Gskip (GSK3B interacting protein)

Advanced Search (OLGA)

Gene: Gskip (GSK3B interacting protein) Rattus norvegicus

Analyze

Symbol:

Gskip

Name:

GSK3B interacting protein

RGD ID:

1308470

Description:

Predicted to enable protein kinase A regulatory subunit binding activity; protein kinase binding activity; and protein kinase inhibitor activity. Predicted to be involved in intrinsic apoptotic signaling pathway in response to oxidative stress; negative regulation of protein kinase activity; and positive regulation of canonical Wnt signaling pathway. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Orthologous to human GSKIP (GSK3B interacting protein); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; fipronil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GSK3-beta interaction protein; LOC362778; RGD1308470; similar to RIKEN cDNA 4933433P14 gene

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GSKIP (GSK3B interacting protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GSKIP (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gskip (GSK3B interacting protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	SPNS1 (SPNS lysolipid transporter 1, lysophospholipid)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	GSKIP (GSK3B interacting protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gskip (GSK3B interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gskip (gsk3b interacting protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11523	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	C06A12.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T24H7.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	Y43F8B.2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG14505	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gskip	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	130,357,241 - 130,373,221 (+)	NCBI		GRCr8
mRatBN7.2	6	124,586,087 - 124,609,106 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	124,586,070 - 124,609,100 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	124,713,904 - 124,729,726 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	125,009,170 - 125,024,993 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	124,370,337 - 124,386,317 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	129,512,950 - 129,536,320 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	129,519,709 - 129,536,221 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	138,706,202 - 138,729,236 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	129,842,160 - 129,858,112 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	129,845,906 - 129,861,859 (+)	NCBI
Celera	6	122,159,593 - 122,175,547 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute myeloid leukemia (ISO)

essential thrombocythemia (ISO)

myelofibrosis (ISO)

myeloid leukemia (ISO)

myeloid neoplasm (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

clothianidin (ISO)

copper(II) sulfate (ISO)

DDE (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

ethanol (ISO)

fipronil (EXP)

furan (EXP)

gentamycin (EXP)

manganese(II) chloride (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

trichostatin A (ISO)

triphenyl phosphate (EXP)

urethane (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intrinsic apoptotic signaling pathway in response to oxidative stress (IEA,ISO,ISS)

negative regulation of protein kinase activity (ISO,ISS)

positive regulation of canonical Wnt signaling pathway (IEA,ISO,ISS)

regulation of canonical Wnt signaling pathway (IEA)

regulation of Wnt signaling pathway (IBA,ISO,ISS)

Cellular Component

cytoplasm (IBA,IEA,ISO,ISS)

nucleus (IEA,ISO,ISS)

Molecular Function

beta-catenin binding (ISO)

kinase regulator activity (IBA)

protein binding (IPI,ISO)

protein kinase A binding (IBA,ISO)

protein kinase A regulatory subunit binding (IEA,ISO)

protein kinase binding (IEA,ISO)

protein kinase inhibitor activity (IEA,ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Glycogen synthase kinase 3beta interaction protein functions as an A-kinase anchoring protein.	Hundsrucker C, etal., J Biol Chem. 2010 Feb 19;285(8):5507-21. doi: 10.1074/jbc.M109.047944. Epub 2009 Dec 11.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8889548	PMID:16981698	PMID:19830702	PMID:25920809	PMID:27484798

Genomics

Comparative Map Data

Gskip
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	130,357,241 - 130,373,221 (+)	NCBI		GRCr8
mRatBN7.2	6	124,586,087 - 124,609,106 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	124,586,070 - 124,609,100 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	124,713,904 - 124,729,726 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	125,009,170 - 125,024,993 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	124,370,337 - 124,386,317 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	129,512,950 - 129,536,320 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	129,519,709 - 129,536,221 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	138,706,202 - 138,729,236 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	129,842,160 - 129,858,112 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	129,845,906 - 129,861,859 (+)	NCBI
Celera	6	122,159,593 - 122,175,547 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

GSKIP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	96,363,526 - 96,387,290 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	96,363,452 - 96,387,288 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	96,829,863 - 96,853,627 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	95,915,775 - 95,923,321 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	95,899,622 - 95,922,362	NCBI
Celera	14	76,901,748 - 76,909,294 (+)	NCBI		Celera
Cytogenetic Map	14	q32.2	NCBI
HuRef	14	77,014,876 - 77,038,713 (+)	NCBI		HuRef
CHM1_1	14	96,768,634 - 96,792,467 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	90,595,122 - 90,618,884 (+)	NCBI		T2T-CHM13v2.0

Gskip
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	105,651,611 - 105,669,317 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	105,651,088 - 105,669,282 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	105,685,352 - 105,703,058 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	105,684,829 - 105,703,023 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	106,923,562 - 106,941,268 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	106,086,491 - 106,104,097 (+)	NCBI		MGSCv36	mm8
Celera	12	106,919,875 - 106,937,566 (+)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	55.92	NCBI

Gskip
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	18,153,564 - 18,177,899 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	18,153,564 - 18,174,980 (+)	NCBI	ChiLan1.0	ChiLan1.0

GSKIP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	97,523,394 - 97,547,474 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	96,739,898 - 96,763,980 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	76,993,055 - 77,017,142 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	96,331,789 - 96,339,378 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	96,329,936 - 96,339,378 (+)	Ensembl	panpan1.1		panPan2

GSKIP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	65,110,659 - 65,131,205 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	65,111,414 - 65,129,622 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	64,626,310 - 64,647,821 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	65,382,175 - 65,403,816 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	65,383,060 - 65,450,126 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	65,054,862 - 65,076,654 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	65,116,291 - 65,137,874 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	65,439,899 - 65,461,533 (+)	NCBI		UU_Cfam_GSD_1.0

Gskip
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	9,406,837 - 9,424,882 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936604	657,400 - 675,923 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936604	657,602 - 675,702 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GSKIP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	117,586,764 - 117,607,564 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	117,586,742 - 117,607,575 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	124,844,708 - 124,865,661 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GSKIP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	74,246,221 - 74,270,608 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	74,246,255 - 74,271,765 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	61,397,502 - 61,422,002 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gskip
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	7,002,240 - 7,015,194 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	7,003,240 - 7,015,215 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gskip
133 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	142
Count of miRNA genes:	96
Interacting mature miRNAs:	122
Transcripts:	ENSRNOT00000006307
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

Markers in Region

RH133907

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	124,608,157 - 124,608,348 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	129,535,331 - 129,535,521	NCBI	Rnor6.0
Rnor_5.0	6	138,728,282 - 138,728,472	UniSTS	Rnor5.0
RGSC_v3.4	6	129,857,755 - 129,857,945	UniSTS	RGSC3.4
Celera	6	122,175,186 - 122,175,376	UniSTS
RH 3.4 Map	6	817.4	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001014198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA819750	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC125847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC087681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM111441	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006307 ⟹ ENSRNOP00000006307

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	124,592,537 - 124,609,100 (+)	Ensembl
Rnor_6.0 Ensembl	6	129,519,709 - 129,536,221 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096229 ⟹ ENSRNOP00000094110

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	124,586,070 - 124,606,091 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098162 ⟹ ENSRNOP00000085422

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	124,605,339 - 124,609,100 (+)	Ensembl

RefSeq Acc Id:

NM_001014198 ⟹ NP_001014220

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	130,357,241 - 130,373,221 (+)	NCBI
mRatBN7.2	6	124,592,538 - 124,608,519 (+)	NCBI
Rnor_6.0	6	129,519,713 - 129,535,692 (+)	NCBI
Rnor_5.0	6	138,706,202 - 138,729,236 (+)	NCBI
RGSC_v3.4	6	129,842,160 - 129,858,112 (+)	RGD
Celera	6	122,159,593 - 122,175,547 (+)	NCBI

Sequence:

show sequence

GGGGGCGGGGGTGGTGCCGGCACCGCAAGTCTGGCTCCAGACGCCTCGGGACGAGGAAGAAGAG
GAACATGGGAGCTCGCAGAATGGAAACAGACTGTAATCCCGTGGATCTAAGCAGTATGTCTGGA
TTCGAAGAAGGCTCCGAGCTCAACGGGTTTGAAGGAACAGATATGAAGGACATGCAGCTGGAGG
CTGAGGCCGTTGTCAATGACGTTCTCTTTGCTGTCAACAACATGTTTGTCTCAAAAAGCCTGCC
CTGTGCAGACGATGTGGCTTACATCAATGTGGAGACAAAGGAAAGAAACAGATACTGCCTGGAG
CTCACAGAAGCAGGGCTCAGGGTGGTGGGCTATGCTTTTGACCAGGTGGAGGACCATTTGCAAA
CCCCCTACCATGAGACAGTCTACTCCCTGTTGGATACGCTCAGCCCTGCCTACCGGGAAGCATT
TGGAAATGCTCTCCTTCAGAGACTGGAAGCTTTGAAACGAGATGGACAGTCCTGACTCAGTCTC
CTGAGGGGCTGCTGCTGGTGTAGAGTCTCACGTAAGACTTGACGCCCTGCATATCATCACTGTG
GAAAGTGCATCGCTGGCTTATGTGCTCACCATGCCTTCCATGTAGGCTTTTGACTCAGCATAAT
TGACTCATAAACTGTCTTAGTTTCAGATTCGTTTAAGGGGACTGTGAGCCCATTGCTCTGACAC
TGTCCTTCTGAGTTTTACAGACACAGTCACTCTGCATCTCCATACCTAATCAGTACTCCATTCT
CTTATGACAGGGCTTCAACGCTGCCAGCACTCTTCTTTACATAGAAAATTCTAGATTTGCACAG
TGATATAGAAATTAGAATCGCCTAACTTGAGACCTGGATTCAGCCTGCTAAATCAGGGGTTTAC
TACTAGCTTGGACTAATGTTGTAGTGGTTATTTTGTTACTGGCCTTATTGGAAACAAACCGTCG
ACTGCACAAATTTTGAGATTTACTGCTCTACTCAATCTACTTACCAAACAGACTGATGAAGACA
AACTGCTTATCTGTTACGTAACTAGGATAAAATGAAAGGCAGGGCAGAAATAATTCTCTATTCC
TTGTTTGCAACAGCCAGCCAACCTAGATGGACAGACCATTAGCAAATGAATGTATCAGTTACTC
ATCTCCACGCTATCTAAGCACATGAGCAAATAGAGGACCAGGCCCCACCTCAGCCTCCGCTGTG
GACAAGGAAGAGGATCCTGGTTTCCCCGGAAACCGTATCTTGGCCTGTGTTGGTTCTTACTCCG
AACGTTTGTTTACAATGTACAGTATATATATGCACATATATATTCAGAAAGTATTTTTGCTTCA
ATGCTTCCCTTTCTATAAAGCCGTGCTTTGGTATTCCTACAGCACCCTTCCTCCCCAGCAGTTG
GGCAGAGCACTGTCCCATTGCCACATGAACAGTGTATCATGAGTGCATTGTATGGTTTGAAACC
AAAGGACGAATGAAGCATTCAGAAACTTGATATTTAAAAAAAGAGATGCTCTGTATTTTATATT
TTATTACAGTTCCTGGTGTTTATAAACTTAATAAAAGTCCTCCATGCTGCTGCATGTTTTCCAG
TATGTGACAAACAGAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001014220	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87681	(Get FASTA)	NCBI Sequence Viewer
	EDL97598	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006307.5
	ENSRNOP00000085422.1
	ENSRNOP00000094110.1
GenBank Protein	Q5PPI3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001014220 ⟸ NM_001014198
- UniProtKB:	Q5PPI3 (UniProtKB/Swiss-Prot), A0A0H2UHD3 (UniProtKB/TrEMBL), A6KBD3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGARRMETDCNPVDLSSMSGFEEGSELNGFEGTDMKDMQLEAEAVVNDVLFAVNNMFVSKSLPC ADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVEDHLQTPYHETVYSLLDTLSPAYREAFG NALLQRLEALKRDGQS hide sequence

Ensembl Acc Id:

ENSRNOP00000006307 ⟸ ENSRNOT00000006307

Ensembl Acc Id:

ENSRNOP00000085422 ⟸ ENSRNOT00000098162

Ensembl Acc Id:

ENSRNOP00000094110 ⟸ ENSRNOT00000096229

Protein Domains

GSKIP

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5PPI3-F1-model_v2	AlphaFold	Q5PPI3	1-139	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694813

Promoter ID:

EPDNEW_R5338

Type:

multiple initiation site

Name:

Gskip_1

Description:

GSK3B interacting protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	129,519,751 - 129,519,811	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1308470	AgrOrtholog
BioCyc Gene	G2FUF-36330	BioCyc
Ensembl Genes	ENSRNOG00000042427	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000006307.8	UniProtKB/TrEMBL
	ENSRNOT00000096229.1	UniProtKB/TrEMBL
	ENSRNOT00000098162.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.2280.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7321205	IMAGE-MGC_LOAD
InterPro	GSKIP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GSKIP_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GSKIP_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:362778	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105785	IMAGE-MGC_LOAD
NCBI Gene	362778	ENTREZGENE
PANTHER	GSK3B-INTERACTING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12490	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DUF727	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gskip	PhenoGen
RatGTEx	ENSRNOG00000042427	RatGTEx
Superfamily-SCOP	SSF103107	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHD3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZZ66_RAT	UniProtKB/TrEMBL
	A0A8I6AKW9_RAT	UniProtKB/TrEMBL
	A6KBD3	ENTREZGENE, UniProtKB/TrEMBL
	GSKIP_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-10	Gskip	GSK3B interacting protein	RGD1308470	similar to RIKEN cDNA 4933433P14 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1308470	similar to RIKEN cDNA 4933433P14 gene	RGD1308470_predicted	similar to RIKEN cDNA 4933433P14 gene (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1308470_predicted	similar to RIKEN cDNA 4933433P14 gene (predicted)	LOC362778_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362778_predicted	similar to RIKEN cDNA 4933433P14 gene (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD