Advanced Search (OLGA)

Gene: Gskip (GSK3B interacting protein) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Gskip

Name:

GSK3B interacting protein

RGD ID:

1318257

MGI Page

MGI

Description:

Predicted to enable protein kinase A regulatory subunit binding activity; protein kinase binding activity; and protein kinase inhibitor activity. Predicted to be involved in intrinsic apoptotic signaling pathway in response to oxidative stress; negative regulation of protein kinase activity; and positive regulation of canonical Wnt signaling pathway. Predicted to be located in nucleus and perinuclear region of cytoplasm. Predicted to be active in cytoplasm. Is expressed in several structures, including gut; liver; metanephros; spleen; and testis. Orthologous to human GSKIP (GSK3B interacting protein).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

4933433P14Rik; FLJ20789; GSK3-beta interaction protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GSKIP (GSK3B interacting protein)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Rattus norvegicus (Norway rat):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Gskip (GSK3B interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GSKIP (GSK3B interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gskip (gsk3b interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Drosophila melanogaster (fruit fly):	CG11523	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C06A12.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T24H7.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	Y43F8B.2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG14505	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gskip	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	105,651,611 - 105,669,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	105,651,088 - 105,669,282 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	105,685,352 - 105,703,058 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	105,684,829 - 105,703,023 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	106,923,562 - 106,941,268 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	106,086,491 - 106,104,097 (+)	NCBI		MGSCv36	mm8
Celera	12	106,919,875 - 106,937,566 (+)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	55.92	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	acute myeloid leukemia		ISO	GSKIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Acute myeloid leukemia	ClinVar
Gskip	Mouse	essential thrombocythemia		ISO	GSKIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Thrombocythemia 1	ClinVar
Gskip	Mouse	myelofibrosis		ISO	GSKIP (Homo sapiens)	8554872	ClinVar Annotator: match by term: Primary myelofibrosis	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	myeloid leukemia		ISO	GSKIP (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26280900
Gskip	Mouse	myeloid neoplasm		ISO	GSKIP (Homo sapiens)	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:26280900

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSKIP mRNA	CTD	PMID:36331819
Gskip	Mouse	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of GSKIP mRNA	CTD	PMID:39298647
Gskip	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Gskip (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin affects the expression of GSKIP mRNA	CTD	PMID:22298810
Gskip	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Gskip (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of GSKIP mRNA	CTD	PMID:21724226 and PMID:33387578
Gskip	Mouse	2-hydroxypropanoic acid	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	Lactic Acid results in decreased expression of GSKIP mRNA	CTD	PMID:30851411
Gskip	Mouse	4,4'-sulfonyldiphenol	decreases expression	EXP		6480464	bisphenol S results in decreased expression of GSKIP mRNA	CTD	PMID:39298647
Gskip	Mouse	arsenite(3-)	multiple interactions	ISO	GSKIP (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to GSKIP mRNA]	CTD	PMID:32406909
Gskip	Mouse	atrazine	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	Atrazine results in decreased expression of GSKIP mRNA	CTD	PMID:22378314
Gskip	Mouse	bisphenol A	increases expression	ISO	Gskip (Rattus norvegicus)	6480464	bisphenol A results in increased expression of GSKIP mRNA	CTD	PMID:25181051
Gskip	Mouse	bisphenol A	decreases methylation	ISO	GSKIP (Homo sapiens)	6480464	bisphenol A results in decreased methylation of GSKIP gene	CTD	PMID:31601247
Gskip	Mouse	bisphenol A	increases methylation	ISO	Gskip (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of GSKIP gene	CTD	PMID:28505145
Gskip	Mouse	carbon nanotube	increases expression	EXP		6480464	Nanotubes more ...	CTD	PMID:25620056
Gskip	Mouse	chromium(6+)	affects expression	EXP		6480464	chromium hexavalent ion affects the expression of GSKIP mRNA	CTD	PMID:28472532
Gskip	Mouse	clothianidin	increases expression	ISO	GSKIP (Homo sapiens)	6480464	clothianidin results in increased expression of GSKIP mRNA	CTD	PMID:29044138
Gskip	Mouse	copper(II) sulfate	increases expression	ISO	GSKIP (Homo sapiens)	6480464	Copper Sulfate results in increased expression of GSKIP mRNA	CTD	PMID:19549813
Gskip	Mouse	DDE	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	Dichlorodiphenyl Dichloroethylene results in decreased expression of GSKIP mRNA	CTD	PMID:38568856
Gskip	Mouse	Dibutyl phosphate	affects expression	ISO	GSKIP (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of GSKIP mRNA	CTD	PMID:37042841
Gskip	Mouse	dicrotophos	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	dicrotophos results in decreased expression of GSKIP mRNA	CTD	PMID:28302478
Gskip	Mouse	disodium selenite	increases expression	ISO	GSKIP (Homo sapiens)	6480464	Sodium Selenite results in increased expression of GSKIP mRNA	CTD	PMID:18175754
Gskip	Mouse	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of GSKIP mRNA	CTD	PMID:30319688
Gskip	Mouse	fipronil	decreases expression	ISO	Gskip (Rattus norvegicus)	6480464	fipronil results in decreased expression of GSKIP mRNA	CTD	PMID:34044035
Gskip	Mouse	furan	increases expression	ISO	Gskip (Rattus norvegicus)	6480464	furan results in increased expression of GSKIP mRNA	CTD	PMID:26194646
Gskip	Mouse	gentamycin	decreases expression	ISO	Gskip (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of GSKIP mRNA	CTD	PMID:33387578
Gskip	Mouse	manganese(II) chloride	increases expression	ISO	Gskip (Rattus norvegicus)	6480464	manganese chloride results in increased expression of GSKIP mRNA	CTD	PMID:28801915
Gskip	Mouse	ozone	multiple interactions	ISO	GSKIP (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of GSKIP mRNA	CTD	PMID:35430440
Gskip	Mouse	paracetamol	increases expression	ISO	GSKIP (Homo sapiens)	6480464	Acetaminophen results in increased expression of GSKIP mRNA	CTD	PMID:22230336
Gskip	Mouse	paracetamol	decreases expression	ISO	Gskip (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of GSKIP mRNA	CTD	PMID:33387578
Gskip	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GSKIP mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of GSKIP mRNA	CTD	PMID:36331819
Gskip	Mouse	quercetin	increases expression	ISO	GSKIP (Homo sapiens)	6480464	Quercetin results in increased expression of GSKIP mRNA	CTD	PMID:30152185
Gskip	Mouse	rac-lactic acid	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	Lactic Acid results in decreased expression of GSKIP mRNA	CTD	PMID:30851411
Gskip	Mouse	silicon dioxide	decreases expression	ISO	GSKIP (Homo sapiens)	6480464	Silicon Dioxide analog results in decreased expression of GSKIP mRNA	CTD	PMID:25895662
Gskip	Mouse	sodium arsenite	increases expression	ISO	GSKIP (Homo sapiens)	6480464	sodium arsenite results in increased expression of GSKIP mRNA	CTD	PMID:38568856
Gskip	Mouse	thioacetamide	decreases expression	ISO	Gskip (Rattus norvegicus)	6480464	Thioacetamide results in decreased expression of GSKIP mRNA	CTD	PMID:34492290
Gskip	Mouse	trichostatin A	affects expression	ISO	GSKIP (Homo sapiens)	6480464	trichostatin A affects the expression of GSKIP mRNA	CTD	PMID:28542535
Gskip	Mouse	triphenyl phosphate	increases expression	ISO	Gskip (Rattus norvegicus)	6480464	triphenyl phosphate results in increased expression of GSKIP mRNA	CTD	PMID:30589522
Gskip	Mouse	urethane	increases expression	ISO	GSKIP (Homo sapiens)	6480464	Urethane results in increased expression of GSKIP mRNA	CTD	PMID:28818685

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	intrinsic apoptotic signaling pathway in response to oxidative stress	involved_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024
Gskip	Mouse	intrinsic apoptotic signaling pathway in response to oxidative stress	involved_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	negative regulation of protein kinase activity	involved_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024
Gskip	Mouse	negative regulation of protein kinase activity	involved_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	positive regulation of canonical Wnt signaling pathway	involved_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024
Gskip	Mouse	positive regulation of canonical Wnt signaling pathway	involved_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	regulation of Wnt signaling pathway	involved_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	regulation of Wnt signaling pathway	involved_in	IBA	PANTHER:PTN000281386 and UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000033
Gskip	Mouse	regulation of Wnt signaling pathway	involved_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	cytoplasm	located_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024
Gskip	Mouse	cytoplasm	located_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	cytoplasm	is_active_in	IBA	PANTHER:PTN001393826 and UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000033
Gskip	Mouse	nucleus	located_in	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	nucleus	located_in	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024
Gskip	Mouse	perinuclear region of cytoplasm	located_in	ISS	UniProtKB:Q9WV60	2290270		BHF-UCL	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	beta-catenin binding	NOT\|enables	ISO	GSKIP (Homo sapiens)	9068941	PMID:27484798	UniProt	PMID:27484798
Gskip	Mouse	kinase regulator activity	enables	IBA	PANTHER:PTN001393826 and UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000033
Gskip	Mouse	protein binding	enables	ISO	UniProtKB:P49840	9068941	PMID:20368287 more ...	IntAct	PMID:20368287 more ...
Gskip	Mouse	protein binding	enables	ISO	UniProtKB:P13861 more ...	9068941	PMID:20007971	UniProt	PMID:20007971
Gskip	Mouse	protein binding	enables	ISO	UniProtKB:P12368	9068941	PMID:20007971	UniProt	PMID:20007971 and REF_RGD_ID:13210529
Gskip	Mouse	protein binding	enables	ISO	UniProtKB:P49841	9068941	PMID:25920809 and PMID:27484798	UniProt	PMID:25920809 and PMID:27484798
Gskip	Mouse	protein kinase A binding	enables	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	protein kinase A binding	enables	IBA	PANTHER:PTN001393826 and UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000033
Gskip	Mouse	protein kinase A regulatory subunit binding	enables	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	protein kinase A regulatory subunit binding	enables	IEA	UniProtKB:Q9P0R6 and ensembl:ENSP00000450420	2290270		Ensembl	GO_REF:0000107
Gskip	Mouse	protein kinase binding	enables	IEA	UniProtKB:Q9P0R6 and ensembl:ENSP00000450420	2290270		Ensembl	GO_REF:0000107
Gskip	Mouse	protein kinase binding	enables	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	protein kinase inhibitor activity	enables	ISO	UniProtKB:Q9P0R6	2290270		GO_Central	GO_REF:0000119
Gskip	Mouse	protein kinase inhibitor activity	enables	ISS	UniProtKB:Q9P0R6	2290270		UniProt	GO_REF:0000024

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Gskip	Mouse	abnormal hard palate morphology		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	abnormal palatal shelf morphology		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	cleft secondary palate		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	cyanosis		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	decreased vocalization		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	delayed bone ossification		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	lethality throughout fetal growth and development, incomplete penetrance		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	neonatal lethality, complete penetrance		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	palatal shelves fail to meet at midline		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	pallor		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	primary atelectasis		IAGP		5509061		MGI	PMID:26582204
Gskip	Mouse	respiratory failure		IAGP		5509061		MGI	PMID:26582204

#	Reference Title	Reference Citation
1.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:10922068	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12520002	PMID:14610273	PMID:15489334	PMID:16141072	PMID:16141073	PMID:16981698
PMID:18799693	PMID:21267068	PMID:21873635	PMID:26582204	PMID:32325033	PMID:32828530	PMID:34748402

Gskip
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	105,651,611 - 105,669,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	105,651,088 - 105,669,282 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	105,685,352 - 105,703,058 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	105,684,829 - 105,703,023 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	106,923,562 - 106,941,268 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	106,086,491 - 106,104,097 (+)	NCBI		MGSCv36	mm8
Celera	12	106,919,875 - 106,937,566 (+)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	55.92	NCBI

GSKIP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	96,363,526 - 96,387,290 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	96,363,452 - 96,387,288 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	96,829,863 - 96,853,627 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	95,915,775 - 95,923,321 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	95,899,622 - 95,922,362	NCBI
Celera	14	76,901,748 - 76,909,294 (+)	NCBI		Celera
Cytogenetic Map	14	q32.2	NCBI
HuRef	14	77,014,876 - 77,038,713 (+)	NCBI		HuRef
CHM1_1	14	96,768,634 - 96,792,467 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	90,595,122 - 90,618,884 (+)	NCBI		T2T-CHM13v2.0

Gskip
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	130,357,241 - 130,373,221 (+)	NCBI		GRCr8
mRatBN7.2	6	124,586,087 - 124,609,106 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	124,586,070 - 124,609,100 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	124,713,904 - 124,729,726 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	125,009,170 - 125,024,993 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	124,370,337 - 124,386,317 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	129,512,950 - 129,536,320 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	129,519,709 - 129,536,221 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	138,706,202 - 138,729,236 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	129,842,160 - 129,858,112 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	129,845,906 - 129,861,859 (+)	NCBI
Celera	6	122,159,593 - 122,175,547 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

Gskip
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	18,153,564 - 18,177,899 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	18,153,564 - 18,174,980 (+)	NCBI	ChiLan1.0	ChiLan1.0

GSKIP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	97,523,394 - 97,547,474 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	96,739,898 - 96,763,980 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	76,993,055 - 77,017,142 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	96,331,789 - 96,339,378 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	96,329,936 - 96,339,378 (+)	Ensembl	panpan1.1		panPan2

GSKIP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	65,110,659 - 65,131,205 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	65,111,414 - 65,129,622 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	64,626,310 - 64,647,821 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	65,382,175 - 65,403,816 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	65,383,060 - 65,450,126 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	65,054,862 - 65,076,654 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	65,116,291 - 65,137,874 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	65,439,899 - 65,461,533 (+)	NCBI		UU_Cfam_GSD_1.0

Gskip
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	9,406,837 - 9,424,882 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936604	657,400 - 675,923 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936604	657,602 - 675,702 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GSKIP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	117,586,764 - 117,607,564 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	117,586,742 - 117,607,575 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	124,844,708 - 124,865,661 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GSKIP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	74,246,221 - 74,270,608 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	74,246,255 - 74,271,765 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	61,397,502 - 61,422,002 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gskip
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	7,002,240 - 7,015,194 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	7,003,240 - 7,015,215 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Gskip
555 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	702
Count of miRNA genes:	379
Interacting mature miRNAs:	431
Transcripts:	ENSMUST00000051934
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
39128213	Lwq23_m	liver weight QTL 10 (mouse)					12	80956708	113383533	Mouse
1300883	Ath21_m	atherosclerosis 21 (mouse)			Not determined		12	85961579	119961683	Mouse
12910532	Nrq10a_m	noise-induced hearing loss resistant QTL 10a (mouse)					12	92750025	120092757	Mouse
12910533	Nrq10_m	noise-induced hearing loss resistant QTL 10 (mouse)					12	92750025	120092757	Mouse
12910790	Pwgrq7_m	pre-weaning growth rate QTL 7 (mouse)					12	90937367	108645308	Mouse
1357463	Vtbt14_m	vertebral trabecular bone trait 14 (mouse)			Not determined		12	92936097	120092757	Mouse
1301269	Sluc12_m	susceptibility to lung cancer 12 (mouse)			Not determined		12	96860337	120092757	Mouse
4142007	Chlq17_m	circulating hormone level QTL 17 (mouse)			Not determined		12	88052874	120092757	Mouse
25823169	Hrsq8_m	host response to SARS QTL 8, log titer (mouse)					12	81696245	108495368	Mouse
4142002	Tbqt3_m	tibia bone quality traits 3 (mouse)			Not determined		12	35285496	109936243	Mouse
11039526	Ccc1_m	colitis susceptibility in the Collaborative Cross 1 (mouse)					12	93528334	111028223	Mouse
1300545	Lifespan3_m	life span 3 (mouse)			Not determined		12	88052874	120092757	Mouse
4141738	Tgq23_m	triglyceride QTL 23 (mouse)			Not determined			72112877	106112877	Mouse
4141610	Tailaq1_m	tail length adjusted QTL 1 (mouse)			Not determined			80956708	113383533	Mouse
1301836	Heal5_m	wound healing/regeneration 5 (mouse)			Not determined		12	89939031	120092757	Mouse
13524846	Ppiq11_m	prepulse inhibition QTL 11 (mouse)					12	82666396	116666396	Mouse
10412156	Nociq3_m	nociceptive sensitivity inflammatory QTL 3 (mouse)			Not determined		12	86396075	114831653	Mouse
13524842	Ppiq10a_m	prepulse inhibition QTL 10a (mouse)					12	77512220	111512220	Mouse
1301879	Insq10_m	insulin QTL 10 (mouse)			Not determined		12	83532075	117532224	Mouse
10402491	Dipa4_m	drug induced psychomotor activation 4 (mouse)			Not determined		12	91222515	120092757	Mouse
1301492	Dbsty3_m	diabesity 3 (mouse)			Not determined		12	83532075	117532224	Mouse
4141335	W6q10_m	weight 6 weeks QTL 10 (mouse)			Not determined			80956708	113383533	Mouse
5491194	Mobq3_m	multigenic obesity QTL 3 (mouse)			Not determined		12	89664071	120092757	Mouse
1302138	Im6_m	immunoregulatory 6 (mouse)			Not determined		12	96860337	120092757	Mouse
1301689	Skull18_m	skull morphology 18 (mouse)			Not determined		12	73887422	107887526	Mouse
1301308	Prdt4_m	prion disease incubation time 4 (mouse)			Not determined		12	88308354	120092757	Mouse
1301922	Bbaa6_m	B.burgdorferi-associated arthritis 6 (mouse)			Not determined		12	90308268	120092757	Mouse
25394546	Skmw76_m	skeletal muscle weight 76, TA (mouse)					12	102593095	106941888	Mouse
1302177	Dps2_m	delta power in slow-wave sleep 2 (mouse)			Not determined		12	94146064	120092757	Mouse
1301926	Adip6_m	adiposity 6 (mouse)			Not determined		12	73887422	107887526	Mouse
10412075	Nils1_m	neointima lesion size 1 (mouse)			Not determined		12	102024665	120092757	Mouse
27226793	Feml10_m	femur length 10, 5 week (mouse)					12	68346774	113363620	Mouse
4142401	Egq10_m	early growth QTL 10 (mouse)			Not determined			80956708	113383533	Mouse
10412192	Bbaa27_m	B.burgdorferi-associated arthritis 27 (mouse)			Not determined		12	91254220	107308393	Mouse
1300973	Abmm_m	antibody mediated myocarditis (mouse)			Not determined		12	93264461	120092757	Mouse
13524849	Ppiq11a_m	prepulse inhibition QTL 11a (mouse)					12	80989143	114989143	Mouse

UniSTS:236940

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	12	105,689,826 - 105,689,954	UniSTS	GRCm38
MGSCv37	12	106,928,036 - 106,928,164	UniSTS	GRCm37
Celera	12	106,924,348 - 106,924,476	UniSTS
Cytogenetic Map	12	E	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_178613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC158526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK017049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK020785	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK029484	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK030204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK042664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK079775	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK167871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK171097	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC031494	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000051934 ⟹ ENSMUSP00000057939

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	12	105,651,643 - 105,669,282 (+)	Ensembl
GRCm38.p6 Ensembl	12	105,685,384 - 105,703,023 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000222284 ⟹ ENSMUSP00000152722

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	12	105,651,088 - 105,665,410 (+)	Ensembl
GRCm38.p6 Ensembl	12	105,684,829 - 105,699,151 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000222841

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	12	105,651,660 - 105,656,479 (+)	Ensembl
GRCm38.p6 Ensembl	12	105,685,401 - 105,690,220 (+)	Ensembl

RefSeq Acc Id:

NM_178613 ⟹ NP_848728

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	12	105,651,611 - 105,669,317 (+)	NCBI
GRCm38	12	105,685,352 - 105,703,058 (+)	ENTREZGENE
MGSCv37	12	106,923,562 - 106,941,268 (+)	RGD
Celera	12	106,919,875 - 106,937,566 (+)	RGD
cM Map	12		ENTREZGENE

Sequence:

show sequence

GGTGGTGAATGGGCGGGGCAACTGCGGGGGCGGGGGTGGTGCCGGCGCCGCGATCCTGGCCCCAGCAGTCTCCGGACGAGGAAGGATAAGAACATGGGCGCTCGCAGAATGGAAACAGACTATAATCC
CGTGGAGCTAAGCAGTATGTCTGGATTTGAAGAAGGCTCCGAGCTCAATGGGTTTGAAGGAGCGGATATGAAGGACATGCAGCTGGAGGCCGAGGCAGTTGTAAACGATGTACTCTTTGCTGTCAACC
ACATGTTTGTCTCAAAAAGCATGCCCTGTGCAGATGATGTGGCTTACATCAATGTGGAGACAAAGGAAAGGAACAGATACTGCCTGGAGCTCACAGAAGCAGGGCTCAGGGTGGTGGGCTATGCTTTT
GACCAGGTGGAGGATCATTTGCAAACCCCCTACCATGAGACAGTCTACTCCTTGTTGGATACTCTCAGCCCTGCCTACCGGGAAGCATTCGGAAACGCGCTCCTTCAGAGACTGGAAGCTTTGAAACG
AGATGGACAGTCATGACTCATGACTCATCTTCCTCCTAATGGGGCCGCTGCTGGTATAGAATCTAACATAAGGCTTGACACCCTTGCGTACAGTCACTGTAGAAAGCGCATCATTCATTGGCTTTGTG
TGTTCGCCATTCCTTCACACGCAGGCTTTTGACTCCCAGCGTAATTGAGTTGTCTTAGTTTCAGCTTCATGGAAGGGGATTTAATTTTGAGACCATTGCTCTGACACTCCCATTCTGAGTTTCACACC
CAGCACTCTGCATTTCAATCCCTAGTCAGCTCTTCATTCTCCTGTTACAGGGCTTCAATGCTGCCAGCACTCTTTTACATAGAAAATTCTAGATTTGCACAGTGATACAGAAATTAGAATCACCTAAC
TTCAGACCTGGATTCAGCCTGCTAAATCAGGGGTTTACTACTAGCTTGGAGTAACTTTGTAGTGGTTATTTTGTACCTGGCCTTATTGGAAACAAACTGTCAACTAGTTTCCCCTGCACAAATTCTGA
AATGTACTGCTCTGCTTAATCTAGTCACATGACCAAGTGGGCTGGTGAAGATGGGTTGCTCATCTGTTTCTTAACTAAGATAAAATGGAAGGCAGGGACAGAAATCGTTCTCCATTCCTTGTTTGCAA
CAGCCAGCCAGCCTAGAGCGGACAGACCATTCGCAAATGAATGTAACAATTACTCATCTCCATGATGTCTAAGCACATGAGCAAATAGAGGAACAGGCCCACCTCATCCTCCAGTGTGGATCTCTTCA
AAGGAAGAAGATCCTGGTTTCCTAGGAAACGGTATTTTGGCCTGTGTTGATTCTTACTCTGAATGTTTGTTTACAATGTACAGTATATATATATATATATGCACATATATATTCAGAACGTATTTTTG
CTTCAATGCTTACTTTCTATAAAGCAGTGCTTTGGTATTCCTACAGCGCCCTTCTTCCCCAGCAGTTGGACAGTGCTCTGTCTCATTGCCACATGAACAGTGTAACATGAGTGCATTGTATGGTTCGA
AACCAAAGGATGAATGAAGCATTCAGAAACTTGATATTTAAAAAAGAGATGCTCTGTATTTTATATTTTATTACAGTCCCCGGTGTTTATAAACGTAATAAAGTCCTCCGTGCTGCTGCATGTTTTCC
AGTATGTGACAAACAGAAAGGACCTGGCTCTGTTCTAGTTGTCACCCAGAGCTGCCTCAGCTGCCACCGTCTGCATCTGGGCACACCTTCATACACTGGTCATCAGCAGATGTTTTTGTCGTTAGTTT
GCAAAGGGCATTTTTAGCCTCTGAAGACCATGGGAGGAAAGGTGAAGGGTAGAGCCCTTGCCTGTCGTGGGTAAGCACCCAGCCCTGTCCTGAGGATCTAAACAGTCTTAAAATGCTTCTGGGGACCA
GGCTTGGTAGAGTTCCCTCTGCATTGCCAATGCCACCGAGAGTTCACTGGGTGTTTGACCCTGGCTTTACAAGACTCTTTTTCTGGTGTGATGTCTGGTTGCCTGCAGTGTGCACAGTGAAGCCCAGC
CTCAGGCTCTCTTTCTGGTGTGATGTCTGGTGTGATGCCTGCAGTGTGCACAGTGAAGCCCAGCCTCAGGCTCTCTTTCTGGTGTGATTTCTGGTTGCCTGCAGTATGCACAGTGAAGTCCGGCCTCA
GGCTCTCTTTCTGGTGTGATGTCTGGTTGCCTGCGGTGTGCACAGTGAAGTCCGGCCTCAGGCTCTCTTTCTGGTGTGATTTCTGGTTGCCTGCAGTGTGCACAGTGAAGTCCGGCCTCAGGCTCTCT
TTCTGGTGTGATGTCTGGTTGCCTGCGGTGTGCACAGTGAAGCCCGGCCTCAGGCTCTCTTTCTGGTGTGATGTCTGGTGTGATGCCTGCAGTGTGCACAGTGAAGCCCTGCCTCAGGCTCTCTTTCT
GGTGTGATGTCTGGTTGCCTGCAGTGTGCACAGTGAAGCCCAGCCTCAGGCTCTCTTTCTGGTGTGATGTCTGGTGTGATGCCTGCAGTGTGCACAGTGAAGCCCAGCCTCAGGCTCTCTTTCTGGTG
TGATTTCTGGTTGCCTGTGGGGTGCACAGAGAAGCCCGGCCTCAGGCTCTCTTTCTGGTGTGATGTCTGGTTGCCTGCAGTGTGCACAGTGAAGCCCGGCCTCAGGTTGAACTTTCTTGTGCTTAATC
TCAGGCTAACATTTTAAAAAATGATGTTTGTAGAGTTTAAATAAAATTATTTACTTGATTTTGAGTTGAGCATAAAGCAGTCATGCTTAAAAACTGAAA

hide sequence


Protein RefSeqs	NP_848728	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH31494	(Get FASTA)	NCBI Sequence Viewer
	BAC26470	(Get FASTA)	NCBI Sequence Viewer
	BAC26840	(Get FASTA)	NCBI Sequence Viewer
	BAC31325	(Get FASTA)	NCBI Sequence Viewer
	BAC37748	(Get FASTA)	NCBI Sequence Viewer
	BAE40767	(Get FASTA)	NCBI Sequence Viewer
	BAE42246	(Get FASTA)	NCBI Sequence Viewer
	EDL18752	(Get FASTA)	NCBI Sequence Viewer
	EDL18753	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000057939
	ENSMUSP00000057939.6
GenBank Protein	Q8BGR8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_848728 ⟸ NM_178613
- UniProtKB:	Q8K2G9 (UniProtKB/Swiss-Prot), Q8CDW3 (UniProtKB/Swiss-Prot), Q8BGR8 (UniProtKB/Swiss-Prot), Q3TBR1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGARRMETDYNPVELSSMSGFEEGSELNGFEGADMKDMQLEAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHLQTPYHETVYSLLDTLSPAYREAFG NALLQRLEALKRDGQS hide sequence

Ensembl Acc Id:

ENSMUSP00000057939 ⟸ ENSMUST00000051934

Ensembl Acc Id:

ENSMUSP00000152722 ⟸ ENSMUST00000222284

Protein Domains

GSKIP

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8BGR8-F1-model_v2	AlphaFold	Q8BGR8	1-139	view protein structure

RGD ID:

8679174

Promoter ID:

EPDNEW_M17617

Type:

multiple initiation site

Name:

Gskip_1

Description:

Mus musculus GSK3B interacting protein , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	12	105,685,418 - 105,685,478	EPDNEW

RGD ID:

6822585

Promoter ID:

MM_KWN:12641

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

NM_029654, NM_178613, UC007OYQ.1, UC007OYR.1

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	12	106,922,261 - 106,923,687 (+)	MPROMDB

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000044715	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000051934	ENTREZGENE
	ENSMUST00000051934.7	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.2280.10	UniProtKB/Swiss-Prot
InterPro	GSKIP	UniProtKB/Swiss-Prot
	GSKIP_dom	UniProtKB/Swiss-Prot
	GSKIP_dom_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:66787	UniProtKB/Swiss-Prot
MGD	MGI:1914037	ENTREZGENE
NCBI Gene	66787	ENTREZGENE
PANTHER	GSK3B-INTERACTING PROTEIN	UniProtKB/Swiss-Prot
	PTHR12490	UniProtKB/Swiss-Prot
Pfam	DUF727	UniProtKB/Swiss-Prot
PhenoGen	Gskip	PhenoGen
Superfamily-SCOP	SSF103107	UniProtKB/Swiss-Prot
UniProt	A0A1Y7VNZ5_MOUSE	UniProtKB/TrEMBL
	GSKIP_MOUSE	UniProtKB/Swiss-Prot
	Q3TBR1	ENTREZGENE, UniProtKB/TrEMBL
	Q8BGR8	ENTREZGENE
	Q8CDD7_MOUSE	UniProtKB/TrEMBL
	Q8CDW3	ENTREZGENE
	Q8K2G9	ENTREZGENE
UniProt Secondary	Q8CDW3	UniProtKB/Swiss-Prot
	Q8K2G9	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-11-27	Gskip	GSK3B interacting protein	4933433P14Rik	RIKEN cDNA 4933433P14 gene	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Mammalian Phenotype