Symbol:
Lamtor3
Name:
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
RGD ID:
1316147
MGI Page
MGI
Description:
Enables kinase activator activity. Acts upstream of or within positive regulation of MAPK cascade and protein localization to cell junction. Located in late endosome. Is expressed in several structures, including central nervous system; genitourinary system; and retina. Orthologous to human LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
AW556229; late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; Map; Map2k; Map2k1ip1; Mapbp; MAPK scaffold protein 1; Mapksp1; MEK binding partner 1; MEK-binding partner 1; MGC103121; mitogen activated protein, binding protein; mitogen-activated protein kinase kinase 1 interacting protein 1; mitogen-activated protein kinase kinase 1-interacting protein 1; mitogen-activated protein kinase scaffold protein 1; Mp; Mp1; ragulator complex protein LAMTOR3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) HGNC
Ensembl, HGNC, HomoloGene, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
LAMTOR3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
lamtor3 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
lmtr-3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
CG5110
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
lamtor3-like
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm5900
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 137,624,316 - 137,634,523 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 137,624,267 - 137,634,661 (+) Ensembl GRCm39 Ensembl GRCm38 3 137,918,555 - 137,928,762 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 137,918,506 - 137,928,900 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 137,581,519 - 137,591,726 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 137,855,942 - 137,866,149 (+) NCBI MGSCv36 mm8 Celera 3 144,329,273 - 144,339,499 (+) NCBI Celera Cytogenetic Map 3 G3 NCBI cM Map 3 63.97 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Lamtor3 Mouse 1,2-dichloroethane decreases expression EXP 6480464 ethylene dichloride results in decreased expression of LAMTOR3 mRNA CTD PMID:28960355 Lamtor3 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of LAMTOR3 mRNA CTD PMID:22206623 Lamtor3 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LAMTOR3 mRNA CTD PMID:22206623 Lamtor3 Mouse 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Citalopram results in increased expression of LAMTOR3 mRNA CTD PMID:28467792 Lamtor3 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:31388691 Lamtor3 Mouse 2,6-dinitrotoluene affects expression ISO Lamtor3 (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of LAMTOR3 mRNA CTD PMID:21346803 Lamtor3 Mouse 2-hydroxypropanoic acid decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LAMTOR3 mRNA CTD PMID:30851411 Lamtor3 Mouse 2-methylcholine affects expression ISO LAMTOR3 (Homo sapiens) 6480464 beta-methylcholine affects the expression of LAMTOR3 mRNA CTD PMID:21179406 Lamtor3 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of LAMTOR3 mRNA CTD PMID:39298647 Lamtor3 Mouse 4,4'-sulfonyldiphenol increases expression ISO LAMTOR3 (Homo sapiens) 6480464 bisphenol S results in increased expression of LAMTOR3 protein CTD PMID:34186270 Lamtor3 Mouse acrylamide increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Acrylamide results in increased expression of LAMTOR3 mRNA CTD PMID:32763439 Lamtor3 Mouse all-trans-retinoic acid increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Tretinoin results in increased expression of LAMTOR3 mRNA CTD PMID:33167477 Lamtor3 Mouse amphetamine increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of LAMTOR3 mRNA CTD PMID:30779732 Lamtor3 Mouse arsane multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse arsenic atom multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of LAMTOR3 mRNA CTD PMID:22687993 Lamtor3 Mouse bisphenol A increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of LAMTOR3 mRNA CTD PMID:30816183 and PMID:32528016 Lamtor3 Mouse cadmium atom multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LAMTOR3 mRNA CTD PMID:35301059 Lamtor3 Mouse cadmium dichloride increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of LAMTOR3 mRNA CTD PMID:38568856 Lamtor3 Mouse cadmium dichloride multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of LAMTOR3 mRNA CTD PMID:35301059 Lamtor3 Mouse cisplatin multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of LAMTOR3 mRNA CTD PMID:27514524 Lamtor3 Mouse citalopram increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Citalopram results in increased expression of LAMTOR3 mRNA CTD PMID:28467792 Lamtor3 Mouse clozapine increases expression EXP 6480464 Clozapine results in increased expression of LAMTOR3 mRNA CTD PMID:14647396 Lamtor3 Mouse copper atom multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of LAMTOR3 mRNA more ... CTD PMID:20971185 more ... Lamtor3 Mouse copper(0) multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of LAMTOR3 mRNA more ... CTD PMID:20971185 more ... Lamtor3 Mouse copper(II) sulfate increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of LAMTOR3 mRNA CTD PMID:19549813 Lamtor3 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of LAMTOR3 mRNA CTD PMID:29279043 Lamtor3 Mouse cyclosporin A increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of LAMTOR3 mRNA CTD PMID:20106945 Lamtor3 Mouse dibutyl phthalate increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of LAMTOR3 mRNA CTD PMID:21266533 Lamtor3 Mouse dibutyl phthalate decreases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of LAMTOR3 mRNA CTD PMID:21266533 Lamtor3 Mouse dicrotophos decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 dicrotophos results in decreased expression of LAMTOR3 mRNA CTD PMID:28302478 Lamtor3 Mouse disulfiram multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of LAMTOR3 mRNA CTD PMID:24690739 Lamtor3 Mouse doxorubicin decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of LAMTOR3 mRNA CTD PMID:29803840 Lamtor3 Mouse escitalopram increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Escitalopram results in increased expression of LAMTOR3 mRNA CTD PMID:28467792 Lamtor3 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of LAMTOR3 mRNA CTD PMID:30319688 Lamtor3 Mouse ethyl methanesulfonate increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of LAMTOR3 mRNA CTD PMID:23649840 Lamtor3 Mouse flutamide increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Flutamide results in increased expression of LAMTOR3 mRNA CTD PMID:24136188 Lamtor3 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of LAMTOR3 mRNA CTD PMID:22206623 Lamtor3 Mouse formaldehyde increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of LAMTOR3 mRNA CTD PMID:23649840 Lamtor3 Mouse gentamycin increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of LAMTOR3 mRNA CTD PMID:33387578 Lamtor3 Mouse glafenine increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Glafenine results in increased expression of LAMTOR3 mRNA CTD PMID:24136188 Lamtor3 Mouse glyphosate increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Glyphosate results in increased expression of LAMTOR3 mRNA CTD PMID:31295307 Lamtor3 Mouse haloperidol increases expression EXP 6480464 Haloperidol results in increased expression of LAMTOR3 mRNA CTD PMID:14647396 Lamtor3 Mouse ivermectin decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 Ivermectin results in decreased expression of LAMTOR3 protein CTD PMID:32959892 Lamtor3 Mouse manganese atom multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse manganese(0) multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse manganese(II) chloride multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse methidathion decreases expression EXP 6480464 methidathion results in decreased expression of LAMTOR3 mRNA CTD PMID:34813904 Lamtor3 Mouse methyl methanesulfonate increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of LAMTOR3 mRNA CTD PMID:23649840 Lamtor3 Mouse methylmercury chloride decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of LAMTOR3 mRNA CTD PMID:28001369 Lamtor3 Mouse N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of LAMTOR3 protein CTD PMID:26558463 Lamtor3 Mouse nefazodone increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 nefazodone results in increased expression of LAMTOR3 mRNA CTD PMID:24136188 Lamtor3 Mouse ozone multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of LAMTOR3 mRNA CTD PMID:35430440 Lamtor3 Mouse p-menthan-3-ol multiple interactions ISO Lamtor3 (Rattus norvegicus) 6480464 [Tobacco Smoke Pollution co-treated with Menthol] results in increased expression of LAMTOR3 protein CTD PMID:27818348 Lamtor3 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of LAMTOR3 mRNA CTD PMID:17562736 Lamtor3 Mouse phenobarbital affects expression ISO LAMTOR3 (Homo sapiens) 6480464 Phenobarbital affects the expression of LAMTOR3 mRNA CTD PMID:19159669 Lamtor3 Mouse potassium chromate decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of LAMTOR3 mRNA CTD PMID:22714537 Lamtor3 Mouse quercetin multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Cisplatin co-treated with Quercetin] results in increased expression of LAMTOR3 mRNA CTD PMID:27514524 Lamtor3 Mouse rac-lactic acid decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of LAMTOR3 mRNA CTD PMID:30851411 Lamtor3 Mouse resveratrol multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of LAMTOR3 mRNA CTD PMID:23557933 Lamtor3 Mouse sevoflurane decreases methylation EXP 6480464 Sevoflurane results in decreased methylation of LAMTOR3 mRNA CTD PMID:35249202 Lamtor3 Mouse sodium arsenite increases expression ISO LAMTOR3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of LAMTOR3 mRNA CTD PMID:38568856 Lamtor3 Mouse sodium arsenite multiple interactions ISO LAMTOR3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of LAMTOR3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of LAMTOR3 mRNA CTD PMID:39836092 Lamtor3 Mouse sunitinib increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Sunitinib results in increased expression of LAMTOR3 mRNA CTD PMID:31533062 Lamtor3 Mouse temozolomide decreases expression ISO LAMTOR3 (Homo sapiens) 6480464 Temozolomide results in decreased expression of LAMTOR3 mRNA CTD PMID:31758290 Lamtor3 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of LAMTOR3 mRNA CTD PMID:31919559 Lamtor3 Mouse thioacetamide increases expression ISO Lamtor3 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of LAMTOR3 mRNA CTD PMID:34492290 Lamtor3 Mouse thiram increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Thiram results in increased expression of LAMTOR3 mRNA CTD PMID:38568856 Lamtor3 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of LAMTOR3 mRNA CTD PMID:29264374 Lamtor3 Mouse triphenyl phosphate affects expression ISO LAMTOR3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of LAMTOR3 mRNA CTD PMID:37042841 Lamtor3 Mouse valproic acid increases expression ISO LAMTOR3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of LAMTOR3 mRNA CTD PMID:23179753 and PMID:29154799 Lamtor3 Mouse valproic acid affects expression ISO LAMTOR3 (Homo sapiens) 6480464 Valproic Acid affects the expression of LAMTOR3 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
1,2-dichloroethane (EXP) 1,2-dimethylhydrazine (EXP) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 2,3',4,4',5-Pentachlorobiphenyl (EXP) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) acrylamide (ISO) all-trans-retinoic acid (ISO) amphetamine (ISO) arsane (ISO) arsenic atom (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) cisplatin (ISO) citalopram (ISO) clozapine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) crocidolite asbestos (EXP) cyclosporin A (ISO) dibutyl phthalate (ISO) dicrotophos (ISO) disulfiram (ISO) doxorubicin (ISO) escitalopram (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) flutamide (ISO) folic acid (EXP) formaldehyde (ISO) gentamycin (ISO) glafenine (ISO) glyphosate (ISO) haloperidol (EXP) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methidathion (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (EXP) nefazodone (ISO) ozone (ISO) p-menthan-3-ol (ISO) paracetamol (EXP) phenobarbital (ISO) potassium chromate (ISO) quercetin (ISO) rac-lactic acid (ISO) resveratrol (ISO) sevoflurane (EXP) sodium arsenite (ISO) sunitinib (ISO) temozolomide (ISO) tetrachloromethane (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) valproic acid (ISO)
Lamtor3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 137,624,316 - 137,634,523 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 137,624,267 - 137,634,661 (+) Ensembl GRCm39 Ensembl GRCm38 3 137,918,555 - 137,928,762 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 137,918,506 - 137,928,900 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 137,581,519 - 137,591,726 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 137,855,942 - 137,866,149 (+) NCBI MGSCv36 mm8 Celera 3 144,329,273 - 144,339,499 (+) NCBI Celera Cytogenetic Map 3 G3 NCBI cM Map 3 63.97 NCBI
LAMTOR3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 99,878,336 - 99,894,546 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 99,878,336 - 99,894,428 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 100,799,493 - 100,815,703 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 101,021,387 - 101,034,726 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 101,159,542 - 101,172,881 NCBI Celera 4 98,096,915 - 98,113,123 (-) NCBI Celera Cytogenetic Map 4 q23 NCBI HuRef 4 96,537,819 - 96,554,027 (-) NCBI HuRef CHM1_1 4 100,776,002 - 100,792,210 (-) NCBI CHM1_1 T2T-CHM13v2.0 4 103,193,819 - 103,210,029 (-) NCBI T2T-CHM13v2.0
Lamtor3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 229,084,795 - 229,097,028 (+) NCBI GRCr8 mRatBN7.2 2 226,411,389 - 226,423,612 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 226,411,400 - 226,423,607 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 234,166,078 - 234,178,334 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 232,065,862 - 232,078,076 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 226,930,478 - 226,942,734 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 243,160,821 - 243,173,057 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 243,160,917 - 243,173,048 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 261,708,575 - 261,721,120 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 235,408,727 - 235,421,196 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 235,395,466 - 235,407,935 (+) NCBI Celera 2 218,577,883 - 218,589,947 (+) NCBI Celera Cytogenetic Map 2 q43 NCBI
Lamtor3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955496 7,788,997 - 7,809,143 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955496 7,789,210 - 7,809,143 (+) NCBI ChiLan1.0 ChiLan1.0
LAMTOR3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 97,959,862 - 97,976,022 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 98,243,665 - 98,259,762 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 92,304,115 - 92,317,461 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 102,965,111 - 102,978,205 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 102,965,111 - 102,978,205 (-) Ensembl panpan1.1 panPan2
LAMTOR3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 21,820,853 - 21,834,443 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 21,820,985 - 21,834,351 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 20,062,612 - 20,076,488 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 22,041,383 - 22,055,265 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 22,041,383 - 22,055,230 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 22,017,859 - 22,031,725 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 21,805,029 - 21,818,875 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 18,049,308 - 18,063,178 (+) NCBI UU_Cfam_GSD_1.0
Lamtor3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 19,769,726 - 19,784,773 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936520 3,113,235 - 3,128,333 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936520 3,113,178 - 3,128,333 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LAMTOR3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 120,623,550 - 120,643,072 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 120,625,897 - 120,642,630 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 129,805,161 - 129,821,876 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
LAMTOR3
Lamtor3
.
Predicted Target Of
Count of predictions: 246 Count of miRNA genes: 189 Interacting mature miRNAs: 211 Transcripts: ENSMUST00000168345 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300753 Eae10_m susceptibility to experimental allergic encephalomyelitis 10 (mouse) Not determined 3 131736617 148451178 Mouse 1300752 Ap6q_m alcohol preference 6 QTL (mouse) Not determined 3 100372912 147045722 Mouse 1558868 Ses9_m salmonella enteritidis susceptibility 9 (mouse) Not determined 3 119057332 153057456 Mouse 10412120 Ccs3_m colon cancer susceptibility 3 (mouse) Not determined 3 131754536 146017669 Mouse 1301563 Alcp3_m alcohol preference locus 3 (mouse) Not determined 3 130736935 159745316 Mouse 11039523 Tbbr1_m Trypanosoma brucei brucei response 1 (mouse) 3 130849375 159745316 Mouse 1301528 Loco1_m locomotor activity 1 (mouse) Not determined 3 133461893 159745316 Mouse 26884436 Zlq3_m zygomatic length QTL 3, 10 week (mouse) 3 3265060 142405761 Mouse 4142449 Tgq14_m triglyceride QTL 14 (mouse) Not determined 119318586 153318586 Mouse 10412240 Alpq6_m alcohol preference QTL 6 (mouse) Not determined 3 120772078 154772078 Mouse 4141935 Tgq15_m triglyceride QTL 15 (mouse) Not determined 119318586 153318586 Mouse 1301347 Fpli_m fasting plasma insulin (mouse) Not determined 3 126460514 159745316 Mouse 1301218 Letohc1_m low ethanol consumption 1 (mouse) Not determined 3 126352986 159745316 Mouse 27226733 Tibmd6_m tibia midshaft diameter 6, 16 week (mouse) 3 101307316 149805637 Mouse 27226732 Tibmd3_m tibia midshaft diameter 3, 10 week (mouse) 3 96607316 147805636 Mouse 1302151 Lprm2_m lymphoproliferation modifier 2 (mouse) Not determined 3 119778857 153779044 Mouse 1301381 Bomb1_m bone marrow pre-B 1 (mouse) Not determined 3 111133243 145133417 Mouse 10043919 Afpq8_m abdominal fat percent QTL 8 (mouse) Not determined 3 119057332 153057456 Mouse 1300619 Cdcs1_m cytokine deficiency colitis susceptibility 1 (mouse) Not determined 3 109834882 143835005 Mouse 1301705 Sles3_m systemic lupus erythmatosus suppressor 3 (mouse) Not determined 3 37174862 143353183 Mouse 4142245 Pstc1_m periosteal circumference 1 (mouse) Not determined 3 126270248 159745316 Mouse 1302056 Orgwq4_m organ weight QTL 4 (mouse) Not determined 3 30067588 147304689 Mouse 1302093 Orgwq5_m organ weight QTL 5 (mouse) Not determined 3 107376936 147304689 Mouse 1301100 Bdt2_m bone density traits 2 (mouse) Not determined 3 114736617 148736784 Mouse
AW556229
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 7 104,949,324 - 104,949,422 UniSTS GRCm38 GRCm38 3 137,928,516 - 137,928,614 UniSTS GRCm38 MGSCv37 7 112,097,838 - 112,097,936 UniSTS GRCm37 MGSCv37 3 137,591,480 - 137,591,578 UniSTS GRCm37 Celera 7 105,224,472 - 105,224,570 UniSTS Celera 3 144,339,254 - 144,339,351 UniSTS Cytogenetic Map 3 G3 UniSTS Cytogenetic Map 7 E3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000168345 ⟹ ENSMUSP00000130811
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,287 - 137,634,526 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,526 - 137,928,765 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000196632
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,323 - 137,634,001 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,562 - 137,928,240 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000197064 ⟹ ENSMUSP00000142512
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,267 - 137,633,980 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,506 - 137,928,219 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000197798
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,287 - 137,625,275 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,526 - 137,919,514 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000197817 ⟹ ENSMUSP00000143656
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,333 - 137,632,575 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,572 - 137,926,814 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000200107
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,630,551 - 137,633,916 (+) Ensembl GRCm38.p6 Ensembl 3 137,924,790 - 137,928,155 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000200269
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,624,605 - 137,632,860 (+) Ensembl GRCm38.p6 Ensembl 3 137,918,844 - 137,927,099 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000200656
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 3 137,631,936 - 137,634,661 (+) Ensembl GRCm38.p6 Ensembl 3 137,926,175 - 137,928,900 (+) Ensembl
RefSeq Acc Id:
NM_019920 ⟹ NP_064304
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 3 137,624,316 - 137,634,523 (+) NCBI GRCm38 3 137,918,555 - 137,928,762 (+) ENTREZGENE MGSCv37 3 137,581,519 - 137,591,726 (+) RGD Celera 3 144,329,273 - 144,339,499 (+) RGD cM Map 3 ENTREZGENE
Sequence:
GTCACGAGTAATGTGACAGCGACTTGACAGGCGGCTTCAGAGAGGCGACTGAACTGCGGGAACACCGGGGCAGGTCTTCCCAGGCTGGAGCGCGCGTGCGTCTGCAGAGGAGTGGAGATCGATTCTGC
hide sequence
RefSeq Acc Id:
NP_064304 ⟸ NM_019920
- UniProtKB:
O88653 (UniProtKB/Swiss-Prot), Q542I7 (UniProtKB/TrEMBL), Q3TX23 (UniProtKB/TrEMBL)
- Sequence:
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDSAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELIKVVEVS
hide sequence
Ensembl Acc Id:
ENSMUSP00000142512 ⟸ ENSMUST00000197064
Ensembl Acc Id:
ENSMUSP00000143656 ⟸ ENSMUST00000197817
Ensembl Acc Id:
ENSMUSP00000130811 ⟸ ENSMUST00000168345
RGD ID: 6834081 Promoter ID: MM_KWN:36217 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: NM_019920 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 3 137,581,251 - 137,581,852 (+) MPROMDB
RGD ID: 6882546 Promoter ID: EPDNEW_M4683 Type: initiation region Name: Lamtor3_1 Description: Mus musculus late endosomal/lysosomal adaptor, MAPK and MTORactivator 3 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 3 137,918,558 - 137,918,618 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-07-27
Lamtor3
late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
Mapksp1
MAPK scaffold protein 1
Symbol and/or name change
5135510 APPROVED
