Symbol:
Fmn2
Name:
formin 2
RGD ID:
1316778
MGI Page
MGI
Description:
Predicted to enable actin binding activity. Involved in several processes, including cytoskeleton organization; meiotic nuclear division; and oogenesis. Acts upstream of or within actin filament bundle assembly and meiotic chromosome movement towards spindle pole. Located in several cellular components, including endoplasmic reticulum membrane; microvillus; and spindle. Is expressed in several structures, including brain; ganglia; neural ectoderm; otocyst; and testis. Human ortholog(s) of this gene implicated in autosomal recessive intellectual developmental disorder 47. Orthologous to human FMN2 (formin 2).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AU024104; formin-2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FMN2 (formin 2) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Fmn2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fmn2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FMN2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FMN2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fmn2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FMN2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FMN2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fmn2 (formin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
FMN2 (formin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Fmn2 (formin 2)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fmn2b (formin 2b)
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
fmn2a (formin 2a)
Alliance
DIOPT (Hieranoid|OrthoFinder|ZFIN)
Drosophila melanogaster (fruit fly):
capu
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fmn2
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 174,324,079 - 174,650,295 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 174,329,391 - 174,650,295 (+) Ensembl GRCm39 Ensembl GRCm38 1 174,501,752 - 174,822,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 174,501,825 - 174,822,729 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 176,431,956 - 176,752,860 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 176,325,847 - 176,658,752 (+) NCBI MGSCv36 mm8 Celera 1 181,581,367 - 181,911,120 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 81.04 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Fmn2 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FMN2 mRNA CTD PMID:17942748 Fmn2 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of FMN2 mRNA CTD PMID:39298647 Fmn2 Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO FMN2 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Fmn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FMN2 mRNA CTD PMID:17942748 Fmn2 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FMN2 mRNA CTD PMID:21570461 more ... Fmn2 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO FMN2 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Fmn2 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of FMN2 mRNA CTD PMID:39298647 Fmn2 Mouse 5-aza-2'-deoxycytidine multiple interactions ISO FMN2 (Homo sapiens) 6480464 Decitabine inhibits the reaction [Smoke results in decreased expression of FMN2 mRNA] CTD PMID:21095227 Fmn2 Mouse aflatoxin B1 decreases methylation ISO FMN2 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of FMN2 exon and Aflatoxin B1 results in decreased methylation of FMN2 gene CTD PMID:27153756 and PMID:30157460 Fmn2 Mouse all-trans-retinoic acid increases expression ISO FMN2 (Homo sapiens) 6480464 Tretinoin results in increased expression of FMN2 mRNA CTD PMID:23724009 Fmn2 Mouse arsane affects methylation ISO FMN2 (Homo sapiens) 6480464 Arsenic affects the methylation of FMN2 gene CTD PMID:25304211 Fmn2 Mouse arsenic atom affects methylation ISO FMN2 (Homo sapiens) 6480464 Arsenic affects the methylation of FMN2 gene CTD PMID:25304211 Fmn2 Mouse arsenite(3-) multiple interactions ISO FMN2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to FMN2 mRNA] CTD PMID:32406909 Fmn2 Mouse arsenous acid increases expression ISO FMN2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FMN2 mRNA CTD PMID:20458559 Fmn2 Mouse benzo[a]pyrene increases methylation ISO FMN2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of FMN2 5' UTR and Benzo(a)pyrene results in increased methylation of FMN2 exon CTD PMID:27901495 Fmn2 Mouse benzo[a]pyrene affects methylation ISO FMN2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of FMN2 exon more ... CTD PMID:27901495 and PMID:30157460 Fmn2 Mouse benzo[b]fluoranthene increases expression EXP 6480464 benzo(b)fluoranthene results in increased expression of FMN2 mRNA CTD PMID:26377693 Fmn2 Mouse benzo[e]pyrene decreases methylation ISO FMN2 (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of FMN2 intron CTD PMID:30157460 Fmn2 Mouse bis(2-ethylhexyl) phthalate decreases expression ISO FMN2 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of FMN2 mRNA CTD PMID:31163220 Fmn2 Mouse bisphenol A decreases expression ISO Fmn2 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of FMN2 mRNA CTD PMID:25181051 Fmn2 Mouse bisphenol A affects methylation ISO FMN2 (Homo sapiens) 6480464 bisphenol A affects the methylation of FMN2 gene CTD PMID:31601247 Fmn2 Mouse bisphenol A multiple interactions ISO FMN2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of FMN2 gene CTD PMID:31601247 Fmn2 Mouse butanal decreases expression ISO FMN2 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of FMN2 mRNA CTD PMID:26079696 Fmn2 Mouse cadmium sulfate multiple interactions EXP 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of FMN2 mRNA] CTD PMID:16221973 Fmn2 Mouse CGP 52608 multiple interactions ISO FMN2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to FMN2 gene] CTD PMID:28238834 Fmn2 Mouse chlordecone affects response to substance ISO FMN2 (Homo sapiens) 6480464 FMN2 gene SNP affects the susceptibility to Chlordecone CTD PMID:25622337 Fmn2 Mouse chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of FMN2 mRNA CTD PMID:37019170 Fmn2 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FMN2 gene CTD PMID:20938992 Fmn2 Mouse cisplatin decreases expression ISO FMN2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of FMN2 mRNA CTD PMID:27392435 Fmn2 Mouse cisplatin multiple interactions ISO FMN2 (Homo sapiens) 6480464 Cisplatin promotes the reaction [jinfukang results in decreased expression of FMN2 mRNA] and jinfukang promotes the reaction [Cisplatin results in decreased expression of FMN2 mRNA] CTD PMID:27392435 Fmn2 Mouse copper(II) chloride increases expression ISO FMN2 (Homo sapiens) 6480464 cupric chloride results in increased expression of FMN2 mRNA CTD PMID:38568856 Fmn2 Mouse cyclosporin A decreases expression ISO FMN2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of FMN2 mRNA CTD PMID:20106945 Fmn2 Mouse daidzein multiple interactions ISO FMN2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in increased expression of FMN2 mRNA CTD PMID:16963248 Fmn2 Mouse diarsenic trioxide increases expression ISO FMN2 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of FMN2 mRNA CTD PMID:20458559 Fmn2 Mouse dichloroacetic acid decreases expression EXP 6480464 Dichloroacetic Acid results in decreased expression of FMN2 mRNA CTD PMID:28962523 Fmn2 Mouse disodium selenite increases expression ISO FMN2 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of FMN2 mRNA CTD PMID:24383545 Fmn2 Mouse dorsomorphin multiple interactions ISO FMN2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fmn2 Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of FMN2 mRNA CTD PMID:19167417 Fmn2 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of FMN2 mRNA CTD PMID:30319688 Fmn2 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of FMN2 mRNA CTD PMID:30319688 Fmn2 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FMN2 gene CTD PMID:20938992 Fmn2 Mouse folic acid increases expression EXP 6480464 Folic Acid results in increased expression of FMN2 mRNA CTD PMID:25629700 Fmn2 Mouse FR900359 increases phosphorylation ISO FMN2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of FMN2 protein CTD PMID:37730182 Fmn2 Mouse fulvestrant multiple interactions ISO FMN2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of FMN2 gene CTD PMID:31601247 Fmn2 Mouse genistein multiple interactions ISO FMN2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in increased expression of FMN2 mRNA CTD PMID:16963248 Fmn2 Mouse glycitein multiple interactions ISO FMN2 (Homo sapiens) 6480464 [Genistein co-treated with daidzein co-treated with glycitein] results in increased expression of FMN2 mRNA CTD PMID:16963248 Fmn2 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of FMN2 mRNA CTD PMID:36331819 Fmn2 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of FMN2 gene CTD PMID:20938992 Fmn2 Mouse lithium chloride decreases expression ISO FMN2 (Homo sapiens) 6480464 Lithium Chloride results in decreased expression of FMN2 mRNA CTD PMID:23527032 Fmn2 Mouse melphalan decreases expression ISO FMN2 (Homo sapiens) 6480464 Melphalan results in decreased expression of FMN2 mRNA CTD PMID:22363485 Fmn2 Mouse methapyrilene decreases methylation ISO FMN2 (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of FMN2 intron CTD PMID:30157460 Fmn2 Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of FMN2 mRNA CTD PMID:27776689 Fmn2 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of FMN2 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of FMN2 mRNA CTD PMID:36331819 Fmn2 Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of FMN2 mRNA CTD PMID:23091169 Fmn2 Mouse potassium chromate increases expression ISO FMN2 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of FMN2 mRNA CTD PMID:22714537 Fmn2 Mouse rotenone decreases expression ISO FMN2 (Homo sapiens) 6480464 Rotenone results in decreased expression of FMN2 mRNA CTD PMID:29955902 Fmn2 Mouse SB 431542 multiple interactions ISO FMN2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Fmn2 Mouse silicon dioxide increases expression ISO FMN2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of FMN2 mRNA CTD PMID:25895662 Fmn2 Mouse silicon dioxide decreases expression ISO FMN2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of FMN2 mRNA CTD PMID:23806026 Fmn2 Mouse sodium arsenite increases expression ISO FMN2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of FMN2 mRNA CTD PMID:38568856 Fmn2 Mouse sodium arsenite decreases expression ISO FMN2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of FMN2 mRNA CTD PMID:34032870 Fmn2 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of FMN2 gene CTD PMID:35295148 Fmn2 Mouse toxaphene affects response to substance ISO FMN2 (Homo sapiens) 6480464 FMN2 gene SNP affects the susceptibility to Toxaphene CTD PMID:25622337 Fmn2 Mouse trichostatin A increases expression ISO FMN2 (Homo sapiens) 6480464 trichostatin A results in increased expression of FMN2 mRNA CTD PMID:24935251 Fmn2 Mouse trichostatin A multiple interactions ISO FMN2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FMN2 mRNA CTD PMID:27188386 Fmn2 Mouse trichostatin A decreases expression ISO FMN2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of FMN2 mRNA CTD PMID:24935251 and PMID:26272509 Fmn2 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of FMN2 mRNA CTD PMID:17963808 Fmn2 Mouse valproic acid affects expression ISO FMN2 (Homo sapiens) 6480464 Valproic Acid affects the expression of FMN2 mRNA CTD PMID:25979313 Fmn2 Mouse valproic acid increases expression ISO FMN2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of FMN2 mRNA CTD PMID:24935251 and PMID:28001369 Fmn2 Mouse vorinostat multiple interactions ISO FMN2 (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of FMN2 mRNA CTD PMID:27188386 Fmn2 Mouse vorinostat decreases expression ISO FMN2 (Homo sapiens) 6480464 vorinostat results in decreased expression of FMN2 mRNA CTD PMID:26272509
17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 4,4'-sulfonyldiphenol (EXP) 5-aza-2'-deoxycytidine (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (EXP) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) butanal (ISO) cadmium sulfate (EXP) CGP 52608 (ISO) chlordecone (ISO) chlorpyrifos (EXP) choline (EXP) cisplatin (ISO) copper(II) chloride (ISO) cyclosporin A (ISO) daidzein (ISO) diarsenic trioxide (ISO) dichloroacetic acid (EXP) disodium selenite (ISO) dorsomorphin (ISO) ethanol (EXP) folic acid (EXP) FR900359 (ISO) fulvestrant (ISO) genistein (ISO) glycitein (ISO) inulin (EXP) L-methionine (EXP) lithium chloride (ISO) melphalan (ISO) methapyrilene (ISO) N-ethyl-N-nitrosourea (EXP) perfluorooctane-1-sulfonic acid (EXP) phenobarbital (EXP) potassium chromate (ISO) rotenone (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) titanium dioxide (EXP) toxaphene (ISO) trichostatin A (ISO) valproic acid (EXP,ISO) vorinostat (ISO)
Biological Process
actin cytoskeleton organization (IBA,ISO) actin filament bundle assembly (IMP) actin nucleation (IEA) cell migration (IEA,ISO) cellular response to hypoxia (ISO,ISS) DNA damage response (ISO,ISS) establishment of meiotic spindle localization (IMP) formin-nucleated actin cable assembly (IBA,IMP,ISO,ISS) homologous chromosome movement towards spindle pole in meiosis I anaphase (IMP) intracellular transport (IMP) meiotic chromosome movement towards spindle pole (IMP) negative regulation of apoptotic process (ISO,ISS) negative regulation of protein catabolic process (ISO,ISS) oogenesis (IMP) polar body extrusion after meiotic divisions (IMP) positive regulation of double-strand break repair (ISO,ISS) protein transport (IEA) vesicle-mediated transport (IMP)
Fmn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 174,324,079 - 174,650,295 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 174,329,391 - 174,650,295 (+) Ensembl GRCm39 Ensembl GRCm38 1 174,501,752 - 174,822,729 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 174,501,825 - 174,822,729 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 176,431,956 - 176,752,860 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 176,325,847 - 176,658,752 (+) NCBI MGSCv36 mm8 Celera 1 181,581,367 - 181,911,120 (+) NCBI Celera Cytogenetic Map 1 H3 NCBI cM Map 1 81.04 NCBI
FMN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 240,091,883 - 240,475,187 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 240,014,348 - 240,475,187 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 240,255,183 - 240,638,487 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 238,321,604 - 238,705,112 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 213,510,402 - 213,893,529 (+) NCBI Celera Cytogenetic Map 1 q43 NCBI HuRef 1 210,713,436 - 211,096,763 (+) NCBI HuRef CHM1_1 1 241,528,744 - 241,910,469 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 239,505,207 - 239,886,446 (+) NCBI T2T-CHM13v2.0
Fmn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 88,986,863 - 89,303,789 (+) NCBI GRCr8 mRatBN7.2 13 86,454,256 - 86,771,437 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 86,453,926 - 86,771,411 (+) Ensembl mRatBN7.2 Ensembl Rnor_6.0 13 92,569,256 - 92,887,302 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 92,569,785 - 92,672,821 (+) NCBI Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 97,035,682 - 97,352,320 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 90,205,332 - 90,520,323 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 13 86,056,421 - 86,372,278 (+) NCBI Celera Cytogenetic Map 13 q24 NCBI
Fmn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955406 11,358,585 - 11,666,102 (-) NCBI ChiLan1.0 ChiLan1.0
FMN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 8,686,548 - 9,078,536 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 8,909,570 - 9,303,709 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 215,626,889 - 216,023,590 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 220,621,414 - 221,008,892 (+) NCBI panpan1.1 PanPan1.1 panPan2
FMN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 31,657,371 - 32,024,777 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 31,697,245 - 32,023,472 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 31,194,870 - 31,564,912 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 31,478,304 - 31,849,271 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 7 31,315,799 - 31,687,109 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 31,348,230 - 31,718,511 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 31,586,597 - 31,957,372 (+) NCBI UU_Cfam_GSD_1.0
Fmn2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 44,577,814 - 44,914,520 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936526 9,833,128 - 10,169,267 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936526 9,832,790 - 10,169,488 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FMN2 No map positions available.
FMN2
Fmn2
.
Predicted Target Of
Count of predictions: 387 Count of miRNA genes: 288 Interacting mature miRNAs: 313 Transcripts: ENSMUST00000030039 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 4141878 Qrr1_m QTL rich region on chromosome 1 (mouse) Not determined 170878743 175320066 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 1357854 Sle16_m systematic lupus erythematosus susceptibility 16 (mouse) Not determined 1 169038741 177377587 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 12790984 Pcho7_m plasma cholesterol 7 (mouse) 1 147219390 181219390 Mouse 1301016 Szs1_m seizure susceptibility 1 (mouse) Not determined 1 170878743 174456436 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 12790996 Aath2_m aortic arch atherosclerosis 2 (mouse) 1 145077630 179077630 Mouse 12791001 Aath6_m aortic arch atherosclerosis 6 (mouse) 1 147219390 181219390 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 10045887 Cplaq13_m circadian period of locomotor activity 13 (mouse) Not determined 1 172831765 181400659 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412205 Bbaa30_m B.burgdorferi-associated arthritis 30 (mouse) Not determined 1 169038741 174456436 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1300777 Chol10_m cholesterol 10 (mouse) Not determined 9 147875502 181875616 Mouse 1302098 Eila1_m ethanol induced locomotor activity 1 (mouse) Not determined 1 112008822 175468938 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300571 Opfa_m open field activity (mouse) Not determined 1 144531347 178531592 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 10043899 Hdlq99_m HDL QTL 99 (mouse) Not determined 1 147875502 181875616 Mouse 11537365 Cnes4_m C. neoformans susceptibility locus 4 (mouse) 1 144449142 178449142 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 4142149 Ctex_m Ctla4 expression QTL (mouse) Not determined 1 153557406 175468938 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse 12910521 Scgq1_m spontaneous crescentic glomerulonephritis QTL 1 (mouse) 1 156602037 176262693 Mouse 11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4142014 Wbcq5_m white blood cell quantitative locus 5 (mouse) Not determined 1 141095010 175095156 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 1301151 Hdlq14_m HDL QTL 14 (mouse) Not determined 1 142489543 176489734 Mouse 4141233 Femwf12_m femur work to failure 12 (mouse) Not determined 141233173 175233272 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301467 Pcir1_m periosteal circumference 1 (mouse) Not determined 1 141233173 175233272 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 1301191 Stia1_m serum transfer induced arthritis 1 (mouse) Not determined 1 141233173 175233272 Mouse 1300934 Cfbw1_m cystic fibrosis body weight 1 (mouse) Not determined 1 145145207 179145325 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 1558720 Bpq8_m blood pressure QTL 8 (mouse) Not determined 1 143284665 177284803 Mouse 13207571 Tcq11_m total cholesterol QTL 11 (mouse) 1 169137569 179647565 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 27095935 Ulnl5_m ulna length 5, 10 week (mouse) 1 128727737 181327565 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 27095915 Scvln13_m sacral vertebrae length 2, 16 week (mouse) 1 117527730 179827565 Mouse 11533913 Rd6m1_m retinal degeneration 6 modifier 1 (mouse) 1 141233173 175233272 Mouse 26884448 Sklq1_m skull length QTL 1, 5 week (mouse) 1 75976637 181327565 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse
G67086
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,602,815 - 174,603,333 UniSTS GRCm38 MGSCv37 1 176,532,946 - 176,533,464 UniSTS GRCm37 Celera 1 181,690,512 - 181,691,031 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 96.0 UniSTS
D1Mit150
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,628,733 - 174,628,870 UniSTS GRCm38 MGSCv37 1 176,558,864 - 176,559,001 UniSTS GRCm37 Celera 1 181,715,980 - 181,716,105 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 100.0 UniSTS Whitehead Genetic 1 99.5 UniSTS Whitehead_YAC 1 UniSTS
AU024104
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,822,567 - 174,822,647 UniSTS GRCm38 MGSCv37 1 176,752,698 - 176,752,778 UniSTS GRCm37 Celera 1 181,910,958 - 181,911,038 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 96.0 UniSTS Whitehead/MRC_RH 1 2191.93 UniSTS
Fmn2
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,821,811 - 174,822,012 UniSTS GRCm38 MGSCv37 1 176,751,942 - 176,752,143 UniSTS GRCm37 Celera 1 181,910,202 - 181,910,403 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 96.0 UniSTS
D1Sta14
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,648,173 - 174,648,252 UniSTS GRCm38 MGSCv37 1 176,578,304 - 176,578,383 UniSTS GRCm37 Celera 1 181,735,556 - 181,735,635 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 97.7 UniSTS
C85956
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 174,821,769 - 174,821,866 UniSTS GRCm38 MGSCv37 1 176,751,900 - 176,751,997 UniSTS GRCm37 Celera 1 181,910,160 - 181,910,257 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 96.0 UniSTS Whitehead/MRC_RH 1 2191.93 UniSTS
ha1938
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 8 9,371,339 - 9,372,238 UniSTS GRCm38 GRCm38 1 174,591,327 - 174,591,506 UniSTS GRCm38 MGSCv37 8 9,371,339 - 9,372,238 UniSTS GRCm37 MGSCv37 1 176,521,458 - 176,521,637 UniSTS GRCm37 Celera 8 9,543,465 - 9,544,364 UniSTS Cytogenetic Map 8 A1.1 UniSTS Cytogenetic Map 1 H3 UniSTS cM Map 1 96.0 UniSTS
Fmn2
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 1 H3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000030039 ⟹ ENSMUSP00000030039
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,329,391 - 174,650,295 (+) Ensembl GRCm38.p6 Ensembl 1 174,501,825 - 174,822,729 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000191821
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,364,611 - 174,410,118 (+) Ensembl GRCm38.p6 Ensembl 1 174,537,045 - 174,582,552 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000191971
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,440,115 - 174,527,974 (+) Ensembl GRCm38.p6 Ensembl 1 174,612,549 - 174,700,408 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000193905
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,541,892 - 174,648,837 (+) Ensembl GRCm38.p6 Ensembl 1 174,714,326 - 174,821,271 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000195300
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,437,374 - 174,443,212 (+) Ensembl GRCm38.p6 Ensembl 1 174,609,808 - 174,615,646 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000195621 ⟹ ENSMUSP00000142288
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 174,437,375 - 174,522,049 (+) Ensembl GRCm38.p6 Ensembl 1 174,609,809 - 174,694,483 (+) Ensembl
RefSeq Acc Id:
NM_019445 ⟹ NP_062318
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 174,329,391 - 174,650,295 (+) NCBI GRCm38 1 174,501,825 - 174,822,729 (+) ENTREZGENE MGSCv37 1 176,431,956 - 176,752,860 (+) RGD Celera 1 181,581,367 - 181,911,120 (+) RGD cM Map 1 ENTREZGENE
Sequence:
CAGGGCCGCAGCCACAGCCGCAGGGACGGCAGCCGGGAGAGCCACCGCGCATTATGCAAAGCGGCAGCAGATGTGAGCGGGGCCAGCTGGGCGCTCCTCGGCCTCCGCTCCCAACGGCCGGCCCAGCT
hide sequence
RefSeq Acc Id:
XM_030255545 ⟹ XP_030111405
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 174,329,318 - 174,649,962 (+) NCBI GRCm38 1 174,501,752 - 174,822,396 (+) NCBI
Sequence:
AGGCCAAGGCTGAGTCCTGTGCAGCCATTGGTGGGGAGTGCGCGCTGAACTGAGCATGTTCGCG
hide sequence
RefSeq Acc Id:
XM_036152433 ⟹ XP_036008326
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 174,324,079 - 174,460,592 (+) NCBI
Sequence:
TACATATATACAATCCCTTTTTCTTGTAGGTCTCTCCCATTTCCAGCCTCCAATGCACCCCACA
hide sequence
RefSeq Acc Id:
NP_062318 ⟸ NM_019445
- UniProtKB:
Q505D3 (UniProtKB/Swiss-Prot), Q9JL04 (UniProtKB/Swiss-Prot)
- Sequence:
MGNQDGKLKRSAGDASHEGGGAEDAAGPRDAEITKKASGSKKALGKHGKGGGGSGETSKKKSKSDSRASVFSNLRIRKNLTKGKGACDSREDVLDSQALPIGELDSAHSIVTKTPDLSLSAEETGLSD
hide sequence
RefSeq Acc Id:
XP_030111405 ⟸ XM_030255545
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSMUSP00000030039 ⟸ ENSMUST00000030039
Ensembl Acc Id:
ENSMUSP00000142288 ⟸ ENSMUST00000195621
RefSeq Acc Id:
XP_036008326 ⟸ XM_036152433
- Peptide Label:
isoform X1
RGD ID: 6875832 Promoter ID: EPDNEW_M1367 Type: initiation region Name: Fmn2_1 Description: Mus musculus formin 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1368 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 174,501,838 - 174,501,898 EPDNEW
RGD ID: 6875834 Promoter ID: EPDNEW_M1368 Type: single initiation site Name: Fmn2_2 Description: Mus musculus formin 2 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M1367 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 174,624,227 - 174,624,287 EPDNEW
RGD ID: 6817732 Promoter ID: MM_KWN:2996 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, ES_Cell Transcripts: ENSMUST00000085858, NM_019445, UC007DTC.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 176,432,031 - 176,433,582 (+) MPROMDB
