Symbol:
Ncf4
Name:
neutrophil cytosolic factor 4
RGD ID:
1314272
MGI Page
MGI
Description:
Predicted to enable phosphatidylinositol-3-phosphate binding activity and superoxide-generating NADPH oxidase activator activity. Predicted to be involved in superoxide anion generation. Located in cytoplasm. Is expressed in liver; lower urinary tract; stomach; and testis. Human ortholog(s) of this gene implicated in autosomal recessive chronic granulomatous disease 3 and rheumatoid arthritis. Orthologous to human NCF4 (neutrophil cytosolic factor 4).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI451400; NCF-4; neutrophil cytosol factor 4; neutrophil NADPH oxidase factor 4; p40-phox; p40p; p40phox
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 78,128,324 - 78,146,782 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 78,129,001 - 78,146,780 (+) Ensembl GRCm39 Ensembl GRCm38 15 78,244,164 - 78,262,582 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 78,244,801 - 78,262,580 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 78,075,241 - 78,093,010 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 78,072,089 - 78,089,829 (+) NCBI MGSCv36 mm8 Celera 15 79,705,722 - 79,723,507 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ncf4 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane increases expression ISO NCF4 (Homo sapiens) 6480464 o and p'-DDT results in increased expression of NCF4 mRNA CTD PMID:35122929 Ncf4 Mouse 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane multiple interactions ISO NCF4 (Homo sapiens) 6480464 Quercetin inhibits the reaction [o and p'-DDT results in increased expression of NCF4 mRNA] CTD PMID:35122929 Ncf4 Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of NCF4 mRNA CTD PMID:26682919 Ncf4 Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1 and 2-Dimethylhydrazine results in increased expression of NCF4 mRNA CTD PMID:22206623 Ncf4 Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of NCF4 mRNA CTD PMID:17555576 Ncf4 Mouse 17alpha-ethynylestradiol increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of NCF4 mRNA CTD PMID:17557909 Ncf4 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of NCF4 mRNA CTD PMID:17942748 Ncf4 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NCF4 mRNA CTD PMID:17942748 Ncf4 Mouse 17beta-estradiol multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NCF4 mRNA CTD PMID:32741896 Ncf4 Mouse 17beta-estradiol 3-benzoate multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NCF4 mRNA CTD PMID:32741896 Ncf4 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO NCF4 (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 Ncf4 Mouse 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO NCF4 (Homo sapiens) 6480464 2 more ... CTD PMID:30821169 and PMID:31251971 Ncf4 Mouse 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO NCF4 (Homo sapiens) 6480464 AHR protein affects the reaction [2 more ... CTD PMID:31251971 Ncf4 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of NCF4 mRNA CTD PMID:17942748 Ncf4 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ncf4 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of NCF4 mRNA CTD PMID:34747641 Ncf4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NCF4 mRNA CTD PMID:32109520 Ncf4 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of NCF4 mRNA CTD PMID:16120747 and PMID:26290441 Ncf4 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NCF4 mRNA CTD PMID:21570461 and PMID:26377647 Ncf4 Mouse 2,4-diaminotoluene increases expression EXP 6480464 2 and 4-diaminotoluene results in increased expression of NCF4 mRNA CTD PMID:20713471 Ncf4 Mouse 3,3',4,4',5-pentachlorobiphenyl increases expression ISO NCF4 (Homo sapiens) 6480464 3 more ... CTD PMID:30821169 Ncf4 Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of NCF4 mRNA CTD PMID:18648102 Ncf4 Mouse 6-propyl-2-thiouracil decreases expression ISO Ncf4 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of NCF4 mRNA CTD PMID:24780913 Ncf4 Mouse 6-propyl-2-thiouracil increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of NCF4 mRNA CTD PMID:30047161 Ncf4 Mouse acetamide increases expression ISO Ncf4 (Rattus norvegicus) 6480464 acetamide results in increased expression of NCF4 mRNA CTD PMID:31881176 Ncf4 Mouse AICA ribonucleotide multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 AICA ribonucleotide inhibits the reaction [Cadmium Chloride results in increased expression of NCF4 protein] CTD PMID:21195169 Ncf4 Mouse aldehydo-D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of NCF4 mRNA CTD PMID:37567420 Ncf4 Mouse all-trans-retinoic acid increases expression ISO NCF4 (Homo sapiens) 6480464 Tretinoin results in increased expression of NCF4 mRNA CTD PMID:33167477 Ncf4 Mouse amitrole increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Amitrole results in increased expression of NCF4 mRNA CTD PMID:30047161 Ncf4 Mouse amphetamine increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of NCF4 mRNA CTD PMID:30779732 Ncf4 Mouse antirheumatic drug decreases expression ISO NCF4 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of NCF4 mRNA CTD PMID:24449571 Ncf4 Mouse benzo[a]pyrene decreases expression ISO NCF4 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NCF4 mRNA CTD PMID:22316170 Ncf4 Mouse benzo[a]pyrene affects methylation ISO NCF4 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NCF4 promoter CTD PMID:27901495 Ncf4 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of NCF4 mRNA CTD PMID:22228805 more ... Ncf4 Mouse benzo[e]pyrene increases methylation ISO NCF4 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of NCF4 intron CTD PMID:30157460 Ncf4 Mouse Benzo[k]fluoranthene increases expression EXP 6480464 benzo(k)fluoranthene results in increased expression of NCF4 mRNA CTD PMID:26377693 Ncf4 Mouse bisphenol A decreases expression ISO Ncf4 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of NCF4 mRNA CTD PMID:25181051 more ... Ncf4 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NCF4 mRNA CTD PMID:32156529 Ncf4 Mouse bisphenol A multiple interactions ISO NCF4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of NCF4 gene CTD PMID:31601247 Ncf4 Mouse bisphenol A increases expression ISO Ncf4 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of NCF4 mRNA CTD PMID:32145629 Ncf4 Mouse bortezomib decreases expression ISO NCF4 (Homo sapiens) 6480464 Bortezomib results in decreased expression of NCF4 mRNA CTD PMID:20977926 Ncf4 Mouse buta-1,3-diene decreases expression EXP 6480464 1 and 3-butadiene results in decreased expression of NCF4 mRNA CTD PMID:29038090 Ncf4 Mouse cadmium atom multiple interactions ISO NCF4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NCF4 mRNA CTD PMID:35301059 Ncf4 Mouse cadmium dichloride increases expression ISO NCF4 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of NCF4 protein CTD PMID:21195169 Ncf4 Mouse cadmium dichloride multiple interactions ISO NCF4 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of NCF4 mRNA CTD PMID:35301059 Ncf4 Mouse cadmium dichloride increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of NCF4 protein CTD PMID:21195169 Ncf4 Mouse cadmium dichloride multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased expression of NCF4 protein] more ... CTD PMID:21195169 Ncf4 Mouse cadmium sulfate multiple interactions EXP 6480464 cadmium sulfate affects the reaction [MTF1 affects the expression of NCF4 mRNA] CTD PMID:16221973 Ncf4 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 Ncf4 Mouse CGP 52608 multiple interactions ISO NCF4 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to NCF4 gene] CTD PMID:28238834 Ncf4 Mouse chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of NCF4 mRNA CTD PMID:23125180 Ncf4 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of NCF4 mRNA CTD PMID:32715474 Ncf4 Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NCF4 mRNA CTD PMID:20938992 Ncf4 Mouse chromium(6+) increases expression ISO NCF4 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of NCF4 protein CTD PMID:21742780 Ncf4 Mouse cocaine increases expression EXP 6480464 Cocaine results in increased expression of NCF4 protein CTD PMID:18952886 Ncf4 Mouse copper atom decreases expression ISO Ncf4 (Rattus norvegicus) 6480464 Copper results in decreased expression of NCF4 mRNA CTD PMID:30556269 Ncf4 Mouse copper(0) decreases expression ISO Ncf4 (Rattus norvegicus) 6480464 Copper results in decreased expression of NCF4 mRNA CTD PMID:30556269 Ncf4 Mouse crocidolite asbestos decreases expression EXP 6480464 Asbestos and Crocidolite results in decreased expression of NCF4 mRNA CTD PMID:29279043 Ncf4 Mouse Cuprizon increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of NCF4 mRNA CTD PMID:27523638 Ncf4 Mouse D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of NCF4 mRNA CTD PMID:37567420 Ncf4 Mouse DDE increases expression ISO NCF4 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of NCF4 mRNA CTD PMID:25386960 Ncf4 Mouse Dibutyl phosphate affects expression ISO NCF4 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of NCF4 mRNA CTD PMID:37042841 Ncf4 Mouse diclofenac increases expression EXP 6480464 Diclofenac results in increased expression of NCF4 mRNA CTD PMID:26934552 Ncf4 Mouse dioxygen multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of NCF4 mRNA CTD PMID:33729688 Ncf4 Mouse diuron decreases expression ISO NCF4 (Homo sapiens) 6480464 Diuron results in decreased expression of NCF4 mRNA CTD PMID:35967413 Ncf4 Mouse ethyl methanesulfonate increases expression ISO NCF4 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of NCF4 mRNA CTD PMID:23649840 Ncf4 Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NCF4 mRNA CTD PMID:20938992 Ncf4 Mouse fructose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of NCF4 mRNA CTD PMID:37567420 Ncf4 Mouse fulvestrant multiple interactions ISO NCF4 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of NCF4 gene CTD PMID:31601247 Ncf4 Mouse glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of NCF4 mRNA CTD PMID:37567420 Ncf4 Mouse indometacin increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Indomethacin results in increased expression of NCF4 mRNA CTD PMID:36868495 Ncf4 Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NCF4 mRNA CTD PMID:20938992 Ncf4 Mouse manganese(II) chloride increases expression ISO Ncf4 (Rattus norvegicus) 6480464 manganese chloride results in increased expression of NCF4 mRNA CTD PMID:28801915 Ncf4 Mouse methapyrilene increases methylation ISO NCF4 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of NCF4 intron CTD PMID:30157460 Ncf4 Mouse methimazole increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Methimazole results in increased expression of NCF4 mRNA CTD PMID:30047161 Ncf4 Mouse methotrexate decreases expression ISO NCF4 (Homo sapiens) 6480464 Methotrexate results in decreased expression of NCF4 mRNA CTD PMID:17400583 Ncf4 Mouse methotrexate increases expression ISO NCF4 (Homo sapiens) 6480464 Methotrexate results in increased expression of NCF4 mRNA CTD PMID:21678067 Ncf4 Mouse microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of NCF4 mRNA CTD PMID:37342990 Ncf4 Mouse N-acetyl-L-cysteine multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased expression of NCF4 protein] CTD PMID:21195169 Ncf4 Mouse N-acetyl-L-cysteine decreases expression ISO Ncf4 (Rattus norvegicus) 6480464 Acetylcysteine results in decreased expression of NCF4 protein CTD PMID:21195169 Ncf4 Mouse N-formyl-L-methionyl-L-leucyl-L-phenylalanine multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 2-benzyl-3-(4-hydroxymethylphenyl)indazole inhibits the reaction [N-Formylmethionine Leucyl-Phenylalanine affects the localization of NCF4 protein] CTD PMID:19445920 Ncf4 Mouse N-formyl-L-methionyl-L-leucyl-L-phenylalanine affects localization ISO Ncf4 (Rattus norvegicus) 6480464 N-Formylmethionine Leucyl-Phenylalanine affects the localization of NCF4 protein CTD PMID:19445920 Ncf4 Mouse nickel atom increases expression ISO NCF4 (Homo sapiens) 6480464 Nickel results in increased expression of NCF4 mRNA CTD PMID:24768652 and PMID:25583101 Ncf4 Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NCF4 mRNA CTD PMID:35964746 Ncf4 Mouse ozone increases expression ISO NCF4 (Homo sapiens) 6480464 Ozone results in increased expression of NCF4 mRNA CTD PMID:23033980 Ncf4 Mouse ozone multiple interactions ISO NCF4 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of NCF4 mRNA CTD PMID:35430440 Ncf4 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NCF4 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NCF4 mRNA CTD PMID:34911549 Ncf4 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of NCF4 mRNA CTD PMID:17562736 Ncf4 Mouse paraquat increases expression ISO NCF4 (Homo sapiens) 6480464 Paraquat results in increased expression of NCF4 mRNA CTD PMID:34097952 Ncf4 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of NCF4 mRNA CTD PMID:17426115 Ncf4 Mouse pregnenolone 16alpha-carbonitrile increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Pregnenolone Carbonitrile results in increased expression of NCF4 mRNA CTD PMID:30047161 Ncf4 Mouse quercetin multiple interactions ISO NCF4 (Homo sapiens) 6480464 Quercetin inhibits the reaction [o and p'-DDT results in increased expression of NCF4 mRNA] CTD PMID:35122929 Ncf4 Mouse senecionine increases expression EXP 6480464 senecionine results in increased expression of NCF4 protein CTD PMID:35357534 Ncf4 Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of NCF4 mRNA CTD PMID:23221170 Ncf4 Mouse silicon dioxide increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Silicon Dioxide results in increased expression of NCF4 mRNA CTD PMID:32721576 Ncf4 Mouse sirolimus multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 Sirolimus inhibits the reaction [Cadmium Chloride results in increased expression of NCF4 protein] CTD PMID:21195169 Ncf4 Mouse sodium dichromate decreases expression ISO NCF4 (Homo sapiens) 6480464 sodium bichromate results in decreased expression of NCF4 mRNA CTD PMID:17685462 Ncf4 Mouse Soman increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Soman results in increased expression of NCF4 mRNA CTD PMID:19281266 Ncf4 Mouse sulfadimethoxine increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of NCF4 mRNA CTD PMID:30047161 Ncf4 Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of NCF4 mRNA CTD PMID:17555576 Ncf4 Mouse tert-butyl hydroperoxide increases expression EXP 6480464 tert-Butylhydroperoxide results in increased expression of NCF4 mRNA CTD PMID:14729362 Ncf4 Mouse testosterone multiple interactions ISO Ncf4 (Rattus norvegicus) 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of NCF4 mRNA CTD PMID:32741896 Ncf4 Mouse Theaflavin 3,3'-digallate affects expression ISO NCF4 (Homo sapiens) 6480464 theaflavin-3 and 3'-digallate affects the expression of NCF4 mRNA CTD PMID:34925699 Ncf4 Mouse thioacetamide increases expression ISO Ncf4 (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of NCF4 mRNA CTD PMID:34492290 Ncf4 Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of NCF4 mRNA CTD PMID:23557971 Ncf4 Mouse triphenyl phosphate affects expression ISO NCF4 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NCF4 mRNA CTD PMID:37042841 Ncf4 Mouse valproic acid increases methylation ISO NCF4 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of NCF4 gene CTD PMID:29154799 Ncf4 Mouse vinclozolin increases expression ISO Ncf4 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of NCF4 mRNA CTD PMID:23034163 Ncf4 Mouse vinclozolin decreases methylation ISO Ncf4 (Rattus norvegicus) 6480464 vinclozolin results in decreased methylation of NCF4 gene CTD PMID:31079544
Imported Annotations - KEGG (archival)
1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 4,4'-diaminodiphenylmethane (EXP) 6-propyl-2-thiouracil (ISO) acetamide (ISO) AICA ribonucleotide (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) amitrole (ISO) amphetamine (ISO) antirheumatic drug (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) Benzo[k]fluoranthene (EXP) bisphenol A (EXP,ISO) bortezomib (ISO) buta-1,3-diene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cadmium sulfate (EXP) carbon nanotube (EXP) CGP 52608 (ISO) chloroprene (EXP) chlorpyrifos (EXP) choline (EXP) chromium(6+) (ISO) cocaine (EXP) copper atom (ISO) copper(0) (ISO) crocidolite asbestos (EXP) Cuprizon (ISO) D-glucose (EXP) DDE (ISO) Dibutyl phosphate (ISO) diclofenac (EXP) dioxygen (ISO) diuron (ISO) ethyl methanesulfonate (ISO) folic acid (EXP) fructose (EXP) fulvestrant (ISO) glucose (EXP) indometacin (ISO) L-methionine (EXP) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (ISO) methotrexate (ISO) microcystin-LR (EXP) N-acetyl-L-cysteine (ISO) N-formyl-L-methionyl-L-leucyl-L-phenylalanine (ISO) nickel atom (ISO) nitrates (EXP) ozone (EXP,ISO) paracetamol (EXP) paraquat (ISO) pirinixic acid (EXP) pregnenolone 16alpha-carbonitrile (ISO) quercetin (ISO) senecionine (EXP) silicon dioxide (EXP,ISO) sirolimus (ISO) sodium dichromate (ISO) Soman (ISO) sulfadimethoxine (ISO) tamoxifen (EXP) tert-butyl hydroperoxide (EXP) testosterone (ISO) Theaflavin 3,3'-digallate (ISO) thioacetamide (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) valproic acid (ISO) vinclozolin (ISO)
Ncf4 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 78,128,324 - 78,146,782 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 78,129,001 - 78,146,780 (+) Ensembl GRCm39 Ensembl GRCm38 15 78,244,164 - 78,262,582 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 78,244,801 - 78,262,580 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 78,075,241 - 78,093,010 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 78,072,089 - 78,089,829 (+) NCBI MGSCv36 mm8 Celera 15 79,705,722 - 79,723,507 (+) NCBI Celera Cytogenetic Map 15 E1 NCBI cM Map 15 37.1 NCBI
NCF4 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 22 36,861,006 - 36,878,015 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 22 36,860,988 - 36,878,017 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 22 37,257,048 - 37,274,057 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 22 35,586,991 - 35,604,005 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 22 35,581,544 - 35,598,558 NCBI Celera 22 21,054,984 - 21,075,404 (+) NCBI Celera Cytogenetic Map 22 q12.3 NCBI HuRef 22 20,219,193 - 20,235,709 (+) NCBI HuRef CHM1_1 22 37,215,777 - 37,232,815 (+) NCBI CHM1_1 T2T-CHM13v2.0 22 37,316,866 - 37,336,974 (+) NCBI T2T-CHM13v2.0
Ncf4 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 111,705,926 - 111,723,893 (+) NCBI GRCr8 mRatBN7.2 7 109,825,420 - 109,843,389 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 109,826,020 - 109,843,389 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 111,575,804 - 111,592,610 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 113,799,365 - 113,816,171 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 113,768,035 - 113,784,810 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 119,481,711 - 119,499,426 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 119,482,272 - 119,499,425 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 119,473,732 - 119,490,872 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 116,167,621 - 116,190,630 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 106,165,444 - 106,181,739 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
Ncf4 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955413 23,388,018 - 23,408,090 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955413 23,388,456 - 23,405,121 (+) NCBI ChiLan1.0 ChiLan1.0
NCF4 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 23 46,715,341 - 46,735,474 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 22 49,406,644 - 49,426,776 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 22 17,775,590 - 17,795,725 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 22 35,611,589 - 35,631,400 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 22 35,611,589 - 35,631,400 (+) Ensembl panpan1.1 panPan2
NCF4 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 10 27,597,296 - 27,672,199 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 10 27,597,486 - 27,615,261 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 10 27,551,611 - 27,626,188 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 10 28,389,229 - 28,463,826 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 10 28,389,225 - 28,407,201 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 10 28,110,753 - 28,185,319 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 10 28,419,256 - 28,493,843 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 10 28,598,068 - 28,672,687 (-) NCBI UU_Cfam_GSD_1.0
Ncf4 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 10,991,297 - 11,005,134 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936492 4,001,898 - 4,010,456 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936492 4,001,711 - 4,015,253 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NCF4 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 10,874,953 - 10,994,014 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 10,876,147 - 10,994,002 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 8,477,878 - 8,593,943 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NCF4 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 19 19,560,047 - 19,579,342 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 19 19,566,562 - 19,579,352 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666045 106,283,752 - 106,303,762 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ncf4
.
Predicted Target Of
Count of predictions: 1075 Count of miRNA genes: 521 Interacting mature miRNAs: 638 Transcripts: ENSMUST00000096357, ENSMUST00000126028, ENSMUST00000133618, ENSMUST00000146147, ENSMUST00000147303, ENSMUST00000148646 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
38501067 Tip3_m tuberculosis immunophenotype 3, IFN-g level (mouse) 15 53563396 89584203 Mouse 1300627 Sluc26_m susceptibility to lung cancer 26 (mouse) Not determined 15 70345653 104073951 Mouse 27226777 Tibl8_m tibia length 8, 5 week (mouse) 15 6929481 84584201 Mouse 15092079 Igly6_m IgG glycosylation 6, GP6 (mouse) 15 74100540 82674156 Mouse 4142252 Tailaq4_m tail length adjusted QTL 4 (mouse) Not determined 3489694 78601286 Mouse 1357703 Vtbt17_m vertebral trabecular bone trait 17 (mouse) Not determined 15 44553313 78553437 Mouse 13504731 Cath5_m carotid atherosclerosis 5 (mouse) 15 54789129 88789129 Mouse 1558786 Msq1_m MAV-1 susceptibility QTL 1 (mouse) Not determined 15 63389646 81086436 Mouse 15092080 Igly7_m IgG glycosylation 7, GP10 (mouse) 15 77794919 82674156 Mouse 12791003 Aath8_m aortic arch atherosclerosis 8 (mouse) 15 73430144 104073951 Mouse 1301006 Hfib1_m hepatic fibrogenesis 1 (mouse) Not determined 15 47306334 81306479 Mouse 27095936 Ulnl4_m ulna length 4, 5 week (mouse) 15 56763396 87684201 Mouse 10755515 Amzn3_m anatomical modifier of Zfp423 3 (mouse) 15 46389646 80389845 Mouse 1301171 Brm2_m brachyury modifier 2 (mouse) Not determined 15 65525376 99525499 Mouse 1301429 Pcir3_m periosteal circumference 3 (mouse) Not determined 15 48465362 82465496 Mouse 1302197 Bhr2_m bronchial hyperresponsiveness 2 (mouse) Not determined 15 64306334 103425899 Mouse 26884402 Cvht9_m cranial vault height 9, 16 week (mouse) 15 42163396 95497881 Mouse 1357756 Alaa4_m alopecia areata 4 (mouse) Not determined 15 46389646 80389845 Mouse 1302074 Bmd4_m bone mineral density 4 (mouse) Not determined 15 56186708 103425899 Mouse 1301433 Rapop5_m radiation-induced apoptosis 5 (mouse) Not determined 15 9273022 79474762 Mouse 26884399 Humsd1_m humerus midshaft diameter 1, 5 week (mouse) 15 48363396 101708435 Mouse 26884397 Humsd5_m humerus midshaft diameter 5, 10 week (mouse) 15 48363396 98397881 Mouse 1300648 Dbsty4_m diabesity 4 (mouse) Not determined 15 70349271 104073951 Mouse 10412067 Pain2_m pain 2 (mouse) Not determined 15 51645339 85645626 Mouse 4141952 W3q7_m weight 3 weeks QTL 7 (mouse) Not determined 3489694 78601286 Mouse 26884442 Sklq6_m skull length QTL 6, 5 week (mouse) 15 6129481 100797881 Mouse 27226717 Tibw4_m tibia width 4, proximal, 10 week (mouse) 15 6129481 78684200 Mouse 1357526 Hyplip2_m hyperlipidemia 2 (mouse) Not determined 15 12402203 102896555 Mouse 4142198 Hbtq_m habituation QTL (mouse) Not determined 15 51160708 85160833 Mouse 1357407 Pfat4_m predicted fat percentage 4 (mouse) 8.6 Body fat amount predicted fat percentage 15 57117005 91117153 Mouse 4142448 Tailq6_m tail length QTL 6 (mouse) Not determined 3489694 78601286 Mouse 1357659 Epfpq4_m epididymal fat percentage QTL 4 (mouse) Not determined 15 3489694 78601286 Mouse 26884425 Cvht2_m cranial vault height 2, 5 week (mouse) 15 28800146 102008435 Mouse 1301568 Tria2_m T-cell receptor induced activation 2 (mouse) Not determined 15 44859141 78859281 Mouse 1302080 Szs13_m seizure susceptibility 13 (mouse) Not determined 15 51685832 85694449 Mouse 1300800 Ses3_m salmonella enteritidis susceptibility 3 (mouse) Not determined 15 57117005 91117153 Mouse 10045637 Heal27_m wound healing/regeneration 29 (mouse) Not determined 15 51418361 85418511 Mouse 1558985 Eae32_m experimental allergic encephalomyelitis susceptibility 32 (mouse) Not determined 15 32578416 103425899 Mouse 4141921 Pstc3_m periosteal circumference 3 (mouse) Not determined 15 67270698 101270847 Mouse 1301708 Cocrb14_m cocaine related behavior 14 (mouse) Not determined 15 51806515 85806651 Mouse 12880420 V25Dq8_m vitamin D inactive form serum level QTL 8 (mouse) 15 61584200 95584200 Mouse 1300851 Heal4_m wound healing/regeneration 4 (mouse) Not determined 15 77527592 104073951 Mouse 1302002 Cocia2_m cocaine induced activation 2 (mouse) Not determined 15 72372459 79899178 Mouse 14747011 Mancz13_m mandible centroid size 13 (mouse) 15 72382669 104073951 Mouse 1357559 Scfq2_m subcutaneous fat pad weight QTL 2 (mouse) Not determined 15 3489694 78601286 Mouse 1300726 Pitm4_m prion incubation time 4 (mouse) Not determined 15 70349271 104073951 Mouse 1301119 Drb7_m dopamine receptor binding 7 (mouse) Not determined 15 65336578 99341028 Mouse 4141135 Cia35_m collagen induced arthritis 35 (mouse) Not determined 15 64811826 98811946 Mouse 27226734 Tibmd5_m tibia midshaft diameter 5, 10 week (mouse) 15 6129481 86684201 Mouse 13442492 Mecth2_m mechanosensation threshold 2 (mouse) 15 74662849 79387201 Mouse 1301601 Faq9_m fluctuating asymmetry QTL 9 (mouse) Not determined 15 63163903 97163995 Mouse 1301472 Pain1_m pain 1 (mouse) Not determined 15 75320846 90813185 Mouse 27226729 Tibmd2_m tibia midshaft diameter 2, 5 week (mouse) 15 38000244 86684201 Mouse 1301860 Gct3_m granulosa cell tumorigenesis 3 (mouse) Not determined 15 47409596 81409691 Mouse
AI451400
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 15 78,262,378 - 78,262,465 UniSTS GRCm38 MGSCv37 15 78,092,808 - 78,092,895 UniSTS GRCm37 Celera 15 79,723,305 - 79,723,392 UniSTS Cytogenetic Map 15 E1 UniSTS cM Map 15 47.2 UniSTS Whitehead/MRC_RH 15 691.52 UniSTS
AB002665
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 15 78,262,379 - 78,262,465 UniSTS GRCm38 MGSCv37 15 78,092,809 - 78,092,895 UniSTS GRCm37 Celera 15 79,723,306 - 79,723,392 UniSTS Cytogenetic Map 15 E1 UniSTS cM Map 15 47.2 UniSTS Whitehead/MRC_RH 15 696.99 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000096357 ⟹ ENSMUSP00000094084
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,129,001 - 78,146,780 (+) Ensembl GRCm38.p6 Ensembl 15 78,244,801 - 78,262,580 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000126028
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,137,446 - 78,144,969 (+) Ensembl GRCm38.p6 Ensembl 15 78,253,246 - 78,260,769 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133618 ⟹ ENSMUSP00000121191
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,129,044 - 78,144,954 (+) Ensembl GRCm38.p6 Ensembl 15 78,244,844 - 78,260,754 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000146147
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,139,652 - 78,145,002 (+) Ensembl GRCm38.p6 Ensembl 15 78,255,452 - 78,260,802 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000147303
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,137,232 - 78,146,780 (+) Ensembl GRCm38.p6 Ensembl 15 78,253,032 - 78,262,580 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000148646
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 78,145,078 - 78,146,775 (+) Ensembl GRCm38.p6 Ensembl 15 78,260,878 - 78,262,575 (+) Ensembl
RefSeq Acc Id:
NM_001411421 ⟹ NP_001398350
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,129,000 - 78,146,780 (+) NCBI
RefSeq Acc Id:
NM_001411422 ⟹ NP_001398351
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,129,000 - 78,146,780 (+) NCBI
RefSeq Acc Id:
NM_001411423 ⟹ NP_001398352
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,128,324 - 78,146,780 (+) NCBI
RefSeq Acc Id:
NM_008677 ⟹ NP_032703
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,129,000 - 78,146,780 (+) NCBI GRCm38 15 78,244,811 - 78,262,580 (+) NCBI MGSCv37 15 78,075,241 - 78,093,010 (+) RGD Celera 15 79,705,722 - 79,723,507 (+) RGD cM Map 15 ENTREZGENE
Sequence:
TGCTGTGCAGCTGGGAAGTGGCTGAGAAGACGTGTGAGGGCCAGGCAGCTCAAAGCCTGAAGGAGGTACTTCAAGGAGGGTCCAGAGAAGCTGGGCAGGGCGGGACCTCCTCAAAGGCTGCCCCTGGG
hide sequence
RefSeq Acc Id:
XM_036159222 ⟹ XP_036015115
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,128,987 - 78,146,782 (+) NCBI
Sequence:
ACCCAAGGGTGCCACTTCCTCAACTGCTGTGCAGCTGGGAAGTGGCTGAGAAGACGTGTGAGGG
hide sequence
RefSeq Acc Id:
XM_036159223 ⟹ XP_036015116
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 78,128,968 - 78,144,229 (+) NCBI
Sequence:
GGCCTCACGCAAGCCCAGCACCCAAGGGTGCCACTTCCTCAACTGCTGTGCAGCTGGGAAGTGG
hide sequence
RefSeq Acc Id:
NP_032703 ⟸ NM_008677
- Peptide Label:
isoform 1
- UniProtKB:
Q3TBC6 (UniProtKB/Swiss-Prot), P97369 (UniProtKB/Swiss-Prot), B6DT57 (UniProtKB/TrEMBL)
- Sequence:
MALAQQLRSESDFEQLPDDVAVSANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFYALQSKLEERFGPESKNSPFTCSLPTLPAKVYMGAKQEIAETRIPALNAYMKNLLSLPVCVLMDPD
hide sequence
Ensembl Acc Id:
ENSMUSP00000121191 ⟸ ENSMUST00000133618
Ensembl Acc Id:
ENSMUSP00000094084 ⟸ ENSMUST00000096357
RefSeq Acc Id:
XP_036015116 ⟸ XM_036159223
- Peptide Label:
isoform X4
- UniProtKB:
A8XU21 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_036015115 ⟸ XM_036159222
- Peptide Label:
isoform X3
- UniProtKB:
Q3TC82 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398352 ⟸ NM_001411423
- Peptide Label:
isoform 1
- UniProtKB:
P97369 (UniProtKB/Swiss-Prot), Q3TBC6 (UniProtKB/Swiss-Prot), B6DT57 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398350 ⟸ NM_001411421
- Peptide Label:
isoform 2
- UniProtKB:
A8XU21 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001398351 ⟸ NM_001411422
- Peptide Label:
isoform 1
- UniProtKB:
P97369 (UniProtKB/Swiss-Prot), Q3TBC6 (UniProtKB/Swiss-Prot), B6DT57 (UniProtKB/TrEMBL)
RGD ID: 6826256 Promoter ID: MM_KWN:18971 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Spleen Transcripts: OTTMUST00000069709, OTTMUST00000069710 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 15 78,074,611 - 78,075,382 (+) MPROMDB
RGD ID: 6826257 Promoter ID: MM_KWN:18972 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: OTTMUST00000069711, OTTMUST00000069712, UC007WOX.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 15 78,082,561 - 78,083,532 (+) MPROMDB
RGD ID: 6826259 Promoter ID: MM_KWN:18973 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: OTTMUST00000069713 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 15 78,085,096 - 78,086,047 (+) MPROMDB
RGD ID: 6826260 Promoter ID: MM_KWN:18974 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour Transcripts: OTTMUST00000069714 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 15 78,090,361 - 78,091,497 (+) MPROMDB
RGD ID: 8684244 Promoter ID: EPDNEW_M20152 Type: initiation region Name: Ncf4_2 Description: Mus musculus neutrophil cytosolic factor 4 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M20153 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 15 78,244,800 - 78,244,860 EPDNEW
RGD ID: 8684246 Promoter ID: EPDNEW_M20153 Type: initiation region Name: Ncf4_1 Description: Mus musculus neutrophil cytosolic factor 4 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M20152 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 15 78,244,965 - 78,245,025 EPDNEW
