Advanced Search (OLGA)

Gene: Csrnp3 (cysteine and serine rich nuclear protein 3) Rattus norvegicus

Analyze

Symbol:

Csrnp3

Name:

cysteine and serine rich nuclear protein 3

RGD ID:

1306214

Description:

Predicted to enable DNA-binding transcription activator activity, RNA polymerase II-specific and sequence-specific DNA binding activity. Predicted to be involved in positive regulation of apoptotic process and positive regulation of transcription by RNA polymerase II. Predicted to be active in nucleus. Orthologous to human CSRNP3 (cysteine and serine rich nuclear protein 3); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-Tetrachlorodibenzofuran; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Csnrp3; cysteine-serine-rich nuclear protein 3; cysteine/serine-rich nuclear protein 3; LOC311093; RGD1306214; similar to TGF-beta induced apotosis protein 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	70,906,587 - 71,102,596 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	70,906,380 - 71,094,009 (+)	Ensembl				GRCr8
mRatBN7.2	3	50,498,379 - 50,695,598 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	50,498,633 - 50,685,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	53,849,858 - 54,029,207 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	62,433,474 - 62,612,826 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	60,209,518 - 60,388,863 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	51,883,559 - 52,120,290 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	51,883,559 - 52,120,290 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	58,517,979 - 58,753,059 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	47,877,014 - 47,972,981 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	50,091,668 - 50,271,757 (+)	NCBI		Celera
RGSC_v3.1	3	47,773,070 - 47,870,041 (+)	NCBI
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asphyxiating thoracic dystrophy (ISO)

benign familial infantile seizures 3 (ISO)

developmental and epileptic encephalopathy (ISO)

epilepsy (ISO)

hereditary sensory and autonomic neuropathy type 2A (ISO)

Spontaneous Abortions (ISO)

substance-related disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-chloropropane-1,2-diol (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

DDT (EXP)

dibutyl phthalate (EXP)

diclofenac (EXP)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

hydroquinone (ISO)

lead(0) (ISO)

methimazole (EXP)

methylmercury chloride (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel atom (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

panobinostat (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

SB 431542 (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

sunitinib (ISO)

topotecan (EXP)

torcetrapib (ISO)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

positive regulation of apoptotic process (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

regulation of transcription by RNA polymerase II (IBA)

Cellular Component

nucleus (IBA,IEA,ISO)

Molecular Function

DNA-binding transcription activator activity, RNA polymerase II-specific (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (IBA)

sequence-specific DNA binding (IBA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:17726538	PMID:18291095	PMID:19389623

Genomics

Comparative Map Data

Csrnp3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	70,906,587 - 71,102,596 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	70,906,380 - 71,094,009 (+)	Ensembl				GRCr8
mRatBN7.2	3	50,498,379 - 50,695,598 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	50,498,633 - 50,685,950 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	53,849,858 - 54,029,207 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	62,433,474 - 62,612,826 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	60,209,518 - 60,388,863 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	51,883,559 - 52,120,290 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	51,883,559 - 52,120,290 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	58,517,979 - 58,753,059 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	47,877,014 - 47,972,981 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	50,091,668 - 50,271,757 (+)	NCBI		Celera
RGSC_v3.1	3	47,773,070 - 47,870,041 (+)	NCBI
Cytogenetic Map	3	q21	NCBI

CSRNP3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	165,469,698 - 165,689,407 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	165,469,647 - 165,689,407 (+)	Ensembl			hg38	GRCh38
GRCh37	2	166,326,208 - 166,545,917 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	166,137,136 - 166,245,458 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	2	159,936,725 - 160,155,865 (+)	NCBI		Celera
Cytogenetic Map	2	q24.3	NCBI
HuRef	2	158,208,131 - 158,427,753 (+)	NCBI		HuRef
CHM1_1	2	166,331,798 - 166,552,214 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	165,926,990 - 166,146,740 (+)	NCBI		T2T-CHM13v2.0

Csrnp3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	65,675,628 - 65,866,958 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	65,676,111 - 65,861,890 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	65,845,284 - 66,036,614 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	65,845,767 - 66,031,546 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	65,683,824 - 65,869,603 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	65,646,681 - 65,824,298 (+)	NCBI		MGSCv36	mm8
Celera	2	67,525,836 - 67,711,310 (+)	NCBI		Celera
Cytogenetic Map	2	C1.3	NCBI
cM Map	2	38.79	NCBI

Csrnp3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	8,460,577 - 8,635,417 (-)	Ensembl
ChiLan1.0	NW_004955449	8,450,292 - 8,635,393 (-)	NCBI	ChiLan1.0	ChiLan1.0

CSRNP3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	68,130,375 - 68,348,373 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	68,145,368 - 68,363,348 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	52,744,717 - 52,962,741 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	170,103,604 - 170,311,348 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	170,122,687 - 170,311,348 (+)	Ensembl			panPan2	panpan1.1

CSRNP3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	10,664,555 - 10,863,366 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	10,664,365 - 10,850,520 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	10,809,377 - 10,998,552 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	10,798,782 - 10,988,138 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	10,815,759 - 10,988,367 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	10,880,583 - 11,069,834 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	10,852,565 - 11,042,335 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	10,965,349 - 11,154,675 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Csrnp3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	127,844,785 - 127,988,598 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	13,631,182 - 13,770,257 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	13,628,830 - 13,808,970 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CSRNP3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	72,141,621 - 72,233,832 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	72,040,854 - 72,242,269 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	80,471,002 - 80,672,885 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CSRNP3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	50,967,138 - 51,184,378 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	51,073,480 - 51,182,389 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	148,332,089 - 148,543,145 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Csrnp3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	3,308,484 - 3,500,852 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624787	3,308,502 - 3,506,450 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Csrnp3
2605 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	101
Interacting mature miRNAs:	103
Transcripts:	ENSRNOT00000007197
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	59863663	73704481	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	58601291	71157804	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

D3Rat43

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	70,942,317 - 70,942,625 (+)	Marker Load Pipeline
mRatBN7.2	3	50,534,264 - 50,534,572 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	51,919,538 - 51,919,845	NCBI	Rnor6.0
Rnor_5.0	3	58,554,011 - 58,554,318	UniSTS	Rnor5.0
RGSC_v3.4	3	47,821,522 - 47,821,830	RGD	RGSC3.4
RGSC_v3.4	3	47,821,523 - 47,821,830	UniSTS	RGSC3.4
Celera	3	50,127,223 - 50,127,530	UniSTS
RGSC_v3.1	3	47,717,895 - 47,718,202	RGD
RH 3.4 Map	3	622.5	UniSTS
RH 3.4 Map	3	622.5	RGD
RH 2.0 Map	3	401.2	RGD
SHRSP x BN Map	3	35.0198	RGD
Cytogenetic Map	3	q21	UniSTS

AU046972

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	50,531,350 - 50,531,440 (+)	MAPPER	mRatBN7.2
mRatBN7.2	3	50,530,114 - 50,531,440 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	51,916,624 - 51,916,713	NCBI	Rnor6.0
Rnor_6.0	3	51,915,388 - 51,916,713	NCBI	Rnor6.0
Rnor_5.0	3	58,551,097 - 58,551,186	UniSTS	Rnor5.0
Rnor_5.0	3	58,549,861 - 58,551,186	UniSTS	Rnor5.0
RGSC_v3.4	3	47,818,609 - 47,818,698	UniSTS	RGSC3.4
RGSC_v3.4	3	47,817,373 - 47,818,698	UniSTS	RGSC3.4
Celera	3	50,123,073 - 50,124,398	UniSTS
Celera	3	50,124,309 - 50,124,398	UniSTS
Cytogenetic Map	3	q21	UniSTS

AU046874

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	20,314,057 - 20,314,228 (+)	MAPPER	mRatBN7.2
mRatBN7.2	16	20,314,057 - 20,314,228 (-)	MAPPER	mRatBN7.2
Rnor_6.0	16	21,916,738 - 21,916,908	NCBI	Rnor6.0
Rnor_6.0	3	52,067,014 - 52,067,184	NCBI	Rnor6.0
Rnor_5.0	16	21,829,705 - 21,829,875	UniSTS	Rnor5.0
Rnor_5.0	3	58,700,774 - 58,700,944	UniSTS	Rnor5.0
Celera	16	20,116,859 - 20,117,037	UniSTS
Cytogenetic Map	3	q21	UniSTS

AU049744

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	20,344,700 - 20,344,872 (-)	MAPPER	mRatBN7.2
mRatBN7.2	16	20,344,700 - 20,344,872 (+)	MAPPER	mRatBN7.2
mRatBN7.2	16	20,134,574 - 20,134,742 (-)	MAPPER	mRatBN7.2
Rnor_6.0	3	52,048,683 - 52,048,852	NCBI	Rnor6.0
Rnor_6.0	16	21,884,634 - 21,884,801	NCBI	Rnor6.0
Rnor_5.0	3	58,681,470 - 58,681,639	UniSTS	Rnor5.0
Rnor_5.0	16	21,797,504 - 21,797,671	UniSTS	Rnor5.0
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	11	59	165	91	90	59	56	59	6	311	147	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271225	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104837	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104840	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211767	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007197 ⟹ ENSRNOP00000007197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	70,906,686 - 71,094,008 (+)	Ensembl
mRatBN7.2 Ensembl	3	50,498,633 - 50,685,950 (+)	Ensembl
Rnor_6.0 Ensembl	3	51,883,559 - 52,120,290 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000128807 ⟹ ENSRNOP00000106784

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	70,906,380 - 71,094,009 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000139072 ⟹ ENSRNOP00000105543

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	70,998,535 - 71,093,804 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000140101 ⟹ ENSRNOP00000099288

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	70,906,635 - 71,094,009 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165994 ⟹ ENSRNOP00000109998

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	71,050,079 - 71,094,009 (+)	Ensembl

RefSeq Acc Id:

NM_001271225 ⟹ NP_001258154

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	70,906,686 - 71,094,008 (+)	NCBI
mRatBN7.2	3	50,498,633 - 50,685,950 (+)	NCBI
Rnor_6.0	3	51,883,559 - 52,120,290 (+)	NCBI
Rnor_5.0	3	58,517,979 - 58,753,059 (+)	NCBI
Celera	3	50,091,668 - 50,271,757 (+)	NCBI

Sequence:

show sequence

ATGGATGGTCGAGGGCGGAGTGAGCTCTTCTCAGTGTGTTCTGCCGGAGCCCAAGTACAGAGAC
CATATTTACAGGTCCAAGTGACAGCTATGAGTGGAATTTTAAAGGGGAAGCTGGAAGAAGCTGA
CAGCGCCTCTCTCTGCTCTTCGGGGCAGGAATCAGATGATGACGTTTTTAGCTGTTACAGTGCT
GACAGTCTTGATAGTGTCTGTCTGTCCACAGCTGGTCATTTACCCGAAAAAATAAAAGGATATC
AGCAGCCTGAAAGGATATTCTCAGAAGCATAGACTCTTCGGAGGATACTGAACTTCATGAGATC
TCACGGTACATGTGACAGCGCCGCAGCTATGAGTGGAATTTTAAAGAGGAAGTTCGAAGATGTG
GAAGCCTCCTCGCCCTGCTCCTCTGCTCGGGAATCGGATGACGAAGTCTCCAGCAGCGAAAGTG
CTGACAGCGGGGATAGCGTCAATCCATCTACCTCCAATCACTTCACCCCTTCCTCCATCCTCAA
AAGAGAGAAACGGCTGAGGACGAAGAATGTGCACTTCAGTTGTGTCACCGTGTACTACTTCACC
AGGAGGCAGGGCTTCACCAGTGTGCCCAGCCAGGGTGGCAGCACTCTTGGGATGTCCAGCCGTC
ACAACAGCGTGCGCCAGTACACCCTGGGAGAGTTCGCAAGAGAGCAGGAGCGGCTGCACCGGGA
GATGCTGAGAGAACACCTCAGGGAGGAGAAGCTCAACTCTCTAAAACTAAAGATGACCAAGAAT
GGCACTGTAGAATCGGAGGAAGCGAGCACACTGACCGTGGATGACATTTCCGATGACGATATCG
ATTTAGACAACACGGAAGTCGACGAATACTTCTTCCTGCAACCCCTGCCCACAAAAAAACGGAG
AGCTCTGTTGCGAGCCTCTGGGGTGAAGAAGATCGACGTGGAAGAAAAACACGAGCTGCGGGCC
ATCCGCCTGTCTCGGGAGGACTGCGGCTGTGACTGCAGAGTGTTCTGTGATCCAGAAACGTGTA
CCTGCAGCCTGGCAGGCATTAAATGTCAGGTGGATCGGATGTCTTTCCCATGTGGCTGCACTAA
AGAAGGCTGTAGTAACACAGCAGGTAGAATTGAATTTAATCCTATCCGCGTGCGGACTCATTTT
TTGCACACAATAATGAAACTTGAACTGGAGAAGAACCGAGAGCAGCAAACCCCCACGCTGAACG
GCTGCCACGGGGAGATAAGCACCCACGGCCCTTCCATGGGCCCTGTCGCTCACTCCGTAGAATA
TTCCATCGCAGACAATTTCGAGATTGAAAGCGAGCCCCAGGCTGCAGTGCTGCACCTGCAGGAG
GAGCTGGATTGCCAAGGAGACGAGGAGGAGGAGGAGGAAGACGGAAGCAGTTTCTGCAGTGGAG
CCACTGACTCGAGCACCCAAAGCCTGGCCCCCAGTGAATCAGACGAGGAAGAGGAAGAGGAGGA
GGAAGAGGAGGAAGAGGAGGAGGAAGATGACGACGACGACAAGGGAGACGGCTTTGTAGAAGGG
CTTGGAGCCCATACTGAAGTCGTCCCCCTTCCTTCTGTCCTTTGTTACTCCGATGGTACTGCAG
TTCATGAAAGCCACACAAAAAATGCTTCATTTTACGCTAGCTCTTCAACTCTGTACTACCAAAT
AGACAGTCACATTCCGGGAACTCCTAGCCAGCTTTCTGACAACTATCCTGAAAGAGATACTGTC
AAAAACGGTGCCCTTTCGCTGGTGCCTTACGCCATGACCCCAGAGCGCTTTGTTGACTATGCCA
GGCAAGCAGAAGAGGCCTATGGAGCCTCTCACTACCCAGCTGCCAACCCGTCGGTCATTGTTTG
CTGCCCCACCTCTGAAAACGATAGTGGGGTGCCCTGTAACCCCTTATATCCTGAACACAGGTCC
AATCTTCCTCAAGTGGAATTTCACTCATACTTGAAAGGCCCTTCCCAGGAAGGGTTCGTCTCCA
CATTGAATGGCGACAGCCACATTTCAGAGCATCCTGCAGAAAATCCTTTGAGCCTTGCAGAAAA
GAGCAGATTGCATGAGGAGTGCATTCAATCCCCCGTGGTGGAAACAGTCCCCGTTTAGTTGCTT
AAATTATTCTATTATAGACCAAGTCTTCTATTTAAGGCACTGTATTGCCTTTGCTGGCGTTGTT
TAACCCGAAGACCAAGAATATGTGGACTGTGATTAATCTTTCAGACAGTATTTCCTTCCTTCCT
TTCTAGGTTCCCAACTGTGGCGTGGCACAAAATACAGTCGCTATGGGGATTTTAAACGATTTTG
AACTGTTTTGATAGAAAATGCTAAATTAAAAAAAAAAAGCATATCTCACAGTTGCCTACCTGTC
AAACTGTGTGAAACCTGCCAAGCTATGCAGACCATAGCTCCAAGTTTTAGATTATCGGGCCTGT
GCAAGATTGTTAACTAAGACTAGAACGCAAGCAGATTTAGAGTCCTAATTTTTCGATATATCTG
AAGATGATGGTGACTTTTTAAATGTAAAAGTAATTATTG

hide sequence

RefSeq Acc Id:

XM_039104837 ⟹ XP_038960765

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	71,014,229 - 71,102,596 (+)	NCBI
mRatBN7.2	3	50,533,529 - 50,695,598 (+)	NCBI

RefSeq Acc Id:

XM_039104838 ⟹ XP_038960766

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	70,906,587 - 71,102,596 (+)	NCBI
mRatBN7.2	3	50,498,379 - 50,695,598 (+)	NCBI

RefSeq Acc Id:

XM_039104839 ⟹ XP_038960767

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	70,916,849 - 71,102,596 (+)	NCBI
mRatBN7.2	3	50,508,675 - 50,695,598 (+)	NCBI

RefSeq Acc Id:

XM_039104840 ⟹ XP_038960768

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	70,998,389 - 71,102,596 (+)	NCBI
mRatBN7.2	3	50,588,493 - 50,695,598 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001258154	(Get FASTA)	NCBI Sequence Viewer
	XP_038960765	(Get FASTA)	NCBI Sequence Viewer
	XP_038960766	(Get FASTA)	NCBI Sequence Viewer
	XP_038960767	(Get FASTA)	NCBI Sequence Viewer
	XP_038960768	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL79028	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007197
	ENSRNOP00000007197.8
	ENSRNOP00000099288
	ENSRNOP00000105543

RefSeq Acc Id:

NP_001258154 ⟸ NM_001271225

- UniProtKB:

D4AE74 (UniProtKB/TrEMBL), A6HLX7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MRSHGTCDSAAAMSGILKRKFEDVEASSPCSSARESDDEVSSSESADSGDSVNPSTSNHFTPSS
ILKREKRLRTKNVHFSCVTVYYFTRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERL
HREMLREHLREEKLNSLKLKMTKNGTVESEEASTLTVDDISDDDIDLDNTEVDEYFFLQPLPTK
KRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRVFCDPETCTCSLAGIKCQVDRMSFPCG
CTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQTPTLNGCHGEISTHGPSMGPVAHS
VEYSIADNFEIESEPQAAVLHLQEELDCQGDEEEEEEDGSSFCSGATDSSTQSLAPSESDEEEE
EEEEEEEEEEEDDDDDKGDGFVEGLGAHTEVVPLPSVLCYSDGTAVHESHTKNASFYASSSTLY
YQIDSHIPGTPSQLSDNYPERDTVKNGALSLVPYAMTPERFVDYARQAEEAYGASHYPAANPSV
IVCCPTSENDSGVPCNPLYPEHRSNLPQVEFHSYLKGPSQEGFVSTLNGDSHISEHPAENPLSL
AEKSRLHEECIQSPVVETVPV

hide sequence

Ensembl Acc Id:

ENSRNOP00000007197 ⟸ ENSRNOT00000007197

RefSeq Acc Id:	XP_038960766 ⟸ XM_039104838
- Peptide Label:	isoform X2
- UniProtKB:	D4AE74 (UniProtKB/TrEMBL), A6HLX7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038960767 ⟸ XM_039104839
- Peptide Label:	isoform X2
- UniProtKB:	D4AE74 (UniProtKB/TrEMBL), A6HLX7 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038960765 ⟸ XM_039104837
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038960768 ⟸ XM_039104840
- Peptide Label:	isoform X3

Ensembl Acc Id:

ENSRNOP00000099288 ⟸ ENSRNOT00000140101

Ensembl Acc Id:

ENSRNOP00000106784 ⟸ ENSRNOT00000128807

Ensembl Acc Id:

ENSRNOP00000105543 ⟸ ENSRNOT00000139072

Ensembl Acc Id:

ENSRNOP00000109998 ⟸ ENSRNOT00000165994

Protein Domains

Cysteine/serine-rich nuclear protein N-terminal

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306214	AgrOrtholog
BioCyc Gene	G2FUF-49551	BioCyc
Ensembl Genes	ENSRNOG00000005359	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000007197	ENTREZGENE
	ENSRNOT00000007197.8	UniProtKB/TrEMBL
	ENSRNOT00000139072	ENTREZGENE
	ENSRNOT00000140101	ENTREZGENE
InterPro	CSRNP_N	UniProtKB/TrEMBL
	Cys/Ser-rich_nuc_prot	UniProtKB/TrEMBL
KEGG Report	rno:311093	UniProtKB/TrEMBL
NCBI Gene	311093	ENTREZGENE
PANTHER	Cys/Ser-rich_nuc_prot	UniProtKB/TrEMBL
	CYSTEINE/SERINE-RICH NUCLEAR PROTEIN 3	UniProtKB/TrEMBL
Pfam	CSRNP_N	UniProtKB/TrEMBL
PhenoGen	Csrnp3	PhenoGen
PRINTS	CYSSERRICHNP	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000005359	RatGTEx
UniProt	A6HLX7	ENTREZGENE, UniProtKB/TrEMBL
	D4AE74	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Csrnp3	cysteine and serine rich nuclear protein 3	Csrnp3	cysteine-serine-rich nuclear protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-27	Csrnp3	cysteine-serine-rich nuclear protein 3	Csnrp3	cysteine-serine-rich nuclear protein 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Csnrp3	cysteine-serine-rich nuclear protein 3	RGD1306214_predicted	similar to TGF-beta induced apotosis protein 2 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1306214_predicted	similar to TGF-beta induced apotosis protein 2 (predicted)	LOC311093_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC311093_predicted	similar to TGF-beta induced apotosis protein 2 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD