Symbol:
Asf1a
Name:
anti-silencing function 1A histone chaperone
RGD ID:
1311941
Description:
Predicted to enable chromatin binding activity; histone binding activity; and histone chaperone activity. Predicted to be involved in DNA repair-dependent chromatin remodeling; DNA replication-dependent chromatin assembly; and replication fork processing. Predicted to act upstream of or within several processes, including DNA repair; nucleosome assembly; and osteoblast differentiation. Predicted to be located in nucleoplasm. Predicted to be part of protein-containing complex. Predicted to be active in chromatin; nucleus; and site of double-strand break. Orthologous to human ASF1A (anti-silencing function 1A histone chaperone); PARTICIPATES IN histone modification pathway; INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ASF1 anti-silencing function 1 homolog A; ASF1 anti-silencing function 1 homolog A (S. cerevisiae); histone chaperone ASF1A; LOC294408
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 33,436,632 - 33,451,478 (+) NCBI GRCr8 mRatBN7.2 20 32,893,962 - 32,908,808 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 32,893,573 - 32,908,808 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 33,933,507 - 33,948,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 33,324,220 - 33,339,204 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 34,051,143 - 34,066,130 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 34,894,419 - 34,909,265 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 34,894,419 - 34,909,265 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 36,651,864 - 36,666,710 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 32,261,624 - 32,276,470 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 32,242,606 - 32,288,661 (+) NCBI Celera 20 34,286,255 - 34,301,101 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Asf1a Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ASF1A (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ASF1A mRNA CTD PMID:22079256 Asf1a Rat 1,2-dimethylhydrazine decreases expression ISO Asf1a (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ASF1A mRNA CTD PMID:22206623 Asf1a Rat 17alpha-ethynylestradiol affects expression ISO Asf1a (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ASF1A mRNA CTD PMID:17555576 Asf1a Rat 1H-pyrazole increases expression ISO Asf1a (Mus musculus) 6480464 pyrazole results in increased expression of ASF1A mRNA CTD PMID:17945193 Asf1a Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:27291303 Asf1a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Asf1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to ASF1A promoter] CTD PMID:19654925 Asf1a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ASF1A mRNA CTD PMID:33387578 Asf1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Asf1a (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ASF1A mRNA CTD PMID:21570461 Asf1a Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ASF1A mRNA CTD PMID:22298810 Asf1a Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of ASF1A mRNA CTD PMID:21346803 Asf1a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ASF1A mRNA CTD PMID:21346803 Asf1a Rat 2-hydroxypropanoic acid decreases expression ISO ASF1A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ASF1A mRNA CTD PMID:30851411 Asf1a Rat 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine decreases expression ISO ASF1A (Homo sapiens) 6480464 2-amino-3-methylimidazo(4 and 5-f)quinoline results in decreased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat 4-nitro-1,2-phenylenediamine increases expression ISO ASF1A (Homo sapiens) 6480464 1 and 2-diamino-4-nitrobenzene results in increased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat aflatoxin B1 decreases methylation ISO ASF1A (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ASF1A gene CTD PMID:27153756 Asf1a Rat arsane multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat arsenic atom multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat benzo[a]pyrene decreases expression ISO Asf1a (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ASF1A mRNA CTD PMID:20504355 Asf1a Rat benzo[a]pyrene increases expression ISO ASF1A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ASF1A mRNA CTD PMID:20106945 more ... Asf1a Rat benzo[a]pyrene increases expression ISO Asf1a (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ASF1A mRNA CTD PMID:22228805 Asf1a Rat benzo[a]pyrene diol epoxide I decreases expression ISO ASF1A (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 and PMID:20018196 Asf1a Rat bisphenol A decreases expression ISO ASF1A (Homo sapiens) 6480464 bisphenol A results in decreased expression of ASF1A mRNA CTD PMID:20678512 Asf1a Rat bisphenol A multiple interactions ISO ASF1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ASF1A gene CTD PMID:31601247 Asf1a Rat bisphenol A increases methylation ISO ASF1A (Homo sapiens) 6480464 bisphenol A results in increased methylation of ASF1A gene CTD PMID:31601247 Asf1a Rat bisphenol A affects expression ISO ASF1A (Homo sapiens) 6480464 bisphenol A affects the expression of ASF1A mRNA CTD PMID:30903817 Asf1a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ASF1A mRNA CTD PMID:25181051 Asf1a Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of ASF1A mRNA CTD PMID:12628495 Asf1a Rat butanal decreases expression ISO ASF1A (Homo sapiens) 6480464 butyraldehyde results in decreased expression of ASF1A mRNA CTD PMID:26079696 Asf1a Rat cadmium atom multiple interactions ISO ASF1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ASF1A mRNA CTD PMID:35301059 Asf1a Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ASF1A mRNA CTD PMID:33453195 Asf1a Rat cadmium dichloride multiple interactions ISO ASF1A (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ASF1A mRNA CTD PMID:35301059 Asf1a Rat cadmium dichloride decreases expression ISO ASF1A (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of ASF1A mRNA CTD PMID:38568856 Asf1a Rat caffeine affects phosphorylation ISO ASF1A (Homo sapiens) 6480464 Caffeine affects the phosphorylation of ASF1A protein CTD PMID:35688186 Asf1a Rat chlorambucil decreases expression ISO ASF1A (Homo sapiens) 6480464 Chlorambucil results in decreased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat chromium(6+) decreases expression ISO ASF1A (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of ASF1A mRNA CTD PMID:30690063 Asf1a Rat clofibrate multiple interactions ISO Asf1a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ASF1A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ASF1A mRNA] CTD PMID:17585979 Asf1a Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ASF1A mRNA CTD PMID:24386269 Asf1a Rat copper(II) sulfate increases expression ISO ASF1A (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ASF1A mRNA CTD PMID:19549813 Asf1a Rat crocidolite asbestos affects expression ISO ASF1A (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of ASF1A mRNA CTD PMID:17331233 Asf1a Rat cyclosporin A increases expression ISO ASF1A (Homo sapiens) 6480464 Cyclosporine results in increased expression of ASF1A mRNA CTD PMID:20106945 Asf1a Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of ASF1A mRNA CTD PMID:23640034 Asf1a Rat Dibutyl phosphate affects expression ISO ASF1A (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ASF1A mRNA CTD PMID:37042841 Asf1a Rat dicrotophos decreases expression ISO ASF1A (Homo sapiens) 6480464 dicrotophos results in decreased expression of ASF1A mRNA CTD PMID:28302478 Asf1a Rat diethylstilbestrol increases expression ISO ASF1A (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat dorsomorphin multiple interactions ISO ASF1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Asf1a Rat doxorubicin decreases expression ISO ASF1A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ASF1A mRNA CTD PMID:29803840 Asf1a Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ASF1A mRNA CTD PMID:29391264 Asf1a Rat Ethyl acrylate increases expression ISO ASF1A (Homo sapiens) 6480464 ethyl acrylate results in increased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of ASF1A mRNA CTD PMID:24136188 Asf1a Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of ASF1A mRNA CTD PMID:24793618 Asf1a Rat folic acid decreases expression ISO Asf1a (Mus musculus) 6480464 Folic Acid results in decreased expression of ASF1A mRNA CTD PMID:25629700 Asf1a Rat FR900359 increases phosphorylation ISO ASF1A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ASF1A protein CTD PMID:37730182 Asf1a Rat fulvestrant multiple interactions ISO ASF1A (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of ASF1A gene CTD PMID:31601247 Asf1a Rat hydrogen peroxide affects expression ISO ASF1A (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ASF1A mRNA CTD PMID:23410634 Asf1a Rat ivermectin decreases expression ISO ASF1A (Homo sapiens) 6480464 Ivermectin results in decreased expression of ASF1A protein CTD PMID:32959892 Asf1a Rat lead diacetate multiple interactions ISO ASF1A (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of ASF1A mRNA CTD PMID:22839698 Asf1a Rat lipopolysaccharide multiple interactions ISO ASF1A (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ASF1A mRNA CTD PMID:35811015 Asf1a Rat manganese atom multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat manganese(0) multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat manganese(II) chloride multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat menadione increases expression ISO ASF1A (Homo sapiens) 6480464 Vitamin K 3 results in increased expression of ASF1A mRNA CTD PMID:23410634 Asf1a Rat mercury dibromide increases expression ISO ASF1A (Homo sapiens) 6480464 mercuric bromide results in increased expression of ASF1A mRNA CTD PMID:26272509 Asf1a Rat mercury dibromide multiple interactions ISO ASF1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASF1A mRNA CTD PMID:27188386 Asf1a Rat methylmercury chloride increases expression ISO ASF1A (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ASF1A mRNA CTD PMID:28001369 Asf1a Rat methylparaben decreases expression ISO ASF1A (Homo sapiens) 6480464 methylparaben results in decreased expression of ASF1A mRNA CTD PMID:31745603 Asf1a Rat N-nitrosodimethylamine decreases expression ISO ASF1A (Homo sapiens) 6480464 Dimethylnitrosamine results in decreased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat nefazodone increases expression EXP 6480464 nefazodone results in increased expression of ASF1A mRNA CTD PMID:24136188 Asf1a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ASF1A mRNA CTD PMID:25729387 Asf1a Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of ASF1A mRNA CTD PMID:25729387 Asf1a Rat p-chloromercuribenzoic acid increases expression ISO ASF1A (Homo sapiens) 6480464 p-Chloromercuribenzoic Acid results in increased expression of ASF1A mRNA CTD PMID:26272509 Asf1a Rat p-chloromercuribenzoic acid multiple interactions ISO ASF1A (Homo sapiens) 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASF1A mRNA CTD PMID:27188386 Asf1a Rat para-Cresidine increases expression ISO ASF1A (Homo sapiens) 6480464 cresidine results in increased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat paracetamol multiple interactions ISO Asf1a (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ASF1A mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ASF1A mRNA] CTD PMID:17585979 Asf1a Rat perfluorooctane-1-sulfonic acid increases expression ISO ASF1A (Homo sapiens) 6480464 perfluorooctane sulfonic acid results in increased expression of ASF1A mRNA CTD PMID:25812627 Asf1a Rat perfluorooctanoic acid increases expression ISO ASF1A (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of ASF1A mRNA CTD PMID:25812627 Asf1a Rat phenylmercury acetate increases expression ISO ASF1A (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ASF1A mRNA CTD PMID:26272509 Asf1a Rat phenylmercury acetate multiple interactions ISO ASF1A (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ASF1A mRNA CTD PMID:27188386 Asf1a Rat phorbol 13-acetate 12-myristate decreases expression ISO ASF1A (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in decreased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat piroxicam decreases expression ISO ASF1A (Homo sapiens) 6480464 Piroxicam results in decreased expression of ASF1A mRNA CTD PMID:21858171 Asf1a Rat potassium chromate multiple interactions ISO ASF1A (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ASF1A mRNA CTD PMID:22079256 Asf1a Rat potassium chromate decreases expression ISO ASF1A (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ASF1A mRNA CTD PMID:22079256 and PMID:22714537 Asf1a Rat rac-lactic acid decreases expression ISO ASF1A (Homo sapiens) 6480464 Lactic Acid results in decreased expression of ASF1A mRNA CTD PMID:30851411 Asf1a Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO ASF1A (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ASF1A mRNA CTD PMID:35811015 Asf1a Rat SB 431542 multiple interactions ISO ASF1A (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Asf1a Rat silver atom decreases expression ISO Asf1a (Mus musculus) 6480464 Silver results in decreased expression of ASF1A mRNA CTD PMID:27131904 Asf1a Rat silver atom increases expression ISO ASF1A (Homo sapiens) 6480464 Silver results in increased expression of ASF1A mRNA CTD PMID:26014281 Asf1a Rat silver(0) decreases expression ISO Asf1a (Mus musculus) 6480464 Silver results in decreased expression of ASF1A mRNA CTD PMID:27131904 Asf1a Rat silver(0) increases expression ISO ASF1A (Homo sapiens) 6480464 Silver results in increased expression of ASF1A mRNA CTD PMID:26014281 Asf1a Rat sodium arsenite increases expression ISO Asf1a (Mus musculus) 6480464 sodium arsenite results in increased expression of ASF1A mRNA CTD PMID:25270620 Asf1a Rat sodium arsenite multiple interactions ISO ASF1A (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of ASF1A mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of ASF1A mRNA CTD PMID:39836092 Asf1a Rat Soman increases expression EXP 6480464 Soman results in increased expression of ASF1A mRNA CTD PMID:19281266 Asf1a Rat sulforaphane increases expression ISO ASF1A (Homo sapiens) 6480464 sulforaphane results in increased expression of ASF1A mRNA CTD PMID:31838189 Asf1a Rat sunitinib decreases expression ISO ASF1A (Homo sapiens) 6480464 Sunitinib results in decreased expression of ASF1A mRNA CTD PMID:31533062 Asf1a Rat tamoxifen affects expression ISO Asf1a (Mus musculus) 6480464 Tamoxifen affects the expression of ASF1A mRNA CTD PMID:17555576 Asf1a Rat temozolomide decreases expression ISO ASF1A (Homo sapiens) 6480464 Temozolomide results in decreased expression of ASF1A mRNA CTD PMID:31758290 Asf1a Rat tert-butyl hydroperoxide increases expression ISO ASF1A (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of ASF1A mRNA CTD PMID:23410634 Asf1a Rat thimerosal increases expression ISO ASF1A (Homo sapiens) 6480464 Thimerosal results in increased expression of ASF1A mRNA CTD PMID:27188386 Asf1a Rat titanium dioxide decreases methylation ISO Asf1a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ASF1A gene CTD PMID:35295148 Asf1a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ASF1A mRNA CTD PMID:25729387 Asf1a Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ASF1A mRNA CTD PMID:25729387 Asf1a Rat Tributyltin oxide increases expression ISO ASF1A (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of ASF1A mRNA CTD PMID:26198647 Asf1a Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ASF1A gene CTD PMID:27618143 Asf1a Rat trimellitic anhydride increases expression ISO Asf1a (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ASF1A mRNA CTD PMID:19042947 Asf1a Rat triphenyl phosphate affects expression ISO ASF1A (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ASF1A mRNA CTD PMID:37042841 Asf1a Rat valproic acid increases expression ISO ASF1A (Homo sapiens) 6480464 Valproic Acid results in increased expression of ASF1A mRNA CTD PMID:23179753 and PMID:29154799 Asf1a Rat valproic acid affects expression ISO ASF1A (Homo sapiens) 6480464 Valproic Acid affects the expression of ASF1A mRNA CTD PMID:25979313 Asf1a Rat zinc protoporphyrin multiple interactions ISO ASF1A (Homo sapiens) 6480464 [lead acetate co-treated with zinc protoporphyrin] results in decreased expression of ASF1A mRNA CTD PMID:22839698
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 1H-pyrazole (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 3-methyl-3H-imidazo[4,5-f]quinolin-2-amine (ISO) 4-nitro-1,2-phenylenediamine (ISO) aflatoxin B1 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chlorambucil (ISO) chromium(6+) (ISO) clofibrate (ISO) cobalt dichloride (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) decabromodiphenyl ether (EXP) Dibutyl phosphate (ISO) dicrotophos (ISO) diethylstilbestrol (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Ethyl acrylate (ISO) flutamide (EXP) folic acid (ISO) FR900359 (ISO) fulvestrant (ISO) hydrogen peroxide (ISO) ivermectin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury dibromide (ISO) methylmercury chloride (ISO) methylparaben (ISO) N-nitrosodimethylamine (ISO) nefazodone (EXP) oxaliplatin (EXP) p-chloromercuribenzoic acid (ISO) para-Cresidine (ISO) paracetamol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) piroxicam (ISO) potassium chromate (ISO) rac-lactic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenite (ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) thimerosal (ISO) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) trimellitic anhydride (ISO) triphenyl phosphate (ISO) valproic acid (ISO) zinc protoporphyrin (ISO)
Asf1a (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 33,436,632 - 33,451,478 (+) NCBI GRCr8 mRatBN7.2 20 32,893,962 - 32,908,808 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 32,893,573 - 32,908,808 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 33,933,507 - 33,948,491 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 33,324,220 - 33,339,204 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 34,051,143 - 34,066,130 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 34,894,419 - 34,909,265 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 34,894,419 - 34,909,265 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 36,651,864 - 36,666,710 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 32,261,624 - 32,276,470 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 32,242,606 - 32,288,661 (+) NCBI Celera 20 34,286,255 - 34,301,101 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
ASF1A (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 118,894,152 - 118,909,171 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 118,894,152 - 118,909,171 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 119,215,316 - 119,230,336 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 119,263,628 - 119,272,035 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 119,263,627 - 119,272,029 NCBI Celera 6 119,959,803 - 119,974,994 (+) NCBI Celera Cytogenetic Map 6 q22.31 NCBI HuRef 6 116,797,372 - 116,812,467 (+) NCBI HuRef CHM1_1 6 119,479,284 - 119,494,377 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 120,079,995 - 120,095,013 (+) NCBI T2T-CHM13v2.0
Asf1a (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 53,473,057 - 53,485,321 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 53,472,853 - 53,485,321 (+) Ensembl GRCm39 Ensembl GRCm38 10 53,596,961 - 53,609,225 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 53,596,757 - 53,609,225 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 53,316,767 - 53,329,031 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 53,285,376 - 53,297,640 (+) NCBI MGSCv36 mm8 Celera 10 54,424,436 - 54,436,700 (+) NCBI Celera Cytogenetic Map 10 B3 NCBI cM Map 10 27.24 NCBI
Asf1a (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955436 1,635,399 - 1,645,075 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955436 1,635,397 - 1,640,989 (+) NCBI ChiLan1.0 ChiLan1.0
ASF1A (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 138,907,808 - 138,923,010 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 136,805,190 - 136,818,669 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 116,702,314 - 116,717,445 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 120,843,523 - 120,858,477 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 120,843,461 - 120,858,471 (+) Ensembl panpan1.1 panPan2
ASF1A (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 58,821,324 - 58,834,935 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 58,821,521 - 58,946,475 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 59,624,039 - 59,637,812 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 59,005,923 - 59,019,731 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 59,006,146 - 59,024,788 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 58,906,233 - 58,920,041 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 58,747,902 - 58,761,670 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 59,379,406 - 59,393,234 (+) NCBI UU_Cfam_GSD_1.0
Asf1a (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 109,592,255 - 109,606,875 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936658 1,699,044 - 1,715,582 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936658 1,699,150 - 1,713,079 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ASF1A (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 43,200,415 - 43,214,913 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 43,200,339 - 43,215,019 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 48,350,741 - 48,365,279 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ASF1A (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 54,972,514 - 54,988,436 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 54,969,299 - 54,988,558 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 27,296,097 - 27,311,554 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Asf1a (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 524 Count of miRNA genes: 252 Interacting mature miRNAs: 312 Transcripts: ENSRNOT00000000471 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
4889610 Pancm3 Pancreatic morphology QTL 3 3.75 0.001 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 20 17617832 47606836 Rat 2303587 Bw93 Body weight QTL 93 13 body mass (VT:0001259) body weight (CMO:0000012) 20 25106722 54435887 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 2303626 Vencon10 Ventilatory control QTL 10 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 20 19190721 54435887 Rat 1598869 Memor6 Memory QTL 6 3.1 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 20 29244388 54435887 Rat 70158 Bp60 Blood pressure QTL 60 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 31614284 44396023 Rat 7411652 Foco24 Food consumption QTL 24 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 11757515 54435887 Rat 1331747 Hrtrt16 Heart rate QTL 16 3.163 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 20 25209734 54435887 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 2303578 Gluco50 Glucose level QTL 50 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 20 25106722 54435887 Rat 2317880 Alcrsp25 Alcohol response QTL 25 2.3 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 17697550 54435887 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 9590092 Insglur9 Insulin/glucose ratio QTL 9 18.38 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 20 11757515 54435887 Rat 2300188 Bmd68 Bone mineral density QTL 68 6.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 20 25106722 54435887 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000471 ⟹ ENSRNOP00000000471
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 32,893,573 - 32,908,808 (+) Ensembl Rnor_6.0 Ensembl 20 34,894,419 - 34,909,265 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000084420 ⟹ ENSRNOP00000068723
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 34,895,059 - 34,907,451 (+) Ensembl
RefSeq Acc Id:
NM_001106389 ⟹ NP_001099859
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 33,436,632 - 33,451,478 (+) NCBI mRatBN7.2 20 32,893,962 - 32,908,808 (+) NCBI Rnor_6.0 20 34,894,419 - 34,909,265 (+) NCBI Rnor_5.0 20 36,651,864 - 36,666,710 (+) NCBI RGSC_v3.4 20 32,261,624 - 32,276,470 (+) RGD Celera 20 34,286,255 - 34,301,101 (+) RGD
Sequence:
GCGGCCGCGCGCGGGACTCTGTGGTGCCGCCAGCCCCGGCCCCATTGTTTGTGTTTTCTTCAAAATATGGCAAAGGTTCAGGTGAACAATGTAGTGGTGCTGGATAACCCGTCGCCTTTCTACAACCC GTTCCAGTTCGAGATCACCTTCGAGTGCATCGAGGACCTGTCTGAAGACTTGGAGTGGAAAATTATCTACGTGGGCTCTGCTGAAAGTGAAGAATACGATCAAGTTTTAGACTCTGTGTTAGTGGGTC CTGTTCCTGCAGGCAGGCATATGTTTGTGTTTCAGGCTGATGCGCCAAACGCGGGGCTCATCCCAGACGCAGACGCAGTGGGGGTAACAGTTGTACTGATTACCTGCACCTACCGAGGTCAAGAATTT ATTAGAGTTGGCTACTATGTAAATAATGAATATACTGAAACAGAATTAAGGGAAAACCCACCAGTAAAACCAGACTTTTCTAAGCTTCAAAGGAATATTTTGGCTTCTAATCCCAGAGTCACAAGGTT CCACATTAACTGGGAAGATAACACAGAGAAACTGGAAGACGCAGAGAGCAGTGACCCCAATCTGCAGTCCCTTCTTTCCACAGATGCACTGCCTTCAGCATCAAAGGGATGGGCGACGTCAGAAAACT CACTCAGTGTCATGTTAGAATCCCACATGGACTGCATGTGACACGTGCCATGCCATTAGTACAGATTAAGCTATTAAAACAGAACTATCTCCCTGAAGTTCCGTAAGTACATAGTCAACGTGAAATGT GAAGAATTTGTTTAAAAACATCCTGTAGAAAGTTTATAAGAAAACCAGTATTTGAGCAAATTGTGGAATATAAATACAACTATTTTTAAGGACTTTTTTTCTCTAATGTGTTATTTTATTTGTTCATG AAACTAATCTGATTAAAGCATATATATTATTTTCTTCTCTTTTATATGTAATTAAAGCACTTATAAAAAGAAAAGTTATCAATTCTTAGACTGGGTTGTAAAGGTGTTTTAGCCTCTTGGACAATAAG ATTTATCAGCTTTTAAAAGGACAAAGTTTACTTCAACTAAAATGATTTTTCCTGTGAAGATAGTATCCTTATAATTTGACAAGAAAATTTCCATTCTGTAGTAAAAAAGATAGATTTAAAATGGGATT TGAAATCAATCACATGCCACCAGGGTTTTTCTAGGCCATCCCAGTGCATCTTACTACAGTTCACATTAAACTGGACTTCTAGTTTTTATATAACAAATGCGGCTGCCTTTGAAGTCCTTCTGACTATC GTGTATGCTTTCCTACATCTAAAACTGAGAAACTATGATCCTAAGCCATCACTGTCTAGAGAGTCCAACACATAAGAGCAAACATAAGGTCTCTGAAGTGTAAGACTCCATTATGATGGCTCAGATCT GCTCACTCTTTCTGCTTACAGGAATGCTGAACGTGCGTTGCTGGCACCATTACTATTGAAGGGTGATTTAGGAAGGTCTAGTCAGCTTCATCCTGGCTAGCGACTCTAGAGAGTATGTCTTACCTTTT GCAGCCACACTACCCCATATCCTTTGGTTCTCATAATGTGTAAGATCAGGGCATTATCTGTAGTTAACATAACAGCTTAACCACTTTTTTTTTTCTCAGAAGAATAGTTTTAGAAAGGAATTCACCAA ATAAATGGGCCAAAAGCTTATTTTCTTTAATGAGAAGTAAATCCTCAAAGTTTTGATCCATTAAATTGACAGTACAATATTCTCAGTTGTTATCAGTGATGATGCCCAGGATAGCCATAGGTTCAAGT TATGCAGTGCCTTCACATCTAAGCTTTTATACTGCACTTTCAAAAGCATTTTGAGGAAAAGGAAGGGGTATTTATTTAAATACAGACTCTATAAGTTGTAATATATTTCTTGCTTTTTTTAAAAGATA AATTTGTGAAACAAAGTCTTGTTAAATGTTAAACTTTGAAATTTAAGACTCCATATTACCCAGTTCATAGATTTTAAAAATAAATATTTCTGGCTACTAAAATGATTTGAAAAAAAAATCTCATTTTG TCTAACTACAATTAGGAGAAAATGTTTAAGACAGTTCAGTGATCAGTACAGTAAGAATAAGTTTGTCAGAAATAAAGATAATTAAATCACCAAGTAAAGCAACTCAGTGCAGTCTTAGATTATAGAAC CACTTTGTGATGACATGCTTAGGTCTTTATACCAAACTTTAAATATATGGCCCATAGTCACAAAAGTCGGAGAAATAAAATACTGCCTTTTATTATTTAAATGCAATAGCATTTAAATTTAAAAGTGA AAGAAGAATAGAAACATTTACACATTAAGAACTAAGAAACTAGCATGCAGGGATTTTCCTCCTGATTAGCCTCATTTAAAAAGACATTATGTCTGAATTACAGTTAAAAGGCTTATAGACTCCGCTCC ACCCCACTTCTTTTGAGATATGGTCTCTCAACATAGCCCTGGCTGTCCTGAACTTTCCTTAGACCAGTGTAGCCTTCAGCTCACAGACATCCACCTGCTTCTGCCTCCTGAGAGCTGGGATTAAAGGC ATTCGACTCCACACCCTGCACCACTTCCTTGTTTCTATCAGTATAAATAAATGTCTGGTGAATACGTACACATACAACACACACATATGCACACACACAGTCCACACCGCTGAAGAGCTAGGGGAGTA GGTTA
hide sequence
RefSeq Acc Id:
NP_001099859 ⟸ NM_001106389
- UniProtKB:
A6K496 (UniProtKB/TrEMBL)
- Sequence:
MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLDSVLVGPVPAGRHMFVFQADAPNAGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYTETELRENPPV KPDFSKLQRNILASNPRVTRFHINWEDNTEKLEDAESSDPNLQSLLSTDALPSASKGWATSENSLSVMLESHMDCM
hide sequence
Ensembl Acc Id:
ENSRNOP00000068723 ⟸ ENSRNOT00000084420
Ensembl Acc Id:
ENSRNOP00000000471 ⟸ ENSRNOT00000000471
RGD ID: 13701629
Promoter ID: EPDNEW_R12153
Type: single initiation site
Name: Asf1a_1
Description: anti-silencing function 1A histone chaperone
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 34,894,364 - 34,894,424 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-09-12
Asf1a
anti-silencing function 1A histone chaperone
Asf1a
ASF1 anti-silencing function 1 homolog A (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-04-30
Asf1a
ASF1 anti-silencing function 1 homolog A (S. cerevisiae)
Asf1a_predicted
ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (predicted)
'predicted' is removed
2292626
APPROVED
2005-01-12
Asf1a_predicted
ASF1 anti-silencing function 1 homolog A (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820
APPROVED