Symbol:
Spin1
Name:
spindlin 1
RGD ID:
1314699
MGI Page
MGI
Description:
Enables histone reader activity and methylated histone binding activity. Involved in protein localization to chromatin and transposable element silencing by piRNA-mediated DNA methylation. Located in spindle. Is active in chromatin. Is expressed in several structures, including alimentary system; brain; cardiovascular system; genitourinary system; and immune system. Orthologous to human SPIN1 (spindlin 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
30000 Mr metaphase complex; AA553322; AA673430; MGC27756; Spin; spindlin-1; spindlin1; SSEC P
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SPIN1 (spindlin 1) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Spin1 (spindlin 1) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Spin1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SPIN1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SPIN1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Spin1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SPIN1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SPIN1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Spin1 (spindlin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
SPIN3 (spindlin family member 3) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Spin1 (spindlin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SPIN1 (spindlin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
spin1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Related Pseudogenes:
Gm7787
Spin3-ps
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 51,254,523 - 51,306,588 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 51,254,916 - 51,306,582 (+) Ensembl GRCm39 Ensembl GRCm38 13 51,097,934 - 51,152,562 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 51,100,880 - 51,152,546 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 51,196,267 - 51,247,915 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 51,113,395 - 51,165,043 (+) NCBI MGSCv36 mm8 Celera 13 52,196,100 - 52,225,469 (+) NCBI Celera Cytogenetic Map 13 A5 NCBI cM Map 13 26.04 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Spin1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SPIN1 mRNA CTD PMID:36331819 Spin1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SPIN1 mRNA CTD PMID:22206623 Spin1 Mouse 17alpha-ethynylestradiol increases expression ISO Spin1 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of SPIN1 mRNA CTD PMID:29097150 Spin1 Mouse 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO SPIN1 (Homo sapiens) 6480464 Metribolone results in increased expression of SPIN1 mRNA CTD PMID:17010196 Spin1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Spin1 Mouse 2,2',5,5'-tetrachlorobiphenyl multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Spin1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of SPIN1 mRNA CTD PMID:16214954 Spin1 Mouse 3-chloropropane-1,2-diol increases expression ISO Spin1 (Rattus norvegicus) 6480464 alpha-Chlorohydrin results in increased expression of SPIN1 mRNA CTD PMID:28522335 Spin1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of SPIN1 mRNA CTD PMID:28628672 Spin1 Mouse 4-hydroxyphenyl retinamide increases expression EXP 6480464 Fenretinide results in increased expression of SPIN1 mRNA CTD PMID:28973697 Spin1 Mouse acrolein multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SPIN1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SPIN1 mRNA CTD PMID:32699268 Spin1 Mouse aflatoxin B1 increases methylation ISO SPIN1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SPIN1 gene and Aflatoxin B1 results in increased methylation of SPIN1 intron CTD PMID:27153756 and PMID:30157460 Spin1 Mouse Aflatoxin B2 alpha decreases methylation ISO SPIN1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of SPIN1 intron CTD PMID:30157460 Spin1 Mouse all-trans-retinoic acid decreases expression ISO SPIN1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of SPIN1 mRNA CTD PMID:33167477 Spin1 Mouse alpha-pinene multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SPIN1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of SPIN1 mRNA CTD PMID:32699268 Spin1 Mouse aristolochic acid A decreases expression ISO SPIN1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SPIN1 mRNA CTD PMID:33212167 Spin1 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of SPIN1 mRNA CTD PMID:23650126 Spin1 Mouse arsenite(3-) multiple interactions ISO SPIN1 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to SPIN1 mRNA] CTD PMID:32406909 Spin1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SPIN1 mRNA CTD PMID:27858113 Spin1 Mouse benzo[a]pyrene decreases methylation ISO SPIN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of SPIN1 3' UTR and Benzo(a)pyrene results in decreased methylation of SPIN1 5' UTR CTD PMID:27901495 Spin1 Mouse benzo[a]pyrene affects methylation ISO SPIN1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SPIN1 intron CTD PMID:30157460 Spin1 Mouse benzo[a]pyrene diol epoxide I decreases expression ISO SPIN1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Spin1 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SPIN1 mRNA CTD PMID:27858113 Spin1 Mouse benzo[e]pyrene increases methylation ISO SPIN1 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of SPIN1 intron CTD PMID:30157460 Spin1 Mouse beta-naphthoflavone increases expression ISO SPIN1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of SPIN1 mRNA CTD PMID:32858204 Spin1 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of SPIN1 mRNA CTD PMID:34319233 Spin1 Mouse bisphenol A increases expression ISO Spin1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of SPIN1 mRNA CTD PMID:25181051 more ... Spin1 Mouse bisphenol A multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SPIN1 gene CTD PMID:31601247 Spin1 Mouse bisphenol F multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of SPIN1 mRNA CTD PMID:28628672 Spin1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Spin1 Mouse chrysene decreases expression EXP 6480464 chrysene results in decreased expression of SPIN1 mRNA CTD PMID:26377693 Spin1 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SPIN1 mRNA CTD PMID:27858113 Spin1 Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of SPIN1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SPIN1 mRNA] CTD PMID:17585979 Spin1 Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of SPIN1 mRNA CTD PMID:17585979 Spin1 Mouse copper(II) sulfate increases expression ISO SPIN1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of SPIN1 mRNA CTD PMID:19549813 Spin1 Mouse dexamethasone multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of SPIN1 mRNA CTD PMID:28628672 Spin1 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of SPIN1 mRNA CTD PMID:24205000 Spin1 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of SPIN1 mRNA CTD PMID:30319688 Spin1 Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of SPIN1 mRNA CTD PMID:25629700 Spin1 Mouse fulvestrant multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of SPIN1 gene CTD PMID:31601247 Spin1 Mouse genistein decreases expression ISO SPIN1 (Homo sapiens) 6480464 Genistein results in decreased expression of SPIN1 mRNA CTD PMID:16705744 Spin1 Mouse hydrogen peroxide affects expression ISO SPIN1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of SPIN1 mRNA CTD PMID:21179406 Spin1 Mouse indometacin multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of SPIN1 mRNA CTD PMID:28628672 Spin1 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SPIN1 mRNA CTD PMID:36331819 Spin1 Mouse leflunomide increases expression ISO Spin1 (Rattus norvegicus) 6480464 leflunomide results in increased expression of SPIN1 mRNA CTD PMID:24136188 Spin1 Mouse methapyrilene increases methylation ISO SPIN1 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of SPIN1 intron CTD PMID:30157460 Spin1 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of SPIN1 mRNA CTD PMID:34813904 Spin1 Mouse ozone multiple interactions ISO SPIN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of SPIN1 mRNA more ... CTD PMID:32699268 Spin1 Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of SPIN1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SPIN1 mRNA] CTD PMID:17585979 Spin1 Mouse paracetamol decreases expression ISO Spin1 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of SPIN1 mRNA CTD PMID:33387578 Spin1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of SPIN1 mRNA CTD PMID:17562736 Spin1 Mouse PCB138 multiple interactions EXP 6480464 [2 more ... CTD PMID:25510870 Spin1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of SPIN1 mRNA CTD PMID:23892564 Spin1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SPIN1 mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SPIN1 mRNA CTD PMID:36331819 Spin1 Mouse rotenone increases expression ISO Spin1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of SPIN1 mRNA CTD PMID:28374803 Spin1 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of SPIN1 mRNA CTD PMID:27131904 Spin1 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of SPIN1 mRNA CTD PMID:27131904 Spin1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of SPIN1 mRNA CTD PMID:31919559 Spin1 Mouse tetraphene decreases expression EXP 6480464 benz(a)anthracene results in decreased expression of SPIN1 mRNA CTD PMID:26377693 Spin1 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of SPIN1 mRNA CTD PMID:27858113 Spin1 Mouse thioacetamide increases expression ISO Spin1 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of SPIN1 mRNA CTD PMID:34492290 Spin1 Mouse thiram decreases expression ISO SPIN1 (Homo sapiens) 6480464 Thiram results in decreased expression of SPIN1 mRNA CTD PMID:38568856 Spin1 Mouse triphenyl phosphate affects expression ISO SPIN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SPIN1 mRNA CTD PMID:37042841 Spin1 Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of SPIN1 mRNA CTD PMID:17292431 Spin1 Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of SPIN1 mRNA CTD PMID:21427059 Spin1 Mouse valproic acid affects expression ISO SPIN1 (Homo sapiens) 6480464 Valproic Acid affects the expression of SPIN1 mRNA CTD PMID:25979313 Spin1 Mouse vorinostat decreases expression ISO SPIN1 (Homo sapiens) 6480464 vorinostat results in decreased expression of SPIN1 mRNA CTD PMID:27188386
(1->4)-beta-D-glucan (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3-chloropropane-1,2-diol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4-hydroxyphenyl retinamide (EXP) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) arsenite(3-) (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (EXP) benzo[e]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (ISO) carbon nanotube (EXP) chrysene (EXP) clofibrate (EXP) copper(II) sulfate (ISO) dexamethasone (ISO) dioxygen (EXP) ethanol (EXP) folic acid (EXP) fulvestrant (ISO) genistein (ISO) hydrogen peroxide (ISO) indometacin (ISO) inulin (EXP) leflunomide (ISO) methapyrilene (ISO) methidathion (EXP) ozone (ISO) paracetamol (EXP,ISO) PCB138 (EXP) pentachlorophenol (EXP) perfluorooctane-1-sulfonic acid (EXP) rotenone (ISO) silver atom (EXP) silver(0) (EXP) tetrachloromethane (EXP) tetraphene (EXP) thioacetamide (ISO) thiram (ISO) triphenyl phosphate (ISO) valproic acid (EXP,ISO) vorinostat (ISO)
Spin1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 51,254,523 - 51,306,588 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 51,254,916 - 51,306,582 (+) Ensembl GRCm39 Ensembl GRCm38 13 51,097,934 - 51,152,562 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 51,100,880 - 51,152,546 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 51,196,267 - 51,247,915 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 51,113,395 - 51,165,043 (+) NCBI MGSCv36 mm8 Celera 13 52,196,100 - 52,225,469 (+) NCBI Celera Cytogenetic Map 13 A5 NCBI cM Map 13 26.04 NCBI
SPIN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 88,388,444 - 88,478,694 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 88,388,430 - 88,478,694 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 91,003,359 - 91,093,609 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 90,193,117 - 90,283,443 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 88,232,968 - 88,320,261 NCBI Celera 9 61,579,528 - 61,669,853 (+) NCBI Celera Cytogenetic Map 9 q22.1 NCBI HuRef 9 60,869,908 - 60,922,040 (+) NCBI HuRef CHM1_1 9 91,150,928 - 91,241,252 (+) NCBI CHM1_1 T2T-CHM13v2.0 9 100,542,547 - 100,632,795 (+) NCBI T2T-CHM13v2.0
Spin1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 14,207,384 - 14,257,330 (-) NCBI GRCr8 mRatBN7.2 17 14,055,685 - 14,105,366 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 14,055,689 - 14,105,411 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 13,984,497 - 14,030,225 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 15,589,742 - 15,635,421 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 13,911,319 - 13,957,038 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 884,854 - 930,527 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 884,861 - 930,527 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 16,148,547 - 16,195,282 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 19,950,350 - 19,996,991 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 19,950,350 - 19,996,991 (-) NCBI Celera 16 203,774 - 204,818 (-) NCBI Celera Cytogenetic Map 17 p14 NCBI
Spin1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955515 3,470,956 - 3,513,728 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955515 3,470,956 - 3,518,909 (-) NCBI ChiLan1.0 ChiLan1.0
SPIN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 50,992,872 - 51,087,039 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 50,995,264 - 51,089,744 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 59,466,550 - 59,558,773 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 87,513,819 - 87,606,187 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 87,513,819 - 87,606,183 (+) Ensembl panpan1.1 panPan2
SPIN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 97,353,108 - 97,426,563 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 97,356,125 - 97,390,646 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 97,815,602 - 97,890,611 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 97,964,655 - 98,039,704 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 97,965,031 - 98,038,858 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 97,592,282 - 97,667,272 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 97,311,443 - 97,386,464 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 98,069,975 - 98,144,932 (-) NCBI UU_Cfam_GSD_1.0
Spin1
SPIN1
SPIN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 98,880,918 - 98,964,988 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 98,913,798 - 98,960,934 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 87,213,604 - 87,297,382 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Spin1
.
Predicted Target Of
Count of predictions: 948 Count of miRNA genes: 563 Interacting mature miRNAs: 661 Transcripts: ENSMUST00000095797 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1300561 Heal7_m wound healing/regeneration 7 (mouse) Not determined 13 36144820 70144904 Mouse 1357591 Tesq1_m testis weight QTL 1 (mouse) Not determined 13 20615512 55720517 Mouse 1301015 Sysbp2_m systolic blood pressure 2 (mouse) Not determined 13 20477612 59821605 Mouse 4142331 Bxs6_m BXSB/MpJ autoimmune nephritis 6 (mouse) Not determined 45210442 83744746 Mouse 12738439 Twq4_m testis weight QTL 4 (mouse) 13 31129110 65129110 Mouse 4142009 Pregq3_m pregnancy QTL 3 (mouse) Not determined 13 20615512 72385189 Mouse 1357587 Pfat3_m predicted fat percentage 3 (mouse) Not determined 13 36101530 70101640 Mouse 10401111 Pgia40_m proteoglycan induced arthritis 40 (mouse) Not determined 13 27918469 61918560 Mouse 1300573 Elsgp2_m elevated serum gp70 2 (mouse) Not determined 13 50616828 84617027 Mouse 10412109 Bxs7_m BXSB/MpJ autoimmune nephritis 7 (mouse) Not determined 13 45210442 83744746 Mouse 10412235 Scgq5_m spontaneous crescentic glomerulonephritis QTL 5 (mouse) Not determined 13 36060908 96239162 Mouse 10755517 Chol15_m cholesterol 15 (mouse) 13 30969467 64969467 Mouse 4142372 Moo2_m modifier of Odc2 (mouse) Not determined X 50318411 84318559 Mouse 15039353 Nmrs35_m NAFLD-associated magnetic resonance shift 35 (mouse) 13 40588253 74588253 Mouse 1302157 Bwem2_m body weight day 30 males 2 (mouse) Not determined 13 39629249 73629397 Mouse 13463469 Gssq1_m glomerulosclerosis severity QTL 1 (mouse) 13 19060908 53061050 Mouse 1301299 Sluc23_m susceptibility to lung cancer 23 (mouse) Not determined 13 34921943 68922081 Mouse 12880423 V25Dq7_m vitamin D inactive form serum level QTL 7 (mouse) 13 19583983 53583983 Mouse 1558898 Hpi1_m hapatic PMN infiltration 1 (mouse) Not determined 13 4414025 53101640 Mouse 4142489 Ath25_m atherosclerosis 25 (mouse) Not determined 25836529 59836529 Mouse 10755533 Chol18_m cholesterol 18 (mouse) 13 30969467 64969467 Mouse 1300985 Bmd13_m bone mineral density 13 (mouse) Not determined 13 39629249 73629397 Mouse 1301880 Hypt_m hypertension (mouse) Not determined 13 18156792 52156924 Mouse 10045618 Heal17_m wound healing/regeneration 17 (mouse) Not determined 13 20746939 54747056 Mouse 10045621 Heal21_m wound healing/regeneration 21 (mouse) Not determined 13 28217379 62217515 Mouse 1300862 Cfbw5_m cystic fibrosis body weight 5 (mouse) Not determined 13 38720358 72720517 Mouse 1300668 Pas10_m pulmonary adenoma susceptibility 10 (mouse) Not determined 13 41489042 75489158 Mouse 1301666 Eae13_m susceptibility to experimental allergic encephalomyelitis 13 (mouse) Not determined 13 50318411 84318559 Mouse 26884393 Humsd7_m humerus midshaft diameter 7, 16 week (mouse) 13 3950000 76048119 Mouse 1300710 Pcd4ts2_m p-glycoprotein positive CD4 T cell subset 2 (mouse) Not determined 13 28210442 62210544 Mouse 1301734 Acsns2_m Angiostrongylus costaricensis nematode susceptibility 2 (mouse) Not determined 13 36101530 70101640 Mouse 26884396 Humsd4_m humerus midshaft diameter 4, 10 week (mouse) 13 47853476 73148119 Mouse 14696729 Kidlq2_m kidney weight, left QTL 2 (mouse) 13 31344736 65344736 Mouse 12738427 Lfibq24_m liver fibrosis QTL 24 (mouse) 13 44258107 52758667 Mouse 1301801 Cpfd5_m cerebellum pattern fissures (mouse) Not determined 13 39629249 73629397 Mouse 4142147 Mvwf4_m modifier of von Willebrand factor 4 (mouse) Not determined 20477612 112898424 Mouse 1357802 Vtbt15_m vertebral trabecular bone trait 15 (mouse) Not determined 13 28217379 62217515 Mouse
U48972
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 51,151,754 - 51,151,952 UniSTS GRCm38 MGSCv37 13 51,247,123 - 51,247,321 UniSTS GRCm37 Celera 13 52,224,669 - 52,224,873 UniSTS Cytogenetic Map 13 A5 UniSTS cM Map 13 31.0 UniSTS Whitehead_YAC 13 UniSTS
RH124326
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 9 67,748,262 - 67,748,714 UniSTS GRCm38 MGSCv37 9 67,596,069 - 67,596,521 UniSTS GRCm37 Celera 9 64,973,479 - 64,973,931 UniSTS Cytogenetic Map 9 C UniSTS Cytogenetic Map 13 A5 UniSTS cM Map 13 31.0 UniSTS
RH124340
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 13 51,149,918 - 51,150,051 UniSTS GRCm38 MGSCv37 13 51,245,287 - 51,245,420 UniSTS GRCm37 Celera 13 52,222,882 - 52,223,015 UniSTS Cytogenetic Map 13 A5 UniSTS cM Map 13 31.0 UniSTS
Spin
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 13 A5 UniSTS cM Map 13 31.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000095797 ⟹ ENSMUSP00000093473
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 51,254,916 - 51,306,582 (+) Ensembl GRCm38.p6 Ensembl 13 51,100,880 - 51,152,546 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000223152
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 13 51,288,355 - 51,306,530 (+) Ensembl GRCm38.p6 Ensembl 13 51,134,319 - 51,152,494 (+) Ensembl
RefSeq Acc Id:
NM_001283028 ⟹ NP_001269957
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,254,880 - 51,306,588 (+) NCBI GRCm38 13 51,100,880 - 51,152,562 (+) NCBI Celera 13 52,173,786 - 52,225,485 (+) NCBI
Sequence:
GGCGGCCGCGGCGAGGAGCGGGGGTGGGGAGGCGCCGTCTGGCTCGGGCTGGGCCGGCGGGGAGCACGAGCGAACCACGGCGGCCCCGTGGGCAGCCTCGGTGGCCGACAGGTGAGACGCGCGTGGGG
hide sequence
RefSeq Acc Id:
NM_001283029 ⟹ NP_001269958
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,255,581 - 51,306,588 (+) NCBI GRCm38 13 51,101,547 - 51,152,562 (+) NCBI Celera 13 52,173,786 - 52,225,485 (+) NCBI
Sequence:
CGGGTTGAGAAATGGCTTCAGTCATCCACGACGTTGCCTGCGCATCTCAAAAGTGCTTGGGATC
hide sequence
RefSeq Acc Id:
NM_001283030 ⟹ NP_001269959
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,254,880 - 51,306,588 (+) NCBI GRCm38 13 51,100,880 - 51,152,562 (+) NCBI Celera 13 52,173,786 - 52,225,485 (+) NCBI
Sequence:
GGCGGCCGCGGCGAGGAGCGGGGGTGGGGAGGCGCCGTCTGGCTCGGGCTGGGCCGGCGGGGAGCACGAGCGAACCACGGCGGCCCCGTGGGCAGCCTCGGTGGCCGACAGGCCATGCTGGAGTATCT
hide sequence
RefSeq Acc Id:
NM_001419135 ⟹ NP_001406064
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,255,581 - 51,306,588 (+) NCBI
RefSeq Acc Id:
NM_001419139 ⟹ NP_001406068
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,255,252 - 51,306,588 (+) NCBI
RefSeq Acc Id:
NM_001419140 ⟹ NP_001406069
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,254,880 - 51,306,588 (+) NCBI
RefSeq Acc Id:
NM_001419141 ⟹ NP_001406070
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,254,523 - 51,306,588 (+) NCBI
RefSeq Acc Id:
NM_011462 ⟹ NP_035592
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,286,833 - 51,306,588 (+) NCBI GRCm38 13 51,132,797 - 51,152,562 (+) NCBI MGSCv37 13 51,196,267 - 51,247,915 (+) RGD Celera 13 52,173,786 - 52,225,485 (+) NCBI cM Map 13 ENTREZGENE
Sequence:
GGGGAAGCAAGCCAGTAAGAAACATCCTCCATGGCCTCTGCGTCAAGTCCTGCTTCCTGCCCCA
hide sequence
RefSeq Acc Id:
NM_146043 ⟹ NP_666155
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,254,880 - 51,306,588 (+) NCBI GRCm38 13 51,100,880 - 51,152,562 (+) NCBI MGSCv37 13 51,196,267 - 51,247,915 (+) RGD Celera 13 52,173,786 - 52,225,485 (+) NCBI cM Map 13 ENTREZGENE
Sequence:
GGCGGCCGCGGCGAGGAGCGGGGGTGGGGAGGCGCCGTCTGGCTCGGGCTGGGCCGGCGGGGAGCACGAGCGAACCACGGCGGCCCCGTGGGCAGCCTCGGTGGCCGACAGAGTGCTTGGGATCCCGT
hide sequence
RefSeq Acc Id:
XM_017315469 ⟹ XP_017170958
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 13 51,256,360 - 51,306,585 (+) NCBI GRCm38 13 51,102,324 - 51,152,552 (+) NCBI
Sequence:
AGGGGCTGTCTTTTTATACTTAGGATTTTTGAAATATATGTGTGTGGATGTTTTGTCTGCATATTTGTCTGTGTACCACATGTGTGTCTGGTGCTCAAGGAGTCCAGAAGAGGGCTCTGAACTCCCGG
hide sequence
RefSeq Acc Id:
NP_666155 ⟸ NM_146043
- Peptide Label:
isoform 2
- UniProtKB:
Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q61142 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
- Sequence:
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHL
hide sequence
RefSeq Acc Id:
NP_035592 ⟸ NM_011462
- Peptide Label:
isoform 1
- UniProtKB:
Q3TQU6 (UniProtKB/TrEMBL)
- Sequence:
MASASSPASCPRKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSL
hide sequence
RefSeq Acc Id:
NP_001269957 ⟸ NM_001283028
- Peptide Label:
isoform 2
- UniProtKB:
Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q61142 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
- Sequence:
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWRE
hide sequence
RefSeq Acc Id:
NP_001269959 ⟸ NM_001283030
- Peptide Label:
isoform 3
- UniProtKB:
Q3UX91 (UniProtKB/TrEMBL)
- Sequence:
MMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRG
hide sequence
RefSeq Acc Id:
NP_001269958 ⟸ NM_001283029
- Peptide Label:
isoform 2
- UniProtKB:
Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q61142 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
- Sequence:
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWREGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHL
hide sequence
RefSeq Acc Id:
XP_017170958 ⟸ XM_017315469
- Peptide Label:
isoform X1
- UniProtKB:
Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q61142 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
- Sequence:
MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRTSVGPSKPVSQPRRNIVGCRIQHGWRE
hide sequence
Ensembl Acc Id:
ENSMUSP00000093473 ⟸ ENSMUST00000095797
RefSeq Acc Id:
NP_001406070 ⟸ NM_001419141
- Peptide Label:
isoform 2
- UniProtKB:
Q61142 (UniProtKB/Swiss-Prot), Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001406069 ⟸ NM_001419140
- Peptide Label:
isoform 2
- UniProtKB:
Q61142 (UniProtKB/Swiss-Prot), Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001406068 ⟸ NM_001419139
- Peptide Label:
isoform 2
- UniProtKB:
Q61142 (UniProtKB/Swiss-Prot), Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001406064 ⟸ NM_001419135
- Peptide Label:
isoform 2
- UniProtKB:
Q61142 (UniProtKB/Swiss-Prot), Q3UT05 (UniProtKB/Swiss-Prot), Q3TLC3 (UniProtKB/Swiss-Prot), Q91VG8 (UniProtKB/Swiss-Prot), Q3UX91 (UniProtKB/TrEMBL)
RGD ID: 8680332 Promoter ID: EPDNEW_M18197 Type: initiation region Name: Spin1_1 Description: Mus musculus spindlin 1 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M18198 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 51,100,880 - 51,100,940 EPDNEW
RGD ID: 8680334 Promoter ID: EPDNEW_M18198 Type: single initiation site Name: Spin1_2 Description: Mus musculus spindlin 1 , transcript variant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M18197 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 13 51,103,666 - 51,103,726 EPDNEW
RGD ID: 6824433 Promoter ID: MM_KWN:14110 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, BoneMarrow_0Hour, BoneMarrow_2Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000057478, NR_029463 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 51,194,961 - 51,196,322 (+) MPROMDB
RGD ID: 6824413 Promoter ID: MM_KWN:14111 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_4Hour, ES_Cell, Kidney, Lung, MEF_B6 Transcripts: UC007QLZ.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 13 51,196,376 - 51,197,212 (+) MPROMDB
