Advanced Search (OLGA)

Gene: CPXM1 (carboxypeptidase X, M14 family member 1) Homo sapiens

Subscribe to Updates

Analyze

Symbol:

CPXM1

Name:

carboxypeptidase X, M14 family member 1

RGD ID:

1315836

HGNC Page

HGNC:15771

Description:

Predicted to enable metallocarboxypeptidase activity and zinc ion binding activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

carboxypeptidase x (m14 family); carboxypeptidase X (M14 family), member 1; carboxypeptidase-like protein X1; CPX1; CPXM; metallocarboxypeptidase CPX-1; probable carboxypeptidase X1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	2,794,074 - 2,800,627 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	2,794,074 - 2,800,627 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	2,774,720 - 2,781,273 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	2,722,715 - 2,729,282 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	2,722,714 - 2,729,266	NCBI
Celera	20	2,839,233 - 2,845,810 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	2,724,251 - 2,730,828 (-)	NCBI		HuRef
CHM1_1	20	2,774,764 - 2,781,341 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	2,824,548 - 2,831,102 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CPXM1	Human	Huntington's disease-like 1		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Huntington disease-like 1	ClinVar	PMID:28492532
CPXM1	Human	pantothenate kinase-associated neurodegeneration		IAGP	(Homo sapiens)	8554872	ClinVar Annotator: match by term: Pigmentary pallidal degeneration	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CPXM1	Human	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	o and p'-DDT results in increased expression of CPXM1 mRNA	CTD	PMID:24096037
CPXM1	Human	1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	o and p'-DDT results in increased expression of CPXM1 mRNA	CTD	PMID:24096037
CPXM1	Human	1,2-dimethylhydrazine	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of CPXM1 mRNA	CTD	PMID:22206623
CPXM1	Human	17alpha-ethynylestradiol	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Ethinyl Estradiol results in decreased expression of CPXM1 mRNA	CTD	PMID:17557909
CPXM1	Human	17beta-estradiol	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	Estradiol results in increased expression of CPXM1 mRNA	CTD	PMID:19484750
CPXM1	Human	2,2',5,5'-tetrachlorobiphenyl	increases expression	EXP		6480464	2 more ...	CTD	PMID:36804509
CPXM1	Human	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Cpxm1 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of CPXM1 mRNA	CTD	PMID:16962184 more ...
CPXM1	Human	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	Cpxm1 (Mus musculus)	6480464	2 more ...	CTD	PMID:38648751
CPXM1	Human	2-methylcholine	affects expression	EXP		6480464	beta-methylcholine affects the expression of CPXM1 mRNA	CTD	PMID:21179406
CPXM1	Human	5-fluorouracil	affects expression	EXP		6480464	Fluorouracil affects the expression of CPXM1 mRNA	CTD	PMID:15205334
CPXM1	Human	6-propyl-2-thiouracil	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of CPXM1 mRNA	CTD	PMID:22504374 and PMID:24780913
CPXM1	Human	acetamide	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	acetamide results in increased expression of CPXM1 mRNA	CTD	PMID:31881176
CPXM1	Human	acrylamide	decreases expression	EXP		6480464	Acrylamide results in decreased expression of CPXM1 mRNA	CTD	PMID:32763439
CPXM1	Human	all-trans-retinoic acid	decreases expression	EXP		6480464	Tretinoin results in decreased expression of CPXM1 mRNA	CTD	PMID:33167477
CPXM1	Human	aristolochic acid A	decreases expression	EXP		6480464	aristolochic acid I results in decreased expression of CPXM1 mRNA	CTD	PMID:33212167
CPXM1	Human	arsane	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPXM1 mRNA	CTD	PMID:39836092
CPXM1	Human	arsenic atom	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPXM1 mRNA	CTD	PMID:39836092
CPXM1	Human	benzo[a]pyrene	increases methylation	EXP		6480464	Benzo(a)pyrene results in increased methylation of CPXM1 3' UTR more ...	CTD	PMID:27901495
CPXM1	Human	bis(2-ethylhexyl) phthalate	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in increased expression of CPXM1 mRNA	CTD	PMID:33754040
CPXM1	Human	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Cpxm1 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of CPXM1 mRNA	CTD	PMID:34319233
CPXM1	Human	bisphenol A	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	bisphenol A results in decreased expression of CPXM1 mRNA	CTD	PMID:25181051 and PMID:34947998
CPXM1	Human	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of CPXM1 mRNA	CTD	PMID:27685785
CPXM1	Human	buta-1,3-diene	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	1 and 3-butadiene results in increased expression of CPXM1 mRNA	CTD	PMID:29038090
CPXM1	Human	cadmium atom	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPXM1 mRNA	CTD	PMID:37325564
CPXM1	Human	cadmium dichloride	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CPXM1 mRNA	CTD	PMID:37325564
CPXM1	Human	carbon nanotube	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
CPXM1	Human	choline	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPXM1 mRNA	CTD	PMID:20938992
CPXM1	Human	cisplatin	increases expression	EXP		6480464	Cisplatin results in increased expression of CPXM1 mRNA	CTD	PMID:27594783
CPXM1	Human	cyclosporin A	decreases methylation	EXP		6480464	Cyclosporine results in decreased methylation of CPXM1 promoter	CTD	PMID:27989131
CPXM1	Human	dibutyl phthalate	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Dibutyl Phthalate results in increased expression of CPXM1 mRNA	CTD	PMID:21266533
CPXM1	Human	dimethylarsinic acid	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CPXM1 mRNA	CTD	PMID:34876320
CPXM1	Human	dimethylarsinic acid	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Cacodylic Acid results in decreased expression of CPXM1 mRNA	CTD	PMID:37567419
CPXM1	Human	dioxygen	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of CPXM1 mRNA	CTD	PMID:30529165
CPXM1	Human	diquat	decreases expression	ISO	Cpxm1 (Mus musculus)	6480464	Diquat results in decreased expression of CPXM1 mRNA	CTD	PMID:36851058
CPXM1	Human	diuron	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Diuron results in decreased expression of CPXM1 mRNA	CTD	PMID:25152437
CPXM1	Human	doxorubicin	affects expression	EXP		6480464	Doxorubicin affects the expression of CPXM1 mRNA	CTD	PMID:15205334
CPXM1	Human	doxorubicin	decreases expression	EXP		6480464	Doxorubicin results in decreased expression of CPXM1 mRNA	CTD	PMID:29803840
CPXM1	Human	endosulfan	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Endosulfan results in decreased expression of CPXM1 mRNA	CTD	PMID:29391264
CPXM1	Human	folic acid	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPXM1 mRNA	CTD	PMID:20938992
CPXM1	Human	furan	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	furan results in increased expression of CPXM1 mRNA	CTD	PMID:27387713
CPXM1	Human	furan	decreases methylation	ISO	Cpxm1 (Rattus norvegicus)	6480464	furan results in decreased methylation of CPXM1 gene	CTD	PMID:27387713
CPXM1	Human	genistein	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	Genistein results in increased expression of CPXM1 mRNA	CTD	PMID:32186404
CPXM1	Human	gentamycin	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of CPXM1 mRNA	CTD	PMID:33387578
CPXM1	Human	inulin	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CPXM1 mRNA	CTD	PMID:36331819
CPXM1	Human	L-methionine	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of CPXM1 mRNA	CTD	PMID:20938992
CPXM1	Human	lead(0)	affects expression	EXP		6480464	Lead affects the expression of CPXM1 mRNA	CTD	PMID:28903495
CPXM1	Human	lipopolysaccharide	multiple interactions	EXP		6480464	S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of CPXM1 mRNA]	CTD	PMID:35811015
CPXM1	Human	lipopolysaccharide	increases expression	EXP		6480464	Lipopolysaccharides results in increased expression of CPXM1 mRNA	CTD	PMID:35811015
CPXM1	Human	methimazole	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Methimazole results in increased expression of CPXM1 mRNA	CTD	PMID:22504374
CPXM1	Human	methylarsonic acid	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CPXM1 mRNA	CTD	PMID:34876320
CPXM1	Human	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of CPXM1 mRNA	CTD	PMID:20061341 and PMID:25566086
CPXM1	Human	ozone	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CPXM1 mRNA	CTD	PMID:34911549
CPXM1	Human	paracetamol	affects expression	ISO	Cpxm1 (Mus musculus)	6480464	Acetaminophen affects the expression of CPXM1 mRNA	CTD	PMID:17562736
CPXM1	Human	paracetamol	decreases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Acetaminophen results in decreased expression of CPXM1 mRNA	CTD	PMID:33387578
CPXM1	Human	paraquat	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Paraquat results in increased expression of CPXM1 mRNA	CTD	PMID:32680482
CPXM1	Human	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of CPXM1 mRNA	CTD	PMID:36331819
CPXM1	Human	pioglitazone	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of CPXM1 mRNA	CTD	PMID:27935865
CPXM1	Human	pirinixic acid	decreases expression	ISO	Cpxm1 (Mus musculus)	6480464	pirinixic acid results in decreased expression of CPXM1 mRNA	CTD	PMID:23811191
CPXM1	Human	progesterone	affects expression	ISO	Cpxm1 (Mus musculus)	6480464	Progesterone affects the expression of CPXM1 mRNA	CTD	PMID:17251523
CPXM1	Human	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	EXP		6480464	S-(1 and 2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in increased expression of CPXM1 mRNA]	CTD	PMID:35811015
CPXM1	Human	silicon dioxide	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	Silicon Dioxide results in increased expression of CPXM1 mRNA	CTD	PMID:29341224
CPXM1	Human	sodium arsenate	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CPXM1 mRNA	CTD	PMID:34876320
CPXM1	Human	sodium arsenite	decreases expression	ISO	Cpxm1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of CPXM1 mRNA	CTD	PMID:18812580
CPXM1	Human	sodium arsenite	multiple interactions	ISO	Cpxm1 (Mus musculus)	6480464	[sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of CPXM1 mRNA	CTD	PMID:34876320
CPXM1	Human	sodium arsenite	multiple interactions	EXP		6480464	[sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CPXM1 mRNA	CTD	PMID:39836092
CPXM1	Human	sodium arsenite	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	sodium arsenite results in increased expression of CPXM1 mRNA	CTD	PMID:37682722
CPXM1	Human	Soman	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Soman results in increased expression of CPXM1 mRNA	CTD	PMID:19281266
CPXM1	Human	sunitinib	decreases expression	EXP		6480464	Sunitinib results in decreased expression of CPXM1 mRNA	CTD	PMID:31533062
CPXM1	Human	titanium dioxide	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	titanium dioxide results in increased expression of CPXM1 mRNA	CTD	PMID:23557971
CPXM1	Human	titanium dioxide	increases methylation	ISO	Cpxm1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of CPXM1 gene	CTD	PMID:35295148
CPXM1	Human	trichloroethene	increases expression	ISO	Cpxm1 (Rattus norvegicus)	6480464	Trichloroethylene results in increased expression of CPXM1 mRNA	CTD	PMID:33387578
CPXM1	Human	trimellitic anhydride	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	trimellitic anhydride results in increased expression of CPXM1 mRNA	CTD	PMID:19042947
CPXM1	Human	triptonide	increases expression	ISO	Cpxm1 (Mus musculus)	6480464	triptonide results in increased expression of CPXM1 mRNA	CTD	PMID:33045310
CPXM1	Human	valproic acid	increases methylation	EXP		6480464	Valproic Acid results in increased methylation of CPXM1 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CPXM1	Human	proteolysis	involved_in	IEA	UniProtKB-KW:KW-0645	150520179		UniProt	GO_REF:0000043
CPXM1	Human	proteolysis	NOT\|acts_upstream_of_or_within	ISO	Cpxm1 (Mus musculus)	9068941	PMID:10073577	MGI	PMID:10073577
CPXM1	Human	proteolysis	involved_in	IEA	InterPro:IPR000834	150520179		InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CPXM1	Human	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	150520179		UniProt	GO_REF:0000043
CPXM1	Human	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	150520179		UniProt	GO_REF:0000044
CPXM1	Human	extracellular space	located_in	IEA	UniProtKB:Q9Z100 and ensembl:ENSMUSP00000028897	150520179		Ensembl	GO_REF:0000107
CPXM1	Human	extracellular space	is_active_in	IBA	MGI:1934569 more ...	150520179		GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CPXM1	Human	carboxypeptidase activity	enables	IEA	UniProtKB-KW:KW-0121	150520179		UniProt	GO_REF:0000043
CPXM1	Human	carboxypeptidase activity	NOT\|enables	ISO	Cpxm1 (Mus musculus)	9068941	PMID:10073577	MGI	PMID:10073577
CPXM1	Human	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	150520179		UniProt	GO_REF:0000043
CPXM1	Human	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	150520179		UniProt	GO_REF:0000043
CPXM1	Human	metallocarboxypeptidase activity	enables	IEA	InterPro:IPR000834	150520179		InterPro	GO_REF:0000002
CPXM1	Human	metallopeptidase activity	enables	IEA	UniProtKB-KW:KW-0482	150520179		UniProt	GO_REF:0000043
CPXM1	Human	peptidase activity	enables	IEA	UniProtKB-KW:KW-0645	150520179		UniProt	GO_REF:0000043
CPXM1	Human	zinc ion binding	enables	IEA	InterPro:IPR000834	150520179		InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	GOAs Human GO annotations	GOA_HUMAN data from the GO Consortium
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:10073577	PMID:11780052	PMID:12477932	PMID:12975309	PMID:14702039	PMID:14759258	PMID:15146197	PMID:15489334	PMID:16344560	PMID:18624398	PMID:21873635	PMID:26603934
PMID:27006448	PMID:35697923

CPXM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	2,794,074 - 2,800,627 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	2,794,074 - 2,800,627 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	2,774,720 - 2,781,273 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	2,722,715 - 2,729,282 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	2,722,714 - 2,729,266	NCBI
Celera	20	2,839,233 - 2,845,810 (-)	NCBI		Celera
Cytogenetic Map	20	p13	NCBI
HuRef	20	2,724,251 - 2,730,828 (-)	NCBI		HuRef
CHM1_1	20	2,774,764 - 2,781,341 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	20	2,824,548 - 2,831,102 (-)	NCBI		T2T-CHM13v2.0

Cpxm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	130,232,695 - 130,239,549 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	130,232,695 - 130,239,494 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	130,390,775 - 130,397,629 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	130,390,775 - 130,397,574 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	130,216,511 - 130,223,365 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	130,082,216 - 130,089,015 (-)	NCBI		MGSCv36	mm8
Celera	2	131,615,457 - 131,622,311 (-)	NCBI		Celera
Cytogenetic Map	2	F1	NCBI
cM Map	2	63.22	NCBI

Cpxm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	138,041,645 - 138,048,443 (-)	NCBI		GRCr8
mRatBN7.2	3	117,588,532 - 117,595,330 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	117,588,532 - 117,595,330 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	121,486,474 - 121,493,272 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	130,081,972 - 130,088,770 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	127,742,598 - 127,749,396 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	122,913,886 - 122,920,684 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	122,913,886 - 122,920,684 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	129,414,247 - 129,421,045 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	118,000,980 - 118,007,777 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	117,906,682 - 117,913,606 (-)	NCBI
Celera	3	116,402,737 - 116,409,535 (-)	NCBI		Celera
Cytogenetic Map	3	q36	NCBI

Cpxm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955415	13,756,889 - 13,763,120 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955415	13,756,752 - 13,763,764 (-)	NCBI	ChiLan1.0	ChiLan1.0

CPXM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	21	3,768,999 - 3,775,576 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	20	3,765,824 - 3,772,378 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	2,888,062 - 2,894,614 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	2,651,390 - 2,657,821 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	2,651,390 - 2,661,001 (-)	Ensembl	panpan1.1		panPan2

CPXM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	24	18,453,874 - 18,460,350 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	24	18,453,712 - 18,461,738 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	24	18,275,230 - 18,289,912 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	24	18,866,383 - 18,881,069 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	24	18,874,609 - 18,881,077 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	24	18,459,571 - 18,474,246 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	24	18,570,347 - 18,585,030 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	24	18,899,134 - 18,913,816 (+)	NCBI		UU_Cfam_GSD_1.0

Cpxm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	167,498,509 - 167,505,280 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936485	15,929,799 - 15,936,648 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936485	15,929,888 - 15,936,647 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CPXM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	17	32,845,232 - 32,852,062 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	17	32,845,154 - 32,852,065 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	17	37,216,074 - 37,222,963 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CPXM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	53,747,355 - 53,753,899 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	53,747,441 - 53,754,750 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666087	162,104 - 169,145 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cpxm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624741	3,930,547 - 3,936,572 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624741	3,930,417 - 3,936,649 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CPXM1
80 total Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 20p13-11.21(chr20:89939-25697564)x3	copy number gain	See cases [RCV000051227]	Chr20:89939..25697564 [GRCh38] Chr20:70580..25678200 [GRCh37] Chr20:18580..25626200 [NCBI36] Chr20:20p13-11.21	pathogenic
GRCh38/hg38 20p13-11.23(chr20:89939-19146279)x3	copy number gain	See cases [RCV000051041]	Chr20:89939..19146279 [GRCh38] Chr20:70580..19126923 [GRCh37] Chr20:18580..19074923 [NCBI36] Chr20:20p13-11.23	pathogenic
GRCh38/hg38 20p13(chr20:2595077-3004837)x3	copy number gain	See cases [RCV000052758]	Chr20:2595077..3004837 [GRCh38] Chr20:2575723..2985483 [GRCh37] Chr20:2523723..2933483 [NCBI36] Chr20:20p13	uncertain significance
GRCh38/hg38 20p13-11.23(chr20:89939-19071495)x3	copy number gain	See cases [RCV000052995]	Chr20:89939..19071495 [GRCh38] Chr20:70580..19052139 [GRCh37] Chr20:18580..19000139 [NCBI36] Chr20:20p13-11.23	pathogenic
GRCh38/hg38 20p13-11.22(chr20:89939-21787252)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052996]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052996]\|See cases [RCV000052996]	Chr20:89939..21787252 [GRCh38] Chr20:70580..21767890 [GRCh37] Chr20:18580..21715890 [NCBI36] Chr20:20p13-11.22	pathogenic
GRCh38/hg38 20p13-12.1(chr20:89939-14818511)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052997]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000052997]\|See cases [RCV000052997]	Chr20:89939..14818511 [GRCh38] Chr20:70580..14799157 [GRCh37] Chr20:18580..14747157 [NCBI36] Chr20:20p13-12.1	pathogenic
NM_001184699.1(CPXM1):c.1753G>A (p.Asp585Asn)	single nucleotide variant	Malignant melanoma [RCV000072561]	Chr20:2794420 [GRCh38] Chr20:2775066 [GRCh37] Chr20:2723066 [NCBI36] Chr20:20p13	not provided
NM_001184699.1(CPXM1):c.1717G>A (p.Gly573Arg)	single nucleotide variant	Malignant melanoma [RCV000072562]	Chr20:2794561 [GRCh38] Chr20:2775207 [GRCh37] Chr20:2723207 [NCBI36] Chr20:20p13	not provided
NM_001184699.1(CPXM1):c.1225G>A (p.Glu409Lys)	single nucleotide variant	Malignant melanoma [RCV000072563]	Chr20:2796264 [GRCh38] Chr20:2776910 [GRCh37] Chr20:2724910 [NCBI36] Chr20:20p13	not provided
NM_001184699.1(CPXM1):c.1804G>A (p.Glu602Lys)	single nucleotide variant	Malignant melanoma [RCV000063705]	Chr20:2794369 [GRCh38] Chr20:2775015 [GRCh37] Chr20:2723015 [NCBI36] Chr20:20p13	not provided
NM_001184699.1(CPXM1):c.1688G>A (p.Gly563Glu)	single nucleotide variant	Malignant melanoma [RCV000063706]	Chr20:2794590 [GRCh38] Chr20:2775236 [GRCh37] Chr20:2723236 [NCBI36] Chr20:20p13	not provided
GRCh38/hg38 20p13-q11.1(chr20:80106-30227427)x3	copy number gain	See cases [RCV000133996]	Chr20:80106..30227427 [GRCh38] Chr20:60747..29462103 [GRCh37] Chr20:8747..28075764 [NCBI36] Chr20:20p13-q11.1	pathogenic
GRCh38/hg38 20p13-q13.33(chr20:99557-64277321)x3	copy number gain	See cases [RCV000135859]	Chr20:99557..64277321 [GRCh38] Chr20:80198..62908674 [GRCh37] Chr20:28198..62379118 [NCBI36] Chr20:20p13-q13.33	pathogenic
GRCh38/hg38 20p13-12.1(chr20:80106-13029401)x3	copy number gain	See cases [RCV000138677]	Chr20:80106..13029401 [GRCh38] Chr20:60747..13010049 [GRCh37] Chr20:8747..12958049 [NCBI36] Chr20:20p13-12.1	pathogenic
GRCh38/hg38 20p13-12.3(chr20:80093-6386012)x3	copy number gain	See cases [RCV000139597]	Chr20:80093..6386012 [GRCh38] Chr20:60734..6366659 [GRCh37] Chr20:8734..6314659 [NCBI36] Chr20:20p13-12.3	pathogenic
GRCh38/hg38 20p13-12.3(chr20:84402-6159078)x3	copy number gain	See cases [RCV000141348]	Chr20:84402..6159078 [GRCh38] Chr20:65043..6139725 [GRCh37] Chr20:13043..6087725 [NCBI36] Chr20:20p13-12.3	pathogenic
GRCh38/hg38 20p13-11.1(chr20:80927-26324843)x3	copy number gain	See cases [RCV000142017]	Chr20:80927..26324843 [GRCh38] Chr20:61568..26305479 [GRCh37] Chr20:9568..26253479 [NCBI36] Chr20:20p13-11.1	pathogenic
GRCh38/hg38 20p13-12.3(chr20:80927-5447679)x3	copy number gain	See cases [RCV000142285]	Chr20:80927..5447679 [GRCh38] Chr20:61568..5428325 [GRCh37] Chr20:9568..5376325 [NCBI36] Chr20:20p13-12.3	uncertain significance
GRCh38/hg38 20p13-12.3(chr20:1269303-8626911)x3	copy number gain	See cases [RCV000142917]	Chr20:1269303..8626911 [GRCh38] Chr20:1249947..8607558 [GRCh37] Chr20:1197947..8555558 [NCBI36] Chr20:20p13-12.3	pathogenic
GRCh38/hg38 20p13-11.23(chr20:80928-18688031)x3	copy number gain	See cases [RCV000143426]	Chr20:80928..18688031 [GRCh38] Chr20:61569..18668675 [GRCh37] Chr20:9569..18616675 [NCBI36] Chr20:20p13-11.23	pathogenic
GRCh38/hg38 20p13(chr20:2526755-3081651)x3	copy number gain	See cases [RCV000143472]	Chr20:2526755..3081651 [GRCh38] Chr20:2507401..3062297 [GRCh37] Chr20:2455401..3010297 [NCBI36] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13-12.3(chr20:121521-5564937)x3	copy number gain	See cases [RCV000239772]	Chr20:121521..5564937 [GRCh37] Chr20:20p13-12.3	pathogenic
GRCh37/hg19 20p13-11.1(chr20:80198-26075841)x3	copy number gain	See cases [RCV000239954]	Chr20:80198..26075841 [GRCh37] Chr20:20p13-11.1	pathogenic
GRCh37/hg19 20p13(chr20:61568-4914872)x3	copy number gain	See cases [RCV000446883]	Chr20:61568..4914872 [GRCh37] Chr20:20p13	pathogenic
GRCh37/hg19 20p13(chr20:61568-4904599)x3	copy number gain	See cases [RCV000448397]	Chr20:61568..4904599 [GRCh37] Chr20:20p13	pathogenic
GRCh37/hg19 20p13-q11.21(chr20:80198-26208081)x3	copy number gain	not provided [RCV000487461]	Chr20:80198..26208081 [GRCh37] Chr20:20p13-q11.21	pathogenic
GRCh37/hg19 20p13-12.3(chr20:213423-5483406)x3	copy number gain	See cases [RCV000510531]	Chr20:213423..5483406 [GRCh37] Chr20:20p13-12.3	uncertain significance
GRCh37/hg19 20p13-12.3(chr20:2463101-8185680)x1	copy number loss	See cases [RCV000511897]	Chr20:2463101..8185680 [GRCh37] Chr20:20p13-12.3	pathogenic
GRCh37/hg19 20p13(chr20:61568-2824960)x3	copy number gain	See cases [RCV000511991]	Chr20:61568..2824960 [GRCh37] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13-q13.33(chr20:61569-62915555)x3	copy number gain	See cases [RCV000510832]	Chr20:61569..62915555 [GRCh37] Chr20:20p13-q13.33	pathogenic
NM_019609.5(CPXM1):c.385C>T (p.Arg129Trp)	single nucleotide variant	not specified [RCV004309460]	Chr20:2798493 [GRCh38] Chr20:2779139 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1901C>T (p.Thr634Met)	single nucleotide variant	not specified [RCV004309838]	Chr20:2794599 [GRCh38] Chr20:2775245 [GRCh37] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13-q13.33(chr20:61569-62915555)	copy number gain	See cases [RCV000512450]	Chr20:61569..62915555 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p13-12.2(chr20:61568-10486106)x3	copy number gain	See cases [RCV000512556]	Chr20:61568..10486106 [GRCh37] Chr20:20p13-12.2	likely pathogenic
GRCh37/hg19 20p13-q13.33(chr20:63244-62961294)x3	copy number gain	not provided [RCV000741059]	Chr20:63244..62961294 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p13(chr20:2739583-3064949)x3	copy number gain	not provided [RCV000741074]	Chr20:2739583..3064949 [GRCh37] Chr20:20p13	benign
GRCh37/hg19 20p13-q13.33(chr20:63244-62912463)x3	copy number gain	not provided [RCV000741057]	Chr20:63244..62912463 [GRCh37] Chr20:20p13-q13.33	pathogenic
GRCh37/hg19 20p13-q13.33(chr20:63244-62948788)x3	copy number gain	not provided [RCV000741058]	Chr20:63244..62948788 [GRCh37] Chr20:20p13-q13.33	pathogenic
NM_019609.5(CPXM1):c.882T>C (p.Pro294=)	single nucleotide variant	not provided [RCV000923955]	Chr20:2797045 [GRCh38] Chr20:2777691 [GRCh37] Chr20:20p13	benign
NM_019609.5(CPXM1):c.322G>A (p.Ala108Thr)	single nucleotide variant	not specified [RCV004304307]	Chr20:2798744 [GRCh38] Chr20:2779390 [GRCh37] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13(chr20:2738670-3054217)x3	copy number gain	not provided [RCV000846074]	Chr20:2738670..3054217 [GRCh37] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13-11.1(chr20:61568-26305479)x3	copy number gain	not provided [RCV001007068]	Chr20:61568..26305479 [GRCh37] Chr20:20p13-11.1	pathogenic
NC_000020.10:g.(?_1959939)_(6760201_?)dup	duplication	Huntington disease-like 1 [RCV003110989]\|Pigmentary pallidal degeneration [RCV003122285]	Chr20:1959939..6760201 [GRCh37] Chr20:20p13-12.3	uncertain significance
NM_019609.5(CPXM1):c.199C>G (p.Arg67Gly)	single nucleotide variant	not specified [RCV004106308]	Chr20:2798867 [GRCh38] Chr20:2779513 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.482G>A (p.Gly161Glu)	single nucleotide variant	not specified [RCV004239865]	Chr20:2798260 [GRCh38] Chr20:2778906 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1525G>A (p.Asp509Asn)	single nucleotide variant	not specified [RCV004141945]	Chr20:2795794 [GRCh38] Chr20:2776440 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1202C>T (p.Pro401Leu)	single nucleotide variant	not specified [RCV004091162]	Chr20:2796287 [GRCh38] Chr20:2776933 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1274G>A (p.Arg425His)	single nucleotide variant	not specified [RCV004139502]	Chr20:2796130 [GRCh38] Chr20:2776776 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2123T>C (p.Leu708Pro)	single nucleotide variant	not specified [RCV004226339]	Chr20:2794272 [GRCh38] Chr20:2774918 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1055A>G (p.Glu352Gly)	single nucleotide variant	not specified [RCV004148438]	Chr20:2796434 [GRCh38] Chr20:2777080 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1709C>T (p.Thr570Met)	single nucleotide variant	not specified [RCV004194611]	Chr20:2795610 [GRCh38] Chr20:2776256 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1576G>A (p.Asp526Asn)	single nucleotide variant	not specified [RCV004115386]	Chr20:2795743 [GRCh38] Chr20:2776389 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1073G>A (p.Gly358Asp)	single nucleotide variant	not specified [RCV004127080]	Chr20:2796416 [GRCh38] Chr20:2777062 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.866C>T (p.Ser289Leu)	single nucleotide variant	not specified [RCV004181164]	Chr20:2797061 [GRCh38] Chr20:2777707 [GRCh37] Chr20:20p13	likely benign
NM_019609.5(CPXM1):c.565A>G (p.Thr189Ala)	single nucleotide variant	not specified [RCV004112346]	Chr20:2798177 [GRCh38] Chr20:2778823 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2057G>A (p.Arg686Gln)	single nucleotide variant	not specified [RCV004230429]	Chr20:2794338 [GRCh38] Chr20:2774984 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1949A>G (p.His650Arg)	single nucleotide variant	not specified [RCV004159858]	Chr20:2794551 [GRCh38] Chr20:2775197 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1646G>A (p.Arg549Gln)	single nucleotide variant	not specified [RCV004072683]	Chr20:2795673 [GRCh38] Chr20:2776319 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.118T>G (p.Ser40Ala)	single nucleotide variant	not specified [RCV004186951]	Chr20:2800455 [GRCh38] Chr20:2781101 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2182C>T (p.Arg728Trp)	single nucleotide variant	not specified [RCV004194132]	Chr20:2794213 [GRCh38] Chr20:2774859 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1335G>T (p.Trp445Cys)	single nucleotide variant	not specified [RCV004166241]	Chr20:2796069 [GRCh38] Chr20:2776715 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.863C>T (p.Ala288Val)	single nucleotide variant	not specified [RCV004133583]	Chr20:2797064 [GRCh38] Chr20:2777710 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1588C>A (p.Arg530Ser)	single nucleotide variant	not specified [RCV004090661]	Chr20:2795731 [GRCh38] Chr20:2776377 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1610C>T (p.Ala537Val)	single nucleotide variant	not specified [RCV004268902]	Chr20:2795709 [GRCh38] Chr20:2776355 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.394G>A (p.Ala132Thr)	single nucleotide variant	not specified [RCV004269560]	Chr20:2798484 [GRCh38] Chr20:2779130 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.134A>G (p.His45Arg)	single nucleotide variant	not specified [RCV004272937]	Chr20:2800439 [GRCh38] Chr20:2781085 [GRCh37] Chr20:20p13	likely benign
NM_019609.5(CPXM1):c.386G>A (p.Arg129Gln)	single nucleotide variant	not specified [RCV004263071]	Chr20:2798492 [GRCh38] Chr20:2779138 [GRCh37] Chr20:20p13	likely benign
NM_019609.5(CPXM1):c.1631A>G (p.Gln544Arg)	single nucleotide variant	not specified [RCV004248433]	Chr20:2795688 [GRCh38] Chr20:2776334 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.913A>G (p.Met305Val)	single nucleotide variant	not specified [RCV004282898]	Chr20:2797014 [GRCh38] Chr20:2777660 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.436C>T (p.Arg146Trp)	single nucleotide variant	not specified [RCV004247986]	Chr20:2798442 [GRCh38] Chr20:2779088 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2174G>A (p.Arg725His)	single nucleotide variant	not provided [RCV004696333]\|not specified [RCV004248463]	Chr20:2794221 [GRCh38] Chr20:2774867 [GRCh37] Chr20:20p13	uncertain significance
GRCh38/hg38 20p13-11.21(chr20:87153-23635465)x3	copy number gain	Renal agenesis [RCV003327640]	Chr20:87153..23635465 [GRCh38] Chr20:20p13-11.21	pathogenic
NM_019609.5(CPXM1):c.61G>C (p.Ala21Pro)	single nucleotide variant	not specified [RCV004349662]	Chr20:2800512 [GRCh38] Chr20:2781158 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2051A>G (p.Asn684Ser)	single nucleotide variant	not specified [RCV004341827]	Chr20:2794344 [GRCh38] Chr20:2774990 [GRCh37] Chr20:20p13	likely benign
GRCh37/hg19 20p13-12.2(chr20:61569-9542361)x3	copy number gain	not provided [RCV003485207]	Chr20:61569..9542361 [GRCh37] Chr20:20p13-12.2	pathogenic
GRCh37/hg19 20p13(chr20:2640674-4323312)x3	copy number gain	not specified [RCV003986138]	Chr20:2640674..4323312 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1205C>G (p.Ser402Cys)	single nucleotide variant	not specified [RCV004374739]	Chr20:2796284 [GRCh38] Chr20:2776930 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1678G>A (p.Gly560Ser)	single nucleotide variant	not specified [RCV004374742]	Chr20:2795641 [GRCh38] Chr20:2776287 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1186C>T (p.Arg396Cys)	single nucleotide variant	not specified [RCV004374737]	Chr20:2796303 [GRCh38] Chr20:2776949 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1553G>T (p.Arg518Leu)	single nucleotide variant	not specified [RCV004374740]	Chr20:2795766 [GRCh38] Chr20:2776412 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2047C>T (p.Arg683Trp)	single nucleotide variant	not specified [RCV004374745]	Chr20:2794348 [GRCh38] Chr20:2774994 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2056C>T (p.Arg686Trp)	single nucleotide variant	not specified [RCV004374746]	Chr20:2794339 [GRCh38] Chr20:2774985 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1204T>A (p.Ser402Thr)	single nucleotide variant	not specified [RCV004374738]	Chr20:2796285 [GRCh38] Chr20:2776931 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1672G>T (p.Val558Leu)	single nucleotide variant	not specified [RCV004374741]	Chr20:2795647 [GRCh38] Chr20:2776293 [GRCh37] Chr20:20p13	likely benign
NM_019609.5(CPXM1):c.1898A>G (p.Asp633Gly)	single nucleotide variant	not specified [RCV004374743]	Chr20:2794602 [GRCh38] Chr20:2775248 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1933G>A (p.Val645Met)	single nucleotide variant	not specified [RCV004374744]	Chr20:2794567 [GRCh38] Chr20:2775213 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.227T>C (p.Met76Thr)	single nucleotide variant	not specified [RCV004374747]	Chr20:2798839 [GRCh38] Chr20:2779485 [GRCh37] Chr20:20p13	uncertain significance
GRCh37/hg19 20p13-11.21(chr20:68351-23860313)x3	copy number gain	not provided [RCV003885495]	Chr20:68351..23860313 [GRCh37] Chr20:20p13-11.21	pathogenic
GRCh37/hg19 20p13-12.1(chr20:68351-16142323)x3	copy number gain	not provided [RCV003885494]	Chr20:68351..16142323 [GRCh37] Chr20:20p13-12.1	pathogenic
NM_019609.5(CPXM1):c.766C>T (p.Pro256Ser)	single nucleotide variant	not specified [RCV004374748]	Chr20:2797258 [GRCh38] Chr20:2777904 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1187G>T (p.Arg396Leu)	single nucleotide variant	not specified [RCV004611138]	Chr20:2796302 [GRCh38] Chr20:2776948 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.555G>A (p.Ser185=)	single nucleotide variant	EBV-positive nodal T- and NK-cell lymphoma [RCV004560204]	Chr20:2798187 [GRCh38] Chr20:2778833 [GRCh37] Chr20:20p13	likely benign
NC_000020.10:g.(?_2361615)_(3903941_?)dup	duplication	not provided [RCV004580998]	Chr20:2361615..3903941 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1693G>C (p.Gly565Arg)	single nucleotide variant	not specified [RCV004611143]	Chr20:2795626 [GRCh38] Chr20:2776272 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1377C>G (p.Asn459Lys)	single nucleotide variant	not specified [RCV004611146]	Chr20:2796027 [GRCh38] Chr20:2776673 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.371G>A (p.Arg124Gln)	single nucleotide variant	not specified [RCV004611137]	Chr20:2798507 [GRCh38] Chr20:2779153 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1646G>T (p.Arg549Leu)	single nucleotide variant	not specified [RCV004611140]	Chr20:2795673 [GRCh38] Chr20:2776319 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1555G>A (p.Glu519Lys)	single nucleotide variant	not specified [RCV004611139]	Chr20:2795764 [GRCh38] Chr20:2776410 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1553G>A (p.Arg518His)	single nucleotide variant	not specified [RCV004611142]	Chr20:2795766 [GRCh38] Chr20:2776412 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.101C>T (p.Thr34Ile)	single nucleotide variant	not specified [RCV004611145]	Chr20:2800472 [GRCh38] Chr20:2781118 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2132T>C (p.Leu711Pro)	single nucleotide variant	not specified [RCV004611141]	Chr20:2794263 [GRCh38] Chr20:2774909 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.37C>T (p.Pro13Ser)	single nucleotide variant	not specified [RCV004611144]	Chr20:2800536 [GRCh38] Chr20:2781182 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.94C>A (p.Pro32Thr)	single nucleotide variant	not specified [RCV004611136]	Chr20:2800479 [GRCh38] Chr20:2781125 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.805G>C (p.Ala269Pro)	single nucleotide variant	not specified [RCV004912803]	Chr20:2797219 [GRCh38] Chr20:2777865 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2126G>A (p.Arg709His)	single nucleotide variant	not specified [RCV004912797]	Chr20:2794269 [GRCh38] Chr20:2774915 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1379A>G (p.His460Arg)	single nucleotide variant	not specified [RCV004912802]	Chr20:2796025 [GRCh38] Chr20:2776671 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.158C>T (p.Ala53Val)	single nucleotide variant	not specified [RCV004912801]	Chr20:2800415 [GRCh38] Chr20:2781061 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1187G>A (p.Arg396His)	single nucleotide variant	not specified [RCV004912804]	Chr20:2796302 [GRCh38] Chr20:2776948 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.194G>A (p.Arg65Gln)	single nucleotide variant	not specified [RCV004912800]	Chr20:2798872 [GRCh38] Chr20:2779518 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.679G>A (p.Ala227Thr)	single nucleotide variant	not specified [RCV004912799]	Chr20:2797970 [GRCh38] Chr20:2778616 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2101A>T (p.Thr701Ser)	single nucleotide variant	not specified [RCV004912798]	Chr20:2794294 [GRCh38] Chr20:2774940 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1864C>T (p.Arg622Cys)	single nucleotide variant	not specified [RCV004912795]	Chr20:2794636 [GRCh38] Chr20:2775282 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1927A>G (p.Ile643Val)	single nucleotide variant	not specified [RCV004912796]	Chr20:2794573 [GRCh38] Chr20:2775219 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.1267G>A (p.Glu423Lys)	single nucleotide variant	not specified [RCV004912794]	Chr20:2796137 [GRCh38] Chr20:2776783 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.289G>A (p.Val97Met)	single nucleotide variant	not specified [RCV004361218]	Chr20:2798777 [GRCh38] Chr20:2779423 [GRCh37] Chr20:20p13	uncertain significance
NM_019609.5(CPXM1):c.2131C>T (p.Leu711=)	single nucleotide variant	not provided [RCV000950019]	Chr20:2794264 [GRCh38] Chr20:2774910 [GRCh37] Chr20:20p13	benign

Predicted Target Of

	Summary Value
Count of predictions:	233
Count of miRNA genes:	222
Interacting mature miRNAs:	233
Transcripts:	ENST00000380605
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
597300779	GWAS1396853_H	probable carboxypeptidase X1 measurement QTL GWAS1396853 (human)		1e-57	probable carboxypeptidase X1 measurement		20	2800116	2800117	Human
597113266	GWAS1209340_H	intraocular pressure measurement QTL GWAS1209340 (human)		2e-10	intraocular pressure measurement		20	2799505	2799506	Human
597113469	GWAS1209543_H	intraocular pressure measurement QTL GWAS1209543 (human)		2e-09	central corneal thickness		20	2800037	2800038	Human
597082060	GWAS1178134_H	gut microbiome measurement QTL GWAS1178134 (human)		0.000001	gut microbiome measurement		20	2800188	2800189	Human
597220435	GWAS1316509_H	corneal resistance factor QTL GWAS1316509 (human)		9e-12	corneal resistance factor		20	2800037	2800038	Human
597211476	GWAS1307550_H	intraocular pressure measurement QTL GWAS1307550 (human)		2e-08	intraocular pressure measurement		20	2799505	2799506	Human
597180663	GWAS1276737_H	probable carboxypeptidase X1 measurement QTL GWAS1276737 (human)		3e-89	probable carboxypeptidase X1 measurement		20	2796329	2796330	Human

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
1204	2366	2757	2231	4914	1699	2233	6	602	1878	440	2243	7110	6364	45	3703	1	820	1706	1527	173	1


RefSeq Transcripts	NM_001184699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_019609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AI470029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK027661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK075527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK303142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK315027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL035460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL541188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AW874578	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY358956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC032692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC063430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX366559	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CN308423	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068258	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS208031	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DB252546	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HB867216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENST00000380605 ⟹ ENSP00000369979

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	20	2,794,074 - 2,800,627 (-)	Ensembl

RefSeq Acc Id:

NM_001184699 ⟹ NP_001171628

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	2,794,074 - 2,800,627 (-)	NCBI
GRCh37	20	2,774,715 - 2,781,292 (-)	RGD
Celera	20	2,839,233 - 2,845,810 (-)	RGD
HuRef	20	2,724,251 - 2,730,828 (-)	RGD
CHM1_1	20	2,774,764 - 2,781,341 (-)	NCBI
T2T-CHM13v2.0	20	2,824,548 - 2,831,102 (-)	NCBI

Sequence:

show sequence

GAGACCGACCCGCCACCCGCCGTAGCCCGCGCGCCCCTGGCACTCAATCCCCGCCATGTGGGGGCTCCTGCTCGCCCTGGCCGCCTTCGCGCCGGCCGTCGGCCCGGCTCTGGGGGCGCCCAGGAACT
CGGTGCTGGGCCTCGCGCAGCCCGGGACCACCAAGGTCCCAGGCTCGACCCCGGCCCTGCATAGCAGCCCGGCACAGCCGCCGGCGGAGACAGCTAACGGGACCTCAGAACAGCATGTCCGGATTCGA
GTCATCAAGAAGAAAAAGGTCATTATGAAGAAGCGGAAGAAGCTAACTCTAACTCGCCCCACCCCACTGGTGACTGCCGGGCCCCTTGTGACCCCCACTCCAGCAGGGACCCTCGACCCCGCTGAGAA
ACAAGAAACAGGCTGTCCTCCTTTGGGTCTGGAGTCCCTGCGAGTTTCAGATAGCCGGCTTGAGGCATCCAGCAGCCAGTCCTTTGGTCTTGGACCACACCGAGGACGGCTCAACATTCAGTCAGGCC
TGGAGGACGGCGATCTATATGATGGAGCCTGGTGTGCTGAGGAGCAGGACGCCGATCCATGGTTTCAGGTGGACGCTGGGCACCCCACCCGCTTCTCGGGTGTTATCACACAGGGCAGGAACTCTGTC
TGGAGGTATGACTGGGTCACATCATACAAGGTCCAGTTCAGCAATGACAGTCGGACCTGGTGGGGAAGTAGGAACCACAGCAGTGGGATGGACGCAGTATTTCCTGCCAATTCAGACCCAGAAACTCC
AGTGCTGAACCTCCTGCCGGAGCCCCAGGTGGCCCGCTTCATTCGCCTGCTGCCCCAGACCTGGCTCCAGGGAGGCGCGCCTTGCCTCCGGGCAGAGATCCTGGCCTGCCCAGTCTCAGACCCCAATG
ACCTATTCCTTGAGGCCCCTGCGTCGGGATCCTCTGACCCTCTAGACTTTCAGCATCACAATTACAAGGCCATGAGGAAGCTGATGAAGCAGGTACAAGAGCAATGCCCCAACATCACCCGCATCTAC
AGCATTGGGAAGAGCTACCAGGGCCTGAAGCTGTATGTGATGGAAATGTCGGACAAGCCTGGGGAGCATGAGCTGGGGGAGCCTGAGGTGCGCTACGTGGCTGGCATGCATGGGAACGAGGCCCTGGG
GCGGGAGTTGCTTCTGCTCCTGATGCAGTTCCTGTGCCATGAGTTCCTGCGAGGGAACCCACGGGTGACCCGGCTGCTCTCTGAGATGCGCATTCACCTGCTGCCCTCCATGAACCCTGATGGCTATG
AGATCGCCTACCACCGGGGTTCAGAGCTGGTGGGCTGGGCCGAGGGCCGCTGGAACAACCAGAGCATCGATCTTAACCATAATTTTGCTGACCTCAACACACCACTGTGGGAAGCACAGGACGATGGG
AAGGTGCCCCACATCGTCCCCAACCATCACCTGCCATTGCCCACTTACTACACCCTGCCCAATGCCACCGTGGCTCCTGAAACGCGGGCAGTAATCAAGTGGATGAAGCGGATCCCCTTTGTGCTAAG
TGCCAACCTCCACGGGGGCATGAATGACTTCAGCTACCTACACACCAACTGCTTTGAGGTCACTGTGGAGCTGTCCTGTGACAAGTTCCCTCACGAGAATGAATTGCCCCAGGAGTGGGAGAACAACA
AAGACGCCCTCCTCACCTACCTGGAGCAGGTGCGCATGGGCATTGCAGGAGTGGTGAGGGACAAGGACACGGAGCTTGGGATTGCTGACGCTGTCATTGCCGTGGATGGGATTAACCATGACGTGACC
ACGGCGTGGGGCGGGGATTATTGGCGTCTGCTGACCCCAGGGGACTACATGGTGACTGCCAGTGCCGAGGGCTACCATTCAGTGACACGGAACTGTCGGGTCACCTTTGAAGAGGGCCCCTTCCCCTG
CAATTTCGTGCTCACCAAGACTCCCAAACAGAGGCTGCGCGAGCTGCTGGCAGCTGGGGCCAAGGTGCCCCCGGACCTTCGCAGGCGCCTGGAGCGGCTAAGGGGACAGAAGGATTGATACCTGCGGT
TTAAGAGCCCTAGGGCAGGCTGGACCTGTCAAGACGGGAAGGGGAAGAGTAGAGAGGGAGGGACAAAGTGAGGAAAAGGTGCTCATTAAAGCTACCGGGCACCTTA

hide sequence

RefSeq Acc Id:

NM_019609 ⟹ NP_062555

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	2,794,074 - 2,800,627 (-)	NCBI
GRCh37	20	2,774,715 - 2,781,292 (-)	RGD
Build 36	20	2,722,715 - 2,729,282 (-)	NCBI Archive
Celera	20	2,839,233 - 2,845,810 (-)	RGD
HuRef	20	2,724,251 - 2,730,828 (-)	RGD
CHM1_1	20	2,774,764 - 2,781,341 (-)	NCBI
T2T-CHM13v2.0	20	2,824,548 - 2,831,102 (-)	NCBI

Sequence:

show sequence

GAGACCGACCCGCCACCCGCCGTAGCCCGCGCGCCCCTGGCACTCAATCCCCGCCATGTGGGGGCTCCTGCTCGCCCTGGCCGCCTTCGCGCCGGCCGTCGGCCCGGCTCTGGGGGCGCCCAGGAACT
CGGTGCTGGGCCTCGCGCAGCCCGGGACCACCAAGGTCCCAGGCTCGACCCCGGCCCTGCATAGCAGCCCGGCACAGCCGCCGGCGGAGACAGCTAACGGGACCTCAGAACAGCATGTCCGGATTCGA
GTCATCAAGAAGAAAAAGGTCATTATGAAGAAGCGGAAGAAGCTAACTCTAACTCGCCCCACCCCACTGGTGACTGCCGGGCCCCTTGTGACCCCCACTCCAGCAGGGACCCTCGACCCCGCTGAGAA
ACAAGAAACAGGCTGTCCTCCTTTGGGTCTGGAGTCCCTGCGAGTTTCAGATAGCCGGCTTGAGGCATCCAGCAGCCAGTCCTTTGGTCTTGGACCACACCGAGGACGGCTCAACATTCAGTCAGGCC
TGGAGGACGGCGATCTATATGATGGAGCCTGGTGTGCTGAGGAGCAGGACGCCGATCCATGGTTTCAGGTGGACGCTGGGCACCCCACCCGCTTCTCGGGTGTTATCACACAGGGCAGGAACTCTGTC
TGGAGGTATGACTGGGTCACATCATACAAGGTCCAGTTCAGCAATGACAGTCGGACCTGGTGGGGAAGTAGGAACCACAGCAGTGGGATGGACGCAGTATTTCCTGCCAATTCAGACCCAGAAACTCC
AGTGCTGAACCTCCTGCCGGAGCCCCAGGTGGCCCGCTTCATTCGCCTGCTGCCCCAGACCTGGCTCCAGGGAGGCGCGCCTTGCCTCCGGGCAGAGATCCTGGCCTGCCCAGTCTCAGACCCCAATG
ACCTATTCCTTGAGGCCCCTGCGTCGGGATCCTCTGACCCTCTAGACTTTCAGCATCACAATTACAAGGCCATGAGGAAGCTGATGAAGCAGGTACAAGAGCAATGCCCCAACATCACCCGCATCTAC
AGCATTGGGAAGAGCTACCAGGGCCTGAAGCTGTATGTGATGGAAATGTCGGACAAGCCTGGGGAGCATGAGCTGGGGGAGCCTGAGGTGCGCTACGTGGCTGGCATGCATGGGAACGAGGCCCTGGG
GCGGGAGTTGCTTCTGCTCCTGATGCAGTTCCTGTGCCATGAGTTCCTGCGAGGGAACCCACGGGTGACCCGGCTGCTCTCTGAGATGCGCATTCACCTGCTGCCCTCCATGAACCCTGATGGCTATG
AGATCGCCTACCACCGGGGTTCAGAGCTGGTGGGCTGGGCCGAGGGCCGCTGGAACAACCAGAGCATCGATCTTAACCATAATTTTGCTGACCTCAACACACCACTGTGGGAAGCACAGGACGATGGG
AAGGTGCCCCACATCGTCCCCAACCATCACCTGCCATTGCCCACTTACTACACCCTGCCCAATGCCACCGTGGCTCCTGAAACGCGGGCAGTAATCAAGTGGATGAAGCGGATCCCCTTTGTGCTAAG
TGCCAACCTCCACGGGGGTGAGCTCGTGGTGTCCTACCCATTCGACATGACTCGCACCCCGTGGGCTGCCCGCGAGCTCACGCCCACACCAGATGATGCTGTGTTTCGCTGGCTCAGCACTGTCTATG
CTGGCAGTAATCTGGCCATGCAGGACACCAGCCGCCGACCCTGCCACAGCCAGGACTTCTCCGTGCACGGCAACATCATCAACGGGGCTGACTGGCACACGGTCCCCGGGAGCATGAATGACTTCAGC
TACCTACACACCAACTGCTTTGAGGTCACTGTGGAGCTGTCCTGTGACAAGTTCCCTCACGAGAATGAATTGCCCCAGGAGTGGGAGAACAACAAAGACGCCCTCCTCACCTACCTGGAGCAGGTGCG
CATGGGCATTGCAGGAGTGGTGAGGGACAAGGACACGGAGCTTGGGATTGCTGACGCTGTCATTGCCGTGGATGGGATTAACCATGACGTGACCACGGCGTGGGGCGGGGATTATTGGCGTCTGCTGA
CCCCAGGGGACTACATGGTGACTGCCAGTGCCGAGGGCTACCATTCAGTGACACGGAACTGTCGGGTCACCTTTGAAGAGGGCCCCTTCCCCTGCAATTTCGTGCTCACCAAGACTCCCAAACAGAGG
CTGCGCGAGCTGCTGGCAGCTGGGGCCAAGGTGCCCCCGGACCTTCGCAGGCGCCTGGAGCGGCTAAGGGGACAGAAGGATTGATACCTGCGGTTTAAGAGCCCTAGGGCAGGCTGGACCTGTCAAGA
CGGGAAGGGGAAGAGTAGAGAGGGAGGGACAAAGTGAGGAAAAGGTGCTCATTAAAGCTACCGGGCACCTTA

hide sequence


Protein RefSeqs	NP_001171628	(Get FASTA)	NCBI Sequence Viewer
	NP_062555	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63430	(Get FASTA)	NCBI Sequence Viewer
	AAQ89315	(Get FASTA)	NCBI Sequence Viewer
	BAB55275	(Get FASTA)	NCBI Sequence Viewer
	BAC11661	(Get FASTA)	NCBI Sequence Viewer
	BAC11672	(Get FASTA)	NCBI Sequence Viewer
	BAG64246	(Get FASTA)	NCBI Sequence Viewer
	CAJ44941	(Get FASTA)	NCBI Sequence Viewer
	CBF57594	(Get FASTA)	NCBI Sequence Viewer
	EAX10575	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000369979
	ENSP00000369979.2
GenBank Protein	Q96SM3	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062555 ⟸ NM_019609
- Peptide Label:	isoform 1 precursor
- UniProtKB:	Q6UW65 (UniProtKB/Swiss-Prot), Q6P4G8 (UniProtKB/Swiss-Prot), Q9NUB5 (UniProtKB/Swiss-Prot), Q96SM3 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTSEQHVRIRVIKKKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGLESLRVSDS RLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGHPTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVLNLLPEPQVARFIRLLP QTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHHNYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMHGNEALGRELLLLLMQFLCHEFLRG NPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVGWAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAVIKWMKRIPFVLSANLHGGELVVSYPFDMTR TPWAARELTPTPDDAVFRWLSTVYAGSNLAMQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIAD AVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD hide sequence

RefSeq Acc Id:	NP_001171628 ⟸ NM_001184699
- Peptide Label:	isoform 2 precursor
- UniProtKB:	Q96SM3 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTSEQHVRIRVIKKKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGLESLRVSDS RLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGHPTRFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVLNLLPEPQVARFIRLLP QTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHHNYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGEPEVRYVAGMHGNEALGRELLLLLMQFLCHEFLRG NPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVGWAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAVIKWMKRIPFVLSANLHGGMNDFSYLHTNCF EVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAA GAKVPPDLRRRLERLRGQKD hide sequence

Ensembl Acc Id:

ENSP00000369979 ⟸ ENST00000380605

Protein Domains

F5/8 type C Peptidase M14

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q96SM3-F1-model_v2	AlphaFold	Q96SM3	1-734	view protein structure

RGD ID:

6798606

Promoter ID:

HG_KWN:38387

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

Lymphoblastoid, NB4

Transcripts:

ENST00000380605, UC010GAS.1

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	20	2,728,866 - 2,729,547 (-)	MPROMDB

RGD ID:

13206177

Promoter ID:

EPDNEW_H26669

Type:

initiation region

Name:

CPXM1_2

Description:

carboxypeptidase X, M14 family member 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H26675

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	20	2,800,627 - 2,800,687	EPDNEW

Database	Acc Id	Source(s)
COSMIC	CPXM1	COSMIC
Ensembl Genes	ENSG00000088882	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000380605	ENTREZGENE
	ENST00000380605.3	UniProtKB/Swiss-Prot
Gene3D-CATH	Carboxypeptidase-like, regulatory domain	UniProtKB/Swiss-Prot
	Galactose-binding domain-like	UniProtKB/Swiss-Prot
	Zn peptidases	UniProtKB/Swiss-Prot
GTEx	ENSG00000088882	GTEx
HGNC ID	HGNC:15771	ENTREZGENE
Human Proteome Map	CPXM1	Human Proteome Map
InterPro	CarboxyPept-like_regulatory	UniProtKB/Swiss-Prot
	FA58C	UniProtKB/Swiss-Prot
	Galactose-bd-like_sf	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
	Peptidase_M14_domain	UniProtKB/Swiss-Prot
KEGG Report	hsa:56265	UniProtKB/Swiss-Prot
NCBI Gene	56265	ENTREZGENE
OMIM	609555	OMIM
PANTHER	CARBOXYPEPTIDASE X1-RELATED	UniProtKB/Swiss-Prot
	PROTEASE M14 CARBOXYPEPTIDASE	UniProtKB/Swiss-Prot
Pfam	CarboxypepD_reg	UniProtKB/Swiss-Prot
	F5_F8_type_C	UniProtKB/Swiss-Prot
	Peptidase_M14	UniProtKB/Swiss-Prot
PharmGKB	PA162382779	PharmGKB
PRINTS	CRBOXYPTASEA	UniProtKB/Swiss-Prot
PROSITE	CARBOXYPEPT_ZN_1	UniProtKB/Swiss-Prot
	CARBOXYPEPT_ZN_2	UniProtKB/Swiss-Prot
	FA58C_3	UniProtKB/Swiss-Prot
	PEPTIDASE_M14	UniProtKB/Swiss-Prot
SMART	FA58C	UniProtKB/Swiss-Prot
	Zn_pept	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF49464	UniProtKB/Swiss-Prot
	SSF49785	UniProtKB/Swiss-Prot
	Zn-dependent exopeptidases	UniProtKB/Swiss-Prot
UniProt	CPXM1_HUMAN	UniProtKB/Swiss-Prot
	Q6P4G8	ENTREZGENE
	Q6UW65	ENTREZGENE
	Q96SM3	ENTREZGENE
	Q9NUB5	ENTREZGENE
UniProt Secondary	Q6P4G8	UniProtKB/Swiss-Prot
	Q6UW65	UniProtKB/Swiss-Prot
	Q9NUB5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-26	CPXM1	carboxypeptidase X, M14 family member 1		carboxypeptidase X (M14 family), member 1	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar