580 (+) NCBI GRCm38 4 53,714,188 - 53,742,580 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCAACTTCATGAGTACTTGCATCACTACATAGTGCTCTTCCCCATTCTGTCCCCAATAGCAGAATGT
hide sequence
RefSeq Acc Id:
XR_881065
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 4 53,713,745 - 53,742,526 (+) NCBI GRCm38 4 53,714,188 - 53,742,526 (+) NCBI
Sequence:
TTTCTTTCAAGCCCCAAACTGGAAGATCGCATCTTCTAGACCTGGATGTCAAGTAGGCACCTCA
hide sequence
RefSeq Acc Id:
NP_647470 ⟸ NM_139309
- Peptide Label:
isoform 1
- UniProtKB:
Q8VD64 (UniProtKB/Swiss-Prot), Q8R507 (UniProtKB/Swiss-Prot)
- Sequence:
MSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSARNGPGSSKSKGNRVGFDSTQWRAVKKFIMLTSSQNVPVFLIDPWILESINKNFEQVKNASQGPASECRFFCVPRDFTAFALQYHLWKNEDGWFR
hide sequence
RefSeq Acc Id:
XP_006538004 ⟸ XM_006537941
- Peptide Label:
isoform X1
- UniProtKB:
A0A1Y7VM91 (UniProtKB/TrEMBL)
- Sequence:
MRGDRSEVSLVTGNKILFHEEDENNWATVKNHPREHHRPMSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSARNGPGSSKSKGNRVGFDSTQWRAVKKFIMLTSSQNVPVFLIDPWILESINKNFEQ
hide sequence
RefSeq Acc Id:
XP_006538006 ⟸ XM_006537943
- Peptide Label:
isoform X2
- Sequence:
MRGDRSEVSLVTGNKILFHEEDENNWATVKNHPREHHRPMSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSARNGPGSSKSKGNRVGFDSTQWRAVKKFIMLTSSQNVPVFLIDPWILESINKNFEQ
hide sequence
RefSeq Acc Id:
XP_030109438 ⟸ XM_030253578
- Peptide Label:
isoform X3
RefSeq Acc Id:
NP_001350057 ⟸ NM_001363128
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001350056 ⟸ NM_001363127
- Peptide Label:
isoform 3
RefSeq Acc Id:
NP_001350055 ⟸ NM_001363126
- Peptide Label:
isoform 2
- UniProtKB:
Q3UMQ5 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000152154 ⟸ ENSMUST00000222290
Ensembl Acc Id:
ENSMUSP00000138774 ⟸ ENSMUST00000107638
Ensembl Acc Id:
ENSMUSP00000061489 ⟸ ENSMUST00000061771
Ensembl Acc Id:
ENSMUSP00000114699 ⟸ ENSMUST00000128667
Ensembl Acc Id:
ENSMUSP00000152867 ⟸ ENSMUST00000221657
RGD ID: 6883460 Promoter ID: EPDNEW_M5181 Type: multiple initiation site Name: Fktn_1 Description: Mus musculus fukutin , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 4 53,714,154 - 53,714,214 EPDNEW
RGD ID: 6835330 Promoter ID: MM_KWN:37674 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000061771, ENSMUST00000098071, OTTMUST00000016204, OTTMUST00000016205, UC008SXF.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 4 53,726,809 - 53,727,309 (+) MPROMDB
