Symbol:
Pogz
Name:
pogo transposable element with ZNF domain
RGD ID:
1320616
MGI Page
MGI
Description:
Predicted to enable DNA binding activity and zinc ion binding activity. Predicted to be involved in kinetochore assembly; mitotic sister chromatid cohesion; and positive regulation of transcription by RNA polymerase II. Predicted to act upstream of or within with a positive effect on double-strand break repair via homologous recombination. Predicted to be located in chromatin; cytosol; and nucleoplasm. Predicted to be active in nucleus. Is expressed in several structures, including brain; early conceptus; genitourinary system; hemolymphoid system; and liver. Used to study autism spectrum disorder. Human ortholog(s) of this gene implicated in White-Sutton syndrome. Orthologous to human POGZ (pogo transposable element derived with ZNF domain).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
9530006B08Rik; AU015913; AU044539
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
POGZ (pogo transposable element derived with ZNF domain) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Pogz (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pogz (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
POGZ (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
POGZ (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pogz (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
POGZ (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
POGZ (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pogz (pogo transposable element derived with ZNF domain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Pogz (pogo transposable element derived with ZNF domain)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
POGZ (pogo transposable element derived with ZNF domain)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pogzb (pogo transposable element derived with ZNF domain b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
pogza (pogo transposable element derived with ZNF domain a)
Alliance
DIOPT (OrthoFinder|OrthoInspector|ZFIN)
Drosophila melanogaster (fruit fly):
row
Alliance
DIOPT (OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
pogz
Alliance
DIOPT (Ensembl Compara|OMA|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 94,730,289 - 94,790,888 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 94,744,878 - 94,789,637 (+) Ensembl GRCm39 Ensembl GRCm38 3 94,822,989 - 94,883,577 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 94,837,567 - 94,882,326 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 94,641,489 - 94,687,491 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 94,923,117 - 94,966,213 (+) NCBI MGSCv36 mm8 Celera 3 96,268,238 - 96,314,269 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.74 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Mouse brain organization revealed through direct genome-scale TF expression analysis.
Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
2.
Large-scale cDNA analysis reveals phased gene expression patterns during preimplantation mouse development.
Ko MS, etal., Development 2000 Apr;127(8):1737-49.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Database resources of the National Center for Biotechnology Information.
Wheeler DL, etal., Nucleic Acids Res 2001 Jan 1;29(1):11-6.
Pogz Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 94,730,289 - 94,790,888 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 94,744,878 - 94,789,637 (+) Ensembl GRCm39 Ensembl GRCm38 3 94,822,989 - 94,883,577 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 94,837,567 - 94,882,326 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 94,641,489 - 94,687,491 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 94,923,117 - 94,966,213 (+) NCBI MGSCv36 mm8 Celera 3 96,268,238 - 96,314,269 (+) NCBI Celera Cytogenetic Map 3 F2.1 NCBI cM Map 3 40.74 NCBI
POGZ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 151,402,724 - 151,459,494 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 151,402,724 - 151,459,494 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 151,375,200 - 151,431,970 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 149,641,824 - 149,698,556 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 148,188,272 - 148,245,005 NCBI Celera 1 124,490,466 - 124,547,192 (-) NCBI Celera Cytogenetic Map 1 q21.3 NCBI HuRef 1 122,753,210 - 122,809,847 (-) NCBI HuRef CHM1_1 1 152,770,790 - 152,827,420 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 150,526,433 - 150,583,190 (-) NCBI T2T-CHM13v2.0
Pogz Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 185,069,492 - 185,129,741 (+) NCBI GRCr8 mRatBN7.2 2 182,394,269 - 182,440,711 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 182,380,768 - 182,440,707 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 190,077,496 - 190,105,366 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 187,872,867 - 187,900,748 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 182,709,966 - 182,737,835 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 195,995,322 - 196,041,500 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 195,996,521 - 196,041,497 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 215,507,126 - 215,534,827 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 189,748,657 - 189,776,355 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 189,685,298 - 189,728,992 (+) NCBI Celera 2 174,957,108 - 174,984,012 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
Pogz Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955589 920,508 - 976,366 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955589 920,729 - 975,242 (+) NCBI ChiLan1.0 ChiLan1.0
POGZ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 98,351,060 - 98,420,975 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 98,102,244 - 98,172,148 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 126,761,777 - 126,818,262 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 130,407,426 - 130,463,909 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 130,407,426 - 130,463,909 (-) Ensembl panpan1.1 panPan2
POGZ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 17 60,464,609 - 60,511,735 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 17 60,465,230 - 60,511,934 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 17 59,909,098 - 59,954,694 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 17 61,482,101 - 61,528,240 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 17 61,480,642 - 61,528,466 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 17 60,309,922 - 60,355,542 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 17 60,395,876 - 60,441,670 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 17 61,124,503 - 61,170,655 (-) NCBI UU_Cfam_GSD_1.0
Pogz Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 22,583,808 - 22,620,357 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936580 1,615,713 - 1,650,874 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936580 1,613,425 - 1,650,849 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
POGZ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 97,776,589 - 97,833,282 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 97,776,579 - 97,833,287 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 106,997,208 - 107,034,066 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
POGZ Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 12,236,036 - 12,290,937 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 12,236,145 - 12,290,956 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 11,809,947 - 11,865,321 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pogz
.
Predicted Target Of
Count of predictions: 2329 Count of miRNA genes: 691 Interacting mature miRNAs: 916 Transcripts: ENSMUST00000042402, ENSMUST00000107265, ENSMUST00000107266, ENSMUST00000107269, ENSMUST00000107270, ENSMUST00000125638, ENSMUST00000126235, ENSMUST00000132544, ENSMUST00000140397, ENSMUST00000142253 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
4142399 Aec1_m autoimmune exocrinopathy 1 (mouse) Not determined 7586174 102690034 Mouse 26884378 Skwq6_m skull length QTL 6, 10 week (mouse) 3 51907421 102307316 Mouse 1301971 Cia5_m collagen induced arthritis QTL 5 (mouse) Not determined 3 66046658 100046795 Mouse 1301392 Eae3_m susceptibility to experimental allergic encephalomyelitis 3 (mouse) Not determined 3 79548730 113548837 Mouse 1301904 Iba2_m induction of brown adipocytes 2 (mouse) Not determined 3 82147043 116147184 Mouse 26884382 Bzwq1_m bi-zygomatic width QTL 1, 5 week (mouse) 3 52207421 137205761 Mouse 11041900 Lmr11a_m leishmaniasis resistance 11a (mouse) 3 83463991 117464137 Mouse 1301398 Rapop3_m radiation-induced apoptosis 3 (mouse) Not determined 3 90511217 100464137 Mouse 26884380 Skwq1_m skull length QTL 1, 5 week (mouse) 3 43954435 101607316 Mouse 14746984 Manh54_m mandible shape 54 (mouse) 3 85289152 119289152 Mouse 12738440 Twq3_m testis weight QTL 3 (mouse) 3 87228015 121228015 Mouse 25314313 Syncl1_m synaptonemal complex length 1 (mouse) 3 67907333 128393649 Mouse 1301272 Cfsw1_m cystic fibrosis survival to weaning 1 (mouse) Not determined 3 83882912 117883044 Mouse 1301791 Char4_m P. chabaudi malaria resistance QTL 4 (mouse) Not determined 3 69625509 100655290 Mouse 11049572 Lmr11c_m leishmaniasis resistance 11c (mouse) 3 72139967 106140094 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 26884427 Cvht4_m cranial vault height 4, 10 week (mouse) 3 16054164 109707316 Mouse 4141294 Bmd24_m bone mineral density 24 (mouse) Not determined 3 61740061 95740241 Mouse 10766455 Sle22_m systematic lupus erythematosus susceptibility 22 (mouse) 3 90376936 124377072 Mouse 14747001 Mancz4_m mandible centroid size 4 (mouse) 3 90378017 124378017 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 13207570 Tcq12_m total cholesterol QTL 12 (mouse) 3 16504164 130163649 Mouse 1357583 Sle18_m systematic lupus erythematosus susceptibility 18 (mouse) Not determined 3 87208904 125316236 Mouse 26884422 Cvht7_m cranial vault height 7, 16 week (mouse) 3 28954149 118893649 Mouse 4142178 Ctrq2_m C. trachomatis resistance QTL 2 (mouse) Not determined 3 89139967 137453008 Mouse 1300595 Tmevd2_m Theiler's murine encephalomyelitis virus induced demyelinating disease susceptibility 2 (mouse) Not determined 3 75463302 109463549 Mouse 11251721 Ewc3_m ethanol withdrawal and consumption 3 (mouse) 3 69568554 103568554 Mouse 1300982 Lmr11_m leishmaniasis resistance 11 (mouse) Not determined 3 72139967 106140094 Mouse 1301947 Pcfm3_m periosteal circumference and femur length 3 (mouse) Not determined 3 81084652 115084797 Mouse 4142099 Cq3_m cholesterol QTL 3 (mouse) Not determined 3 84888918 118889067 Mouse 11039512 Ltpr3b_m Leishmania tropica response 3b (mouse) 3 83463991 117464137 Mouse 1301349 Pgia26_m proteoglycan induced arthritis 26 (mouse) Not determined 3 92251533 126251650 Mouse 11039519 Ltpr3_m Leishmania tropica response 3 (mouse) 3 56704102 100464137 Mouse 1302052 Etohcta4_m ethanol conditioned taste aversion 4 (mouse) Not determined 3 91000105 125008748 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 11039507 Ltpr3g_m Leishmania tropica response 3g (mouse) 3 83463991 117464137 Mouse 11039508 Ltpr3f_m Leishmania tropica response 3f (mouse) 3 83463991 117464137 Mouse 1301422 Sle11_m systematic lupus erythematosus susceptibility 11 (mouse) Not determined 3 70208904 104209042 Mouse 11039509 Ltpr3e_m Leishmania tropica response 3e (mouse) 3 83463991 117464137 Mouse 11039510 Ltpr3d_m Leishmania tropica response 3d (mouse) 3 83463991 117464137 Mouse 13208566 Bmiq5_m body mass index QTL 5 (mouse) 3 40954435 115793649 Mouse 11039511 Ltpr3c_m Leishmania tropica response 3c (mouse) 3 83463991 117464137 Mouse
AU015913
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 94,882,026 - 94,882,275 UniSTS GRCm38 MGSCv37 3 94,685,948 - 94,686,197 UniSTS GRCm37 Celera 3 96,312,726 - 96,312,975 UniSTS Cytogenetic Map 3 F2.1 UniSTS Whitehead/MRC_RH 3 1071.71 UniSTS
AU044539
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 94,881,976 - 94,882,241 UniSTS GRCm38 MGSCv37 3 94,685,898 - 94,686,163 UniSTS GRCm37 Celera 3 96,312,676 - 96,312,941 UniSTS Cytogenetic Map 3 F2.1 UniSTS Whitehead/MRC_RH 3 1069.39 UniSTS
ECD10327
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 94,876,755 - 94,877,371 UniSTS GRCm38 MGSCv37 3 94,680,677 - 94,681,293 UniSTS GRCm37 Celera 3 96,307,454 - 96,308,070 UniSTS Cytogenetic Map 3 F2.1 UniSTS
stSG627185
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 3 94,860,862 - 94,862,487 UniSTS GRCm38 MGSCv37 3 94,664,784 - 94,666,409 UniSTS GRCm37 Celera 3 96,291,555 - 96,293,180 UniSTS Cytogenetic Map 3 F2.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000042402 ⟹ ENSMUSP00000037523
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,745,024 - 94,788,186 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,713 - 94,880,875 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107265
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,745,008 - 94,768,904 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,697 - 94,861,593 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107266 ⟹ ENSMUSP00000102887
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,745,024 - 94,787,643 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,713 - 94,880,332 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107269 ⟹ ENSMUSP00000102890
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,745,024 - 94,789,635 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,713 - 94,882,324 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000107270 ⟹ ENSMUSP00000102891
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,744,878 - 94,789,637 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,567 - 94,882,326 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000125638
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,778,623 - 94,781,062 (+) Ensembl GRCm38.p6 Ensembl 3 94,871,312 - 94,873,751 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000126235
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,745,024 - 94,773,813 (+) Ensembl GRCm38.p6 Ensembl 3 94,837,713 - 94,866,502 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000132544
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,771,039 - 94,771,861 (+) Ensembl GRCm38.p6 Ensembl 3 94,863,728 - 94,864,550 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000140397 ⟹ ENSMUSP00000122492
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,771,830 - 94,779,613 (+) Ensembl GRCm38.p6 Ensembl 3 94,864,519 - 94,872,302 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000142253
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,784,966 - 94,786,277 (+) Ensembl GRCm38.p6 Ensembl 3 94,877,655 - 94,878,966 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000249403 ⟹ ENSMUSP00000159753
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 94,744,878 - 94,789,637 (+) Ensembl
RefSeq Acc Id:
NM_001165948 ⟹ NP_001159420
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,748 - 94,790,888 (+) NCBI GRCm38 3 94,837,437 - 94,883,577 (+) NCBI MGSCv37 3 94,641,489 - 94,687,491 (+) RGD Celera 3 96,268,238 - 96,314,269 (+) RGD cM Map 3 ENTREZGENE
Sequence:
GGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCCTTGGCCCCCCCACCCCCTCCCTCGGGGCCCCCCGCCCCCCTCGGGAAAAAAATCCACCCCAATCACTCGAACCCGAGGGAG
hide sequence
RefSeq Acc Id:
NM_001368811 ⟹ NP_001355740
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,748 - 94,790,888 (+) NCBI GRCm38 3 94,837,437 - 94,883,577 (+) NCBI
Sequence:
GGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCCTTGGCCCCCCCACCCCCTCCCTCGGGGCCCCCCGCCCCCCTCGGGAAAAAAATCCACCCCAATCACTCGAACCCGAGGGAG
hide sequence
RefSeq Acc Id:
NM_001368812 ⟹ NP_001355741
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,748 - 94,790,888 (+) NCBI GRCm38 3 94,837,437 - 94,883,577 (+) NCBI
Sequence:
GGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCCTTGGCCCCCCCACCCCC
hide sequence
RefSeq Acc Id:
NM_172683 ⟹ NP_766271
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,748 - 94,790,888 (+) NCBI GRCm38 3 94,837,437 - 94,883,577 (+) NCBI MGSCv37 3 94,641,489 - 94,687,491 (+) RGD Celera 3 96,268,238 - 96,314,269 (+) RGD cM Map 3 ENTREZGENE
Sequence:
GGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCCTTGGCCCCCCCACCCCCTCCCTCGGGGCCCCCCGCCCCCCTCGGGAAAAAAATCCACCCCAATCACTCGAACCCGAGGGAG
hide sequence
RefSeq Acc Id:
XM_006501362 ⟹ XP_006501425
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,700 - 94,789,637 (+) NCBI GRCm38 3 94,837,389 - 94,882,326 (+) NCBI
Sequence:
TGACGAGAGGTATCCCTCCGCGGGGCGAGAGGGTCGGTGGGGGGAGTCGGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCCTTGGCCCCCCCACCCCCTCCCTCGGGGCCCCCC
hide sequence
RefSeq Acc Id:
XM_006501363 ⟹ XP_006501426
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,700 - 94,789,637 (+) NCBI GRCm38 3 94,837,389 - 94,882,326 (+) NCBI
Sequence:
TGACGAGAGGTATCCCTCCGCGGGGCGAGAGGGTCGGTGGGGGGAGTCGGCGTTTCTCTCCCCC
hide sequence
RefSeq Acc Id:
XM_011240090 ⟹ XP_011238392
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,730,289 - 94,789,637 (+) NCBI GRCm38 3 94,822,989 - 94,880,884 (+) NCBI
Sequence:
AGCTCAGGCTAGTCTCAAGTTTGCTAAATATCCAAGGACGACTTTGAACTCCTGATTCTCAATG
hide sequence
RefSeq Acc Id:
XM_036163056 ⟹ XP_036018949
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 94,744,731 - 94,789,637 (+) NCBI
Sequence:
GGTCGGTGGGGGGAGTCGGCGTTTCTCTCCCCCGCGCCAGCTCCCATACACGGAGCCACATTCC
hide sequence
RefSeq Acc Id:
NP_766271 ⟸ NM_172683
- Peptide Label:
isoform 1
- UniProtKB:
Q8C0K1 (UniProtKB/Swiss-Prot), Q80TZ8 (UniProtKB/Swiss-Prot), Q4VA94 (UniProtKB/Swiss-Prot), Q8K294 (UniProtKB/Swiss-Prot), Q8BZH4 (UniProtKB/Swiss-Prot), B9EIG6 (UniProtKB/TrEMBL), Q3TSQ2 (UniProtKB/TrEMBL)
- Sequence:
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTSVSVSQQPVSAPVPIAAHASVAGHLSTSTTVSNSGAQNSDSTKKTLVTLIANNNAGNTLVQQGGQPLILTQNPAPGLGTMVTQPVLRP
hide sequence
RefSeq Acc Id:
NP_001159420 ⟸ NM_001165948
- Peptide Label:
isoform 2
- UniProtKB:
Q0VGT3 (UniProtKB/TrEMBL), Q3TSQ2 (UniProtKB/TrEMBL)
- Sequence:
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTSVSVSQQPVSAPVPIAAHASVAGH
hide sequence
RefSeq Acc Id:
XP_006501425 ⟸ XM_006501362
- Peptide Label:
isoform X2
- UniProtKB:
D3YUX1 (UniProtKB/TrEMBL), Q3TSQ2 (UniProtKB/TrEMBL)
- Sequence:
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTSAGNTLVQQGGQPLILTQNPAPGL
hide sequence
RefSeq Acc Id:
XP_006501426 ⟸ XM_006501363
- Peptide Label:
isoform X3
- UniProtKB:
Q3TSQ2 (UniProtKB/TrEMBL)
- Sequence:
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTSAGNTLVQQGGQPLILTQNPAPGL
hide sequence
RefSeq Acc Id:
XP_011238392 ⟸ XM_011240090
- Peptide Label:
isoform X1
- UniProtKB:
Q8C0K1 (UniProtKB/Swiss-Prot), Q80TZ8 (UniProtKB/Swiss-Prot), Q4VA94 (UniProtKB/Swiss-Prot), Q8K294 (UniProtKB/Swiss-Prot), Q8BZH4 (UniProtKB/Swiss-Prot), B9EIG6 (UniProtKB/TrEMBL), Q3TSQ2 (UniProtKB/TrEMBL)
- Sequence:
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTSVSVSQQPVSAPVPIAAHASVAGH
hide sequence
RefSeq Acc Id:
NP_001355740 ⟸ NM_001368811
- Peptide Label:
isoform 3
- UniProtKB:
D3YUW8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001355741 ⟸ NM_001368812
- Peptide Label:
isoform 4
- UniProtKB:
D3YUW8 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000102891 ⟸ ENSMUST00000107270
Ensembl Acc Id:
ENSMUSP00000102887 ⟸ ENSMUST00000107266
Ensembl Acc Id:
ENSMUSP00000102890 ⟸ ENSMUST00000107269
Ensembl Acc Id:
ENSMUSP00000037523 ⟸ ENSMUST00000042402
Ensembl Acc Id:
ENSMUSP00000122492 ⟸ ENSMUST00000140397
RefSeq Acc Id:
XP_036018949 ⟸ XM_036163056
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSMUSP00000159753 ⟸ ENSMUST00000249403
RGD ID: 6834259 Promoter ID: MM_KWN:35226 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, ES_Cell, Kidney, Liver, MEF_B4, MEF_B6 Transcripts: ENSMUST00000107265, ENSMUST00000107266, ENSMUST00000107269, NM_001165948, NM_172683, OTTMUST00000047050 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 94,641,121 - 94,641,667 (+) MPROMDB
RGD ID: 6834261 Promoter ID: MM_KWN:35227 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Lung Transcripts: OTTMUST00000047052, OTTMUST00000082770 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 94,667,476 - 94,668,387 (+) MPROMDB
RGD ID: 6834260 Promoter ID: MM_KWN:35228 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney, Lung Transcripts: OTTMUST00000047053 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 94,674,864 - 94,675,364 (+) MPROMDB
RGD ID: 6834262 Promoter ID: MM_KWN:35229 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: OTTMUST00000047054 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 94,680,391 - 94,680,891 (+) MPROMDB
RGD ID: 6881512 Promoter ID: EPDNEW_M4207 Type: multiple initiation site Name: Pogz_2 Description: Mus musculus pogo transposable element with ZNF domain , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M4208 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 94,837,548 - 94,837,608 EPDNEW
RGD ID: 6881514 Promoter ID: EPDNEW_M4208 Type: multiple initiation site Name: Pogz_1 Description: Mus musculus pogo transposable element with ZNF domain , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M4207 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 94,837,713 - 94,837,773 EPDNEW
