Symbol:
Csrnp3
Name:
cysteine-serine-rich nuclear protein 3
RGD ID:
1314705
MGI Page
MGI
Description:
Enables DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific DNA binding activity. Involved in positive regulation of apoptotic process and positive regulation of transcription by RNA polymerase II. Located in nucleus. Is expressed in several structures, including central nervous system; gonad; gut; liver; and spleen. Orthologous to human CSRNP3 (cysteine and serine rich nuclear protein 3).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
A330102K23Rik; Csnrp3; CSR; CSRNP-3; cysteine/serine-rich nuclear protein 3; Mbu1; RP23-306G16.1; taip-2; TGF-beta induced apoptosis protein 2; TGF-beta-induced apoptosis protein 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CSRNP3 (cysteine and serine rich nuclear protein 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Csrnp3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Csrnp3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CSRNP3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CSRNP3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Csrnp3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CSRNP3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CSRNP3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Csrnp3 (cysteine and serine rich nuclear protein 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Csrnp3 (cysteine and serine rich nuclear protein 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CSRNP3 (cysteine and serine rich nuclear protein 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
csrnp3 (cysteine-serine-rich nuclear protein 3)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Axud1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
C41D11.3
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 65,675,628 - 65,866,958 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 65,676,111 - 65,861,890 (+) Ensembl GRCm39 Ensembl GRCm38 2 65,845,284 - 66,036,614 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 65,845,767 - 66,031,546 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 65,683,824 - 65,869,603 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 65,646,681 - 65,824,298 (+) NCBI MGSCv36 mm8 Celera 2 67,525,836 - 67,711,310 (+) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 38.79 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Csrnp3 Mouse asphyxiating thoracic dystrophy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Jeune thoracic dystrophy ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21719429|PMID:22495306|PMID:23020937|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28492532|PMID:29068549 Csrnp3 Mouse asphyxiating thoracic dystrophy 1 ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Chondroectodermal dysplasia-like syndrome ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21719429|PMID:22495306|PMID:23020937|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28492532|PMID:29068549 Csrnp3 Mouse benign familial infantile seizures 3 ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Seizures, benign familial infantile, 3 ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse benign familial neonatal epilepsy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Familial neonatal seizures ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse developmental and epileptic encephalopathy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Developmental and epileptic encephalopathy ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18479393|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25253744|PMID:25439579|PMID:25492405|PMID:25524840|PMID:25995458|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse developmental and epileptic encephalopathy 11 ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Complex neurodevelopmental disorder | ClinVar Annotator: match by term: Early more ... ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse early infantile epileptic encephalopathy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Early infantile epileptic encephalopathy ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18479393|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25253744|PMID:25439579|PMID:25492405|PMID:25524840|PMID:25995458|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse epilepsy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Epilepsy ClinVar PMID:25741868 Csrnp3 Mouse generalized epilepsy with febrile seizures plus 7 ISO RGD:1605039 8554872 ClinVar Annotator: match by term: GEFS+, TYPE 7 ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18479393|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25253744|PMID:25439579|PMID:25492405|PMID:25524840|PMID:25995458|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse hereditary sensory and autonomic neuropathy type 2A ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Neuropathy, hereditary sensory and autonomic, type 2A ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18479393|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25253744|PMID:25439579|PMID:25492405|PMID:25524840|PMID:25995458|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse hereditary sensory neuropathy ISO RGD:1605039 8554872 ClinVar Annotator: match by term: NEUROPATHY, HEREDITARY SENSORY RADICULAR, AUTOSOMAL RECESSIVE ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18479393|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21416599|PMID:21692795|PMID:21719429|PMID:22495306|PMID:23016767|PMID:23020937|PMID:23184456|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25253744|PMID:25439579|PMID:25492405|PMID:25524840|PMID:25995458|PMID:26068938|PMID:27491411|PMID:28379373|PMID:28492532|PMID:29068549 Csrnp3 Mouse nephronophthisis ISO RGD:1605039 8554872 ClinVar Annotator: match by term: Nephronophthisis ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21719429|PMID:22495306|PMID:23020937|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28492532|PMID:29068549 Csrnp3 Mouse nephronophthisis 1 ISO RGD:1605039 8554872 ClinVar Annotator: match by term: juvenile nephronophthisis ClinVar PMID:15133511|PMID:16865694|PMID:17347258|PMID:17470132|PMID:17561957|PMID:18327258|PMID:18930999|PMID:19304393|PMID:19400878|PMID:20358599|PMID:20522430|PMID:21068128|PMID:21258341|PMID:21719429|PMID:22495306|PMID:23020937|PMID:23559409|PMID:23662938|PMID:24650168|PMID:24876116|PMID:25492405|PMID:26068938|PMID:27491411|PMID:28492532|PMID:29068549
Only show annotations with direct experimental evidence (0 objects hidden)
Csrnp3 Mouse 17alpha-ethynylestradiol increases expression ISO RGD:1306214 6480464 Ethinyl Estradiol results in increased expression of CSRNP3 mRNA CTD PMID:29097150 Csrnp3 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of CSRNP3 mRNA CTD PMID:25210133 Csrnp3 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CSRNP3 mRNA CTD PMID:24058054 Csrnp3 Mouse 2,3,7,8-Tetrachlorodibenzofuran decreases expression ISO RGD:1306214 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of CSRNP3 mRNA CTD PMID:32109520 Csrnp3 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO RGD:1605039 6480464 2,2',4,4',5-brominated diphenyl ether results in decreased expression of CSRNP3 mRNA CTD PMID:26705709 Csrnp3 Mouse 3-chloropropane-1,2-diol decreases expression ISO RGD:1306214 6480464 alpha-Chlorohydrin results in decreased expression of H3C8 mRNA CTD PMID:28522335 Csrnp3 Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:1306214 6480464 Propylthiouracil results in decreased expression of CSRNP3 mRNA; Propylthiouracil results in decreased expression of H3C7 more ... CTD PMID:24780913|PMID:30047161 Csrnp3 Mouse acetamide increases expression ISO RGD:1306214 6480464 acetamide results in increased expression of CSRNP3 mRNA CTD PMID:31881176 Csrnp3 Mouse aflatoxin B1 increases expression ISO RGD:1306214 6480464 Aflatoxin B1 results in increased expression of CSRNP3 mRNA CTD PMID:33354967 Csrnp3 Mouse all-trans-retinoic acid increases expression ISO RGD:1605039 6480464 Tretinoin results in increased expression of CSRNP3 mRNA CTD PMID:23724009 Csrnp3 Mouse amitrole decreases expression ISO RGD:1306214 6480464 Amitrole results in decreased expression of CSRNP3 mRNA CTD PMID:30047161 Csrnp3 Mouse antirheumatic drug increases expression ISO RGD:1605039 6480464 Antirheumatic Agents results in increased expression of CSRNP3 mRNA CTD PMID:24449571 Csrnp3 Mouse aristolochic acid A decreases expression ISO RGD:1605039 6480464 aristolochic acid I results in decreased expression of CSRNP3 mRNA CTD PMID:33212167 Csrnp3 Mouse arsenite(3-) multiple interactions ISO RGD:1605039 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CSRNP3 mRNA] CTD PMID:32406909 Csrnp3 Mouse atrazine affects methylation ISO RGD:1306214 6480464 Atrazine affects the methylation of CSRNP3 gene CTD PMID:28931070 Csrnp3 Mouse benzo[a]pyrene affects methylation ISO RGD:1605039 6480464 Benzo(a)pyrene affects the methylation of CSRNP3 promoter CTD PMID:27901495 Csrnp3 Mouse bisphenol A affects expression ISO RGD:1306214 6480464 bisphenol A affects the expression of CSRNP3 mRNA CTD PMID:25181051 Csrnp3 Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CSRNP3 mRNA CTD PMID:32156529 Csrnp3 Mouse bisphenol A multiple interactions ISO RGD:1605039 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CSRNP3 gene CTD PMID:31601247 Csrnp3 Mouse bisphenol A increases expression ISO RGD:1605039 6480464 bisphenol A results in increased expression of CSRNP3 mRNA CTD PMID:29275510 Csrnp3 Mouse bisphenol A increases methylation ISO RGD:1306214 6480464 bisphenol A results in increased methylation of CSRNP3 gene CTD PMID:28505145 Csrnp3 Mouse bisphenol A increases expression ISO RGD:1306214 6480464 bisphenol A results in increased expression of CSRNP3 mRNA CTD PMID:29097150|PMID:30816183|PMID:32528016 Csrnp3 Mouse bisphenol F multiple interactions ISO RGD:1605039 6480464 [bisphenol F co-treated with Fulvestrant] results in increased methylation of CSRNP3 gene CTD PMID:31601247 Csrnp3 Mouse cobalt dichloride increases expression ISO RGD:1306214 6480464 cobaltous chloride results in increased expression of H3C7 mRNA CTD PMID:24386269 Csrnp3 Mouse copper atom multiple interactions ISO RGD:1605039 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CSRNP3 mRNA CTD PMID:20971185 Csrnp3 Mouse copper(0) multiple interactions ISO RGD:1605039 6480464 [NSC 689534 binds to Copper] which results in decreased expression of CSRNP3 mRNA CTD PMID:20971185 Csrnp3 Mouse cyclosporin A decreases expression ISO RGD:1605039 6480464 Cyclosporine results in decreased expression of CSRNP3 mRNA CTD PMID:20106945 Csrnp3 Mouse DDT increases methylation ISO RGD:1306214 6480464 DDT results in increased methylation of CSRNP3 gene CTD PMID:30207508 Csrnp3 Mouse dibutyl phthalate increases expression ISO RGD:1306214 6480464 Dibutyl Phthalate results in increased expression of CSRNP3 mRNA CTD PMID:21266533 Csrnp3 Mouse diclofenac increases expression ISO RGD:1306214 6480464 Diclofenac results in increased expression of CSRNP3 mRNA CTD PMID:30723492 Csrnp3 Mouse diuron increases expression ISO RGD:1306214 6480464 Diuron results in increased expression of H3C7 mRNA CTD PMID:25152437 Csrnp3 Mouse dorsomorphin multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Csrnp3 Mouse doxorubicin decreases expression ISO RGD:1605039 6480464 Doxorubicin results in decreased expression of CSRNP3 mRNA CTD PMID:29803840 Csrnp3 Mouse entinostat multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Csrnp3 Mouse entinostat decreases expression ISO RGD:1605039 6480464 entinostat results in decreased expression of CSRNP3 mRNA CTD PMID:26272509 Csrnp3 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of CSRNP3 mRNA CTD PMID:30319688 Csrnp3 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of CSRNP3 mRNA CTD PMID:25629700 Csrnp3 Mouse fulvestrant multiple interactions ISO RGD:1605039 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of CSRNP3 gene; [bisphenol F co-treated more ... CTD PMID:31601247 Csrnp3 Mouse fulvestrant increases methylation ISO RGD:1605039 6480464 Fulvestrant results in increased methylation of CSRNP3 gene CTD PMID:31601247 Csrnp3 Mouse furan decreases expression ISO RGD:1306214 6480464 furan results in decreased expression of CSRNP3 mRNA CTD PMID:26194646 Csrnp3 Mouse hydroquinone decreases expression ISO RGD:1605039 6480464 hydroquinone results in decreased expression of CSRNP3 mRNA CTD PMID:31256213 Csrnp3 Mouse lead(0) affects expression ISO RGD:1605039 6480464 Lead affects the expression of CSRNP3 mRNA CTD PMID:28903495 Csrnp3 Mouse methimazole decreases expression ISO RGD:1306214 6480464 Methimazole results in decreased expression of CSRNP3 mRNA CTD PMID:30047161 Csrnp3 Mouse methylmercury chloride decreases expression ISO RGD:1605039 6480464 methylmercuric chloride results in decreased expression of CSRNP3 mRNA CTD PMID:26272509|PMID:28001369 Csrnp3 Mouse methylmercury chloride multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Csrnp3 Mouse N-methyl-4-phenylpyridinium decreases expression ISO RGD:1605039 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of CSRNP3 mRNA CTD PMID:24810058 Csrnp3 Mouse nickel atom decreases expression ISO RGD:1605039 6480464 Nickel results in decreased expression of CSRNP3 mRNA CTD PMID:25583101 Csrnp3 Mouse okadaic acid decreases expression ISO RGD:1605039 6480464 Okadaic Acid results in decreased expression of CSRNP3 mRNA CTD PMID:38832940 Csrnp3 Mouse oxaliplatin multiple interactions ISO RGD:1306214 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of H3C7 mRNA CTD PMID:25729387 Csrnp3 Mouse panobinostat multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Csrnp3 Mouse paracetamol decreases expression ISO RGD:1605039 6480464 Acetaminophen results in decreased expression of CSRNP3 mRNA CTD PMID:29067470 Csrnp3 Mouse pirinixic acid multiple interactions EXP 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Csrnp3 Mouse SB 431542 multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ... CTD PMID:27188386 Csrnp3 Mouse Soman increases expression ISO RGD:1306214 6480464 Soman results in increased expression of CSRNP3 mRNA CTD PMID:19281266 Csrnp3 Mouse sulfadimethoxine decreases expression ISO RGD:1306214 6480464 Sulfadimethoxine results in decreased expression of CSRNP3 mRNA CTD PMID:30047161 Csrnp3 Mouse sunitinib decreases expression ISO RGD:1605039 6480464 Sunitinib results in decreased expression of CSRNP3 mRNA CTD PMID:31533062 Csrnp3 Mouse topotecan multiple interactions ISO RGD:1306214 6480464 [Oxaliplatin co-treated with Topotecan] results in increased expression of H3C7 mRNA CTD PMID:25729387 Csrnp3 Mouse topotecan increases expression ISO RGD:1306214 6480464 Topotecan results in increased expression of H3C7 mRNA CTD PMID:25729387 Csrnp3 Mouse torcetrapib increases expression ISO RGD:1605039 6480464 torcetrapib results in increased expression of CSRNP3 mRNA CTD PMID:23228038 Csrnp3 Mouse trichostatin A decreases expression ISO RGD:1605039 6480464 trichostatin A results in decreased expression of CSRNP3 mRNA CTD PMID:26272509 Csrnp3 Mouse trichostatin A multiple interactions ISO RGD:1605039 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Csrnp3 Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of CSRNP3 mRNA CTD PMID:33045310 Csrnp3 Mouse valproic acid decreases expression ISO RGD:1605039 6480464 Valproic Acid results in decreased expression of CSRNP3 mRNA CTD PMID:23179753|PMID:28001369 Csrnp3 Mouse valproic acid decreases expression ISO RGD:1306214 6480464 Valproic Acid results in decreased expression of CSRNP3 mRNA CTD PMID:29427782 Csrnp3 Mouse valproic acid affects splicing ISO RGD:1306214 6480464 Valproic Acid affects the splicing of CSRNP3 mRNA CTD PMID:29427782 Csrnp3 Mouse valproic acid affects expression ISO RGD:1605039 6480464 Valproic Acid affects the expression of CSRNP3 mRNA CTD PMID:25979313 Csrnp3 Mouse valproic acid decreases methylation ISO RGD:1605039 6480464 Valproic Acid results in decreased methylation of CSRNP3 gene CTD PMID:29154799 Csrnp3 Mouse vinclozolin affects expression ISO RGD:1306214 6480464 vinclozolin affects the expression of CSRNP3 mRNA CTD PMID:19015723
17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3-chloropropane-1,2-diol (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) cyclosporin A (ISO) DDT (ISO) dibutyl phthalate (ISO) diclofenac (ISO) diuron (ISO) dorsomorphin (ISO) doxorubicin (ISO) entinostat (ISO) ethanol (EXP) folic acid (EXP) fulvestrant (ISO) furan (ISO) hydroquinone (ISO) lead(0) (ISO) methimazole (ISO) methylmercury chloride (ISO) N-methyl-4-phenylpyridinium (ISO) nickel atom (ISO) okadaic acid (ISO) oxaliplatin (ISO) panobinostat (ISO) paracetamol (ISO) pirinixic acid (EXP) SB 431542 (ISO) Soman (ISO) sulfadimethoxine (ISO) sunitinib (ISO) topotecan (ISO) torcetrapib (ISO) trichostatin A (ISO) triptonide (EXP) valproic acid (ISO) vinclozolin (ISO)
Csrnp3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 65,675,628 - 65,866,958 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 65,676,111 - 65,861,890 (+) Ensembl GRCm39 Ensembl GRCm38 2 65,845,284 - 66,036,614 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 65,845,767 - 66,031,546 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 65,683,824 - 65,869,603 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 65,646,681 - 65,824,298 (+) NCBI MGSCv36 mm8 Celera 2 67,525,836 - 67,711,310 (+) NCBI Celera Cytogenetic Map 2 C1.3 NCBI cM Map 2 38.79 NCBI
CSRNP3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 165,469,698 - 165,689,407 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 165,469,647 - 165,689,407 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 166,326,208 - 166,545,917 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 166,137,136 - 166,245,458 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 2 159,936,725 - 160,155,865 (+) NCBI Celera Cytogenetic Map 2 q24.3 NCBI HuRef 2 158,208,131 - 158,427,753 (+) NCBI HuRef CHM1_1 2 166,331,798 - 166,552,214 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 165,926,990 - 166,146,740 (+) NCBI T2T-CHM13v2.0
Csrnp3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 70,906,587 - 71,102,596 (+) NCBI GRCr8 mRatBN7.2 3 50,498,379 - 50,695,598 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 50,498,633 - 50,685,950 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 53,849,858 - 54,029,207 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 62,433,474 - 62,612,826 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 60,209,518 - 60,388,863 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 51,883,559 - 52,120,290 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 51,883,559 - 52,120,290 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 58,517,979 - 58,753,059 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 47,877,014 - 47,972,981 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 3 47,773,070 - 47,870,041 (+) NCBI Celera 3 50,091,668 - 50,271,757 (+) NCBI Celera Cytogenetic Map 3 q21 NCBI
Csrnp3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955449 8,460,577 - 8,635,417 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955449 8,450,292 - 8,635,393 (-) NCBI ChiLan1.0 ChiLan1.0
CSRNP3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 68,130,375 - 68,348,373 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 68,145,368 - 68,363,348 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 52,744,717 - 52,962,741 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 170,103,604 - 170,311,348 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 170,122,687 - 170,311,348 (+) Ensembl panpan1.1 panPan2
CSRNP3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 36 10,664,555 - 10,863,366 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 36 10,664,365 - 10,850,520 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 36 10,809,377 - 10,998,552 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 36 10,798,782 - 10,988,138 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 36 10,815,759 - 10,988,367 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 36 10,880,583 - 11,069,834 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 36 10,852,565 - 11,042,335 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 36 10,965,349 - 11,154,675 (+) NCBI UU_Cfam_GSD_1.0
Csrnp3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 127,844,785 - 127,988,598 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936469 13,631,182 - 13,770,257 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936469 13,628,830 - 13,808,970 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CSRNP3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 72,141,621 - 72,233,832 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 72,040,854 - 72,242,269 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 80,471,002 - 80,672,885 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CSRNP3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 50,967,138 - 51,184,378 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 51,073,480 - 51,182,389 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 148,332,089 - 148,543,145 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Csrnp3
.
Predicted Target Of
Count of predictions: 4930 Count of miRNA genes: 958 Interacting mature miRNAs: 1415 Transcripts: ENSMUST00000053910, ENSMUST00000112394, ENSMUST00000112397, ENSMUST00000122912, ENSMUST00000129133, ENSMUST00000139896, ENSMUST00000145598, ENSMUST00000176109 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
13464141 Hbbcq3_m hemoglobin concentration QTL 3 (mouse) 2 52448019 86448136 Mouse 8552707 Cia23_m collagen induced arthritis QTL 23 (mouse) Not determined 2 12129537 66556453 Mouse 13824983 Vclq1_m curvilinear velocity QTL 1 (mouse) 2 61830344 136841920 Mouse 1301402 Ap2q_m alcohol preference 2 QTL (mouse) Not determined 2 43520612 77520756 Mouse 4142133 Pbwg1.6_m postnatal body weight growth 1.6 (mouse) Not determined 35797324 69797406 Mouse 1300761 Lgth1_m body length 1 (mouse) Not determined 2 51703276 85703425 Mouse 4141236 Hbnr5_m Heligmosomoides bakeri nematode resistance 5 (mouse) Not determined 31214567 105143570 Mouse 1302174 Dssc2_m dextran sodium sulfate induced colitis QTL2 (mouse) Not determined 2 24224632 148700377 Mouse 1301405 Etohr_m ethanol response acute (mouse) Not determined 2 63005954 97006113 Mouse 1558915 W3q1_m weight 3 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1300875 Taste1_m taste-saccharin preference 1 (mouse) Not determined 2 50923175 84923278 Mouse 1301769 Orgwq2_m organ weight QTL 2 (mouse) Not determined 2 3887126 93421651 Mouse 1357454 Kidq1_m kidney weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357577 Trmq3_m T cell ratio modifier QTL 3 (mouse) Not determined 2 60520612 119355518 Mouse 1558966 W10q9_m weight 10 weeks QTL 9 (mouse) Not determined 2 20897778 118894840 Mouse 4141854 T2dm2sa_m type 2 diabetes mellitus 2 in SMXA RI mice (mouse) Not determined 2 29307947 148374934 Mouse 13432174 Actres5_m activity response to ethanol/saline 5 (mouse) 2 59892287 69792287 Mouse 1300662 Etohila_m ethanol induced locomotor activity (mouse) Not determined 2 63005954 97006113 Mouse 1300788 Cia2_m collagen induced arthritis QTL 2 (mouse) Not determined 2 43520612 77520756 Mouse 10053681 Lith24_m lithogenic gene 24 (mouse) Not determined 2 63005954 97006113 Mouse 1301048 Actre2_m activity response to ethanol 2 (mouse) Not determined 2 63005954 97006113 Mouse 1300671 Cia4_m collagen induced arthritis QTL 4 (mouse) Not determined 2 43520612 77520756 Mouse 1357881 Estoq1_m embryo survival total QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 5491197 Mobq5_m multigenic obesity QTL 5 (mouse) Not determined 2 65269746 162518926 Mouse 1301411 Pitm1_m prion incubation time 1 (mouse) Not determined 2 43520612 77520756 Mouse 4141069 Pbwg1.5_m postnatal body weight growth 1.5 (mouse) Not determined 43520612 77520756 Mouse 1558820 Moo1_m modifier of Odc1 (mouse) Not determined 17 48269746 82269934 Mouse 13432184 Actdes1_m activity chamber total difference ethanol/saline 1 (mouse) 2 59392287 69292287 Mouse 13506939 Pbwg1.12_m postnatal body weight growth 1.12 (mouse) 2 65132412 68703425 Mouse 1300645 Alcp1_m alcohol preference locus 1 (mouse) Not determined 2 45228128 67838868 Mouse 4141186 Pbwg1.8_m postnatal body weight growth 1.8 (mouse) Not determined 35797324 69797406 Mouse 13432178 Actres2_m activity response to ethanol/saline 2 (mouse) 2 60692287 74092287 Mouse 12738429 Lfibq18_m liver fibrosis QTL 18 (mouse) 2 57919991 91919991 Mouse 39128209 Lwq14_m liver weight QTL 14 (mouse) 2 20897778 118894840 Mouse 1558738 W6q1_m weight 6 weeks QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 11038703 Ltpr1_m Leishmania tropica response 1 (mouse) 2 39971665 73971811 Mouse 1300568 Hdl1_m high density lipoprotein (HDL) level 1 (mouse) Not determined 2 48269746 82269934 Mouse 1559001 Eae33_m experimental allergic encephalomyelitis susceptibility 33 (mouse) Not determined 2 35991679 71609412 Mouse 4142447 Pbwg1.7_m postnatal body weight growth 1.7 (mouse) Not determined 35797324 69797406 Mouse 1301703 Bomd3_m bone mineral density 3 (mouse) Not determined 2 63005954 97006113 Mouse 10449151 Hdl8_m high density lipoprotein (HDL) level 8 (mouse) 2 38129725 67072607 Mouse 1301747 Eae21_m experimental allergic encephalomyelitis 21 (mouse) Not determined 2 48269746 82269934 Mouse 1301235 Alcw4_m alcohol withdrawal 4 (mouse) Not determined 2 48269746 82269934 Mouse 10449150 Pvldlc1_m plasma VLDL-cholesterol 1 (mouse) 2 38129725 67072607 Mouse 4141406 Alpq2_m alcohol preference QTL 2 (mouse) Not determined 2 57524117 91524288 Mouse 10755526 Lymph1_m lymphocyte differential 1 (mouse) 2 50819314 84819314 Mouse 13463471 Hctq6_m hematocrit QTL 6 (mouse) 2 52448019 86448136 Mouse 1301873 Hsl1_m hyperoxia susceptibility locus 1 (mouse) Not determined 2 63570154 97570301 Mouse 1558899 Egq1_m early growth QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 1357681 Hrtq1_m heart weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10449145 Lanq1_m lanosterol level QTL 1 (mouse) 2 38129725 67072607 Mouse 1301109 Dntcs2_m dental caries susceptibility 2 (mouse) Not determined 2 40885493 114910165 Mouse 1357436 Splq1_m spleen weight QTL 1 (mouse) Not determined 2 20897778 118894840 Mouse 10755532 Lymph5_m lymphocyte differential 5 (mouse) 2 44199017 78199017 Mouse 11532740 Pbwg1.10_m postnatal body weight growth 1.10 (mouse) 2 48132412 82132495 Mouse 1300577 Capsq1_m capsaicin sensitivity related QTL 1 (mouse) Not determined 2 27602060 84013384 Mouse 1301344 Lith1_m lithogenic gene 1 (mouse) Not determined 2 45347635 145312647 Mouse 1301480 Pbwg1_m postnatal body weight growth 1 (mouse) Not determined 2 41820719 75820843 Mouse 10044002 Hdl7_m HDL level 7 (mouse) Not determined 2 63005954 97006113 Mouse
A330102K23Rik
Mouse Assembly Chr Position (strand) Source JBrowse cM Map 2 UniSTS cM Map 2 UniSTS cM Map 2 UniSTS
Csrnp3
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 C1.3 UniSTS
A330102K23Rik
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 C1.3 UniSTS
A330102K23Rik
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 2 C1.3 UniSTS cM Map 2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000053910 ⟹ ENSMUSP00000055719
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,676,186 - 65,855,950 (+) Ensembl GRCm38.p6 Ensembl 2 65,845,842 - 66,025,606 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112394 ⟹ ENSMUSP00000108013
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,779,293 - 65,853,397 (+) Ensembl GRCm38.p6 Ensembl 2 65,948,949 - 66,023,053 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112397 ⟹ ENSMUSP00000135151
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,676,199 - 65,853,623 (+) Ensembl GRCm38.p6 Ensembl 2 65,845,855 - 66,023,279 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000122912 ⟹ ENSMUSP00000117533
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,676,111 - 65,861,890 (+) Ensembl GRCm38.p6 Ensembl 2 65,845,767 - 66,031,546 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000129133
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,690,941 - 65,779,783 (+) Ensembl GRCm38.p6 Ensembl 2 65,860,597 - 65,949,439 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000139896
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,676,189 - 65,709,162 (+) Ensembl GRCm38.p6 Ensembl 2 65,845,845 - 65,878,818 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000145598 ⟹ ENSMUSP00000135605
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,762,209 - 65,853,828 (+) Ensembl GRCm38.p6 Ensembl 2 65,931,865 - 66,023,484 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000176109 ⟹ ENSMUSP00000135019
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 65,760,481 - 65,854,290 (+) Ensembl GRCm38.p6 Ensembl 2 65,930,137 - 66,023,946 (+) Ensembl
RefSeq Acc Id:
NM_001290665 ⟹ NP_001277594
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,762,209 - 65,861,890 (+) NCBI GRCm38 2 65,931,865 - 66,031,546 (+) NCBI Celera 2 67,525,836 - 67,711,310 (+) NCBI
Sequence:
GCGGGTCCGGGTGCTCCAGGATGCAGGTACCCTGGGCGAACTGCAGCTCCACAATTCCTTACCCAGCATTCCGCTTTGGCTGCTGGAGCACTGCCTGAACCTTATGCAAATGAGAGCAGCACAGGCTT
hide sequence
RefSeq Acc Id:
NM_001290666 ⟹ NP_001277595
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,111 - 65,861,890 (+) NCBI GRCm38 2 65,845,767 - 66,031,546 (+) NCBI Celera 2 67,525,836 - 67,711,310 (+) NCBI
Sequence:
GGAGGACGCCAGGATCTGGCTTTTGTTATTGGTTGGCTGCGGCCTGATGGATGAAGGGCGGAGT
hide sequence
RefSeq Acc Id:
NM_153409 ⟹ NP_700458
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,111 - 65,861,890 (+) NCBI GRCm38 2 65,845,767 - 66,031,546 (+) ENTREZGENE MGSCv37 2 65,683,824 - 65,869,603 (+) RGD Celera 2 67,525,836 - 67,711,310 (+) RGD cM Map 2 ENTREZGENE
Sequence:
GGAGGACGCCAGGATCTGGCTTTTGTTATTGGTTGGCTGCGGCCTGATGGATGAAGGGCGGAGTGAGCTCTTCTCAGTGTGTTCTGCTGGAGCCCAAGTACAGAGACCATATTTACAGGTCCATGTGA
hide sequence
RefSeq Acc Id:
NM_178634 ⟹ NP_848749
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,111 - 65,861,890 (+) NCBI GRCm38 2 65,845,767 - 66,031,546 (+) ENTREZGENE MGSCv37 2 65,683,824 - 65,869,603 (+) RGD Celera 2 67,525,836 - 67,711,310 (+) RGD cM Map 2 ENTREZGENE
Sequence:
GGAGGACGCCAGGATCTGGCTTTTGTTATTGGTTGGCTGCGGCCTGATGGATGAAGGGCGGAGT
hide sequence
RefSeq Acc Id:
XM_030252233 ⟹ XP_030108093
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,675,628 - 65,866,958 (+) NCBI GRCm38 2 65,845,284 - 66,036,614 (+) NCBI
Sequence:
GTATTCTGCTGATCTGGCCCCAGAACTATGAATAGAAACACTGCCAAGCAGAGGTTGTCATGTCACCAGTAAGAGATGTCATGCTTGATTCATTTCCCTTGGATCCTTTGAAAAGGCAATATTGATGG
hide sequence
RefSeq Acc Id:
XM_030252234 ⟹ XP_030108094
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,675,682 - 65,866,958 (+) NCBI GRCm38 2 65,845,338 - 66,036,614 (+) NCBI
Sequence:
TTGTCATGTCACCAGTAAGAGATGTCATGCTTGATTCATTTCCCTTGGATCCTTTGAAAAGGCA
hide sequence
RefSeq Acc Id:
XM_030252235 ⟹ XP_030108095
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,048 - 65,866,958 (+) NCBI GRCm38 2 65,845,704 - 66,036,614 (+) NCBI
Sequence:
TTGTCCTCTAAAAGCTCGAGGTGGGAGGGAGCAAGGACTGAGAGCAGGCAGGCGGCAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_030252236 ⟹ XP_030108096
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,048 - 65,866,958 (+) NCBI GRCm38 2 65,845,704 - 66,036,614 (+) NCBI
Sequence:
TTGTCCTCTAAAAGCTCGAGGTGGGAGGGAGCAAGGACTGAGAGCAGGCAGGCGGCAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_030252237 ⟹ XP_030108097
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,048 - 65,866,958 (+) NCBI GRCm38 2 65,845,704 - 66,036,614 (+) NCBI
Sequence:
TTGTCCTCTAAAAGCTCGAGGTGGGAGGGAGCAAGGACTGAGAGCAGGCAGGCGGCAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_036162720 ⟹ XP_036018613
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 65,676,048 - 65,866,958 (+) NCBI
Sequence:
TTGTCCTCTAAAAGCTCGAGGTGGGAGGGAGCAAGGACTGAGAGCAGGCAGGCGGCAAGAGCTG
hide sequence
RefSeq Acc Id:
NP_700458 ⟸ NM_153409
- Peptide Label:
isoform a
- UniProtKB:
Q8BUT9 (UniProtKB/Swiss-Prot), A3F6Q4 (UniProtKB/Swiss-Prot), Q8BYL1 (UniProtKB/Swiss-Prot), P59055 (UniProtKB/Swiss-Prot)
- Sequence:
MRSQGTCDNAAAMSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTPSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERL
hide sequence
RefSeq Acc Id:
NP_848749 ⟸ NM_178634
- Peptide Label:
isoform a
- UniProtKB:
Q8BUT9 (UniProtKB/Swiss-Prot), A3F6Q4 (UniProtKB/Swiss-Prot), Q8BYL1 (UniProtKB/Swiss-Prot), P59055 (UniProtKB/Swiss-Prot)
- Sequence:
MRSQGTCDNAAAMSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTPSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERL
hide sequence
RefSeq Acc Id:
NP_001277595 ⟸ NM_001290666
- Peptide Label:
isoform c
- UniProtKB:
Q7TNU4 (UniProtKB/TrEMBL)
- Sequence:
MWTPPHHAPLLGNRMMKSPAAKVLTAGIASIHPPQITSPMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVDEKHELRAIRLSREDCGCDCRVFCDPETC
hide sequence
RefSeq Acc Id:
NP_001277594 ⟸ NM_001290665
- Peptide Label:
isoform b
- UniProtKB:
P59055 (UniProtKB/Swiss-Prot)
- Sequence:
MSGILKRKFEDVDASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTPSSILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREE
hide sequence
RefSeq Acc Id:
XP_030108093 ⟸ XM_030252233
- Peptide Label:
isoform X1
- UniProtKB:
Q8BUT9 (UniProtKB/Swiss-Prot), P59055 (UniProtKB/Swiss-Prot), A3F6Q4 (UniProtKB/Swiss-Prot), Q8BYL1 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030108094 ⟸ XM_030252234
- Peptide Label:
isoform X1
- UniProtKB:
Q8BUT9 (UniProtKB/Swiss-Prot), P59055 (UniProtKB/Swiss-Prot), A3F6Q4 (UniProtKB/Swiss-Prot), Q8BYL1 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_030108095 ⟸ XM_030252235
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_030108097 ⟸ XM_030252237
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_030108096 ⟸ XM_030252236
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSMUSP00000135605 ⟸ ENSMUST00000145598
Ensembl Acc Id:
ENSMUSP00000135151 ⟸ ENSMUST00000112397
Ensembl Acc Id:
ENSMUSP00000108013 ⟸ ENSMUST00000112394
Ensembl Acc Id:
ENSMUSP00000055719 ⟸ ENSMUST00000053910
Ensembl Acc Id:
ENSMUSP00000117533 ⟸ ENSMUST00000122912
Ensembl Acc Id:
ENSMUSP00000135019 ⟸ ENSMUST00000176109
RefSeq Acc Id:
XP_036018613 ⟸ XM_036162720
- Peptide Label:
isoform X2
RGD ID: 6831083 Promoter ID: MM_KWN:29461 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain Transcripts: NM_178634, OTTMUST00000031210, OTTMUST00000031311, OTTMUST00000031313 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 65,683,516 - 65,684,016 (+) MPROMDB
RGD ID: 6830658 Promoter ID: MM_KWN:29465 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Kidney Transcripts: OTTMUST00000031316, UC008JWS.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 65,769,711 - 65,770,211 (+) MPROMDB
RGD ID: 6877454 Promoter ID: EPDNEW_M2178 Type: multiple initiation site Name: Csrnp3_1 Description: Mus musculus cysteine-serine-rich nuclear protein 3 , transcriptvariant 2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 65,845,842 - 65,845,902 EPDNEW
