Symbol:
Flnb
Name:
filamin B
RGD ID:
1311915
Description:
Predicted to enable identical protein binding activity. Predicted to act upstream of or within several processes, including cellular response to type II interferon; epithelial cell development; and skeletal muscle tissue development. Located in neuronal cell body. Human ortholog(s) of this gene implicated in Larsen syndrome; bone development disease (multiple); cleft palate; and spinal disease (multiple). Orthologous to human FLNB (filamin B); PARTICIPATES IN integrin mediated signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
filamin B, beta; filamin, beta; filamin-B; filamin-B-like; LOC100911261; LOC306204
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FLNB (filamin B) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Flnb (filamin, beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Flnb (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FLNB (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FLNB (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Flnb (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FLNB (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FLNB (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Flnb (filamin B) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NR1I3 (nuclear receptor subfamily 1 group I member 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
FLNB (filamin B)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Flnb (filamin, beta)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
flnb (filamin B, beta (actin binding protein 278))
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
fln-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
cher
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
flnb
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 19,392,212 - 19,525,278 (-) NCBI GRCr8 mRatBN7.2 15 16,961,999 - 17,095,059 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 16,962,003 - 17,095,006 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 19,136,669 - 19,269,742 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 20,095,144 - 20,228,215 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 18,350,059 - 18,483,132 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 18,750,152 - 18,883,019 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 18,750,118 - 18,883,005 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 22,716,606 - 22,849,401 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 18,949,027 - 19,082,504 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 18,950,017 - 19,108,490 (-) NCBI Celera 15 16,918,384 - 17,051,016 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Flnb Rat bone development disease ISO RGD:1323621 1601168 Larsen syndrome,OMIM:150250;DNA:point mutation:exon:F161C RGD Flnb Rat bone development disease ISO RGD:1323621 1601170 boomerang dysplasia,OMIM:112310;DNA:point mutation:exon:L171R,S235P RGD Flnb Rat cleft palate susceptibility ISO RGD:1323621 12791026 DNA:SNPs:: RGD Flnb Rat clubfoot ISO RGD:1323621 12791025 DNA:missense mutations:cds:c.4717G>T (p.D1573Y), c.1897A>G(p.M633V,c.2195A>G (p.Y732C)(human) RGD Flnb Rat Larsen Syndromes ISO RGD:1323621 12791029 DNA:deletion, missense mutations:cds: RGD Flnb Rat osteochondrodysplasia ISO RGD:1323621 1601168 atelosteogenesis type I,OMIM:108720;DNA:point mutation:exon:A173V RGD Flnb Rat osteochondrodysplasia ISO RGD:1323621 12791027 DNA:missense, deletion mutations:exons: RGD Flnb Rat spinal disease ISO RGD:1323621 1601168 spondylocarpotarsal syndrome,OMIM:272460;DNA:frameshift:6408delC,DNA:point mutation:exons:R818X,R1607X RGD Flnb Rat spondylocarpotarsal synostosis syndrome ISO RGD:1323622 12791028 RGD
Flnb Rat Atelosteogenesis Type 1 ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Atelosteogenesis type I | ClinVar Annotator: match by term: Spondylohumerofemoral more ... ClinVar PMID:14991055|PMID:16752402|PMID:20301736|PMID:22190451|PMID:24624349|PMID:25741868|PMID:28492532 Flnb Rat Atelosteogenesis Type 3 ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Atelosteogenesis type 3 | ClinVar Annotator: match by term: Atelosteogenesis more ... ClinVar PMID:14991055|PMID:16648377|PMID:16752402|PMID:16801345|PMID:17576681|PMID:20301736|PMID:22190451|PMID:25741868|PMID:27048506|PMID:27395407|PMID:28492532|PMID:30544257|PMID:36653407|PMID:9536098 Flnb Rat Boomerang dysplasia ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Boomerang dysplasia | ClinVar Annotator: match by term: Boomerang-like skeletal more ... ClinVar PMID:12955767|PMID:14991055|PMID:17510210|PMID:25741868|PMID:28492532 Flnb Rat connective tissue disease ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Connective tissue disorder ClinVar PMID:14991055|PMID:17576681|PMID:25741868|PMID:28492532|PMID:9536098 Flnb Rat connective tissue disease ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Connective tissue disease | ClinVar Annotator: match by term: Connective more ... ClinVar PMID:14991055|PMID:17576681|PMID:20301736|PMID:25741868|PMID:28492532|PMID:9536098 Flnb Rat Dwarfism ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Short stature ClinVar Flnb Rat genetic disease ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:14991055|PMID:16199547|PMID:16752402|PMID:16801345|PMID:17576681|PMID:19085972|PMID:20301736|PMID:22190451|PMID:25741868|PMID:26491051|PMID:28492532|PMID:30712878|PMID:34491919|PMID:9536098 Flnb Rat Knee Dislocation ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Knee dislocation ClinVar PMID:25741868|PMID:28492532|PMID:31836586 Flnb Rat Larsen syndrome ISO RGD:1323621 8554872 ClinVar Annotator: match by term: FLNB-Related Spectrum Disorders | ClinVar Annotator: match by term: Larsen more ... ClinVar PMID:14991055|PMID:16648377|PMID:16752402|PMID:16801345|PMID:17576681|PMID:18322662|PMID:19085972|PMID:20301736|PMID:21620354|PMID:22190451|PMID:24123776|PMID:25741868|PMID:26380986|PMID:26491051|PMID:27048506|PMID:28229453|PMID:28492532|PMID:29566257|PMID:30544257|PMID:30712878|PMID:31836586|PMID:9536098 Flnb Rat myofibrillar myopathy 5 ISO RGD:1323621 8554872 ClinVar Annotator: match by term: FLNB-Related Disorders | ClinVar Annotator: match by term: Myofibrillar myopathy more ... ClinVar PMID:14991055|PMID:16648377|PMID:16752402|PMID:16801345|PMID:17576681|PMID:19085972|PMID:20301736|PMID:21620354|PMID:22190451|PMID:25741868|PMID:26491051|PMID:28492532|PMID:30712878|PMID:34491919|PMID:9536098 Flnb Rat Pyruvate Dehydrogenase E1-Beta Deficiency ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Pyruvate dehydrogenase E1-beta deficiency ClinVar PMID:28492532 Flnb Rat spondylocarpotarsal synostosis syndrome ISO RGD:1323621 8554872 ClinVar Annotator: match by term: Scoliosis, congenital with unilateral unsegmented bar | ClinVar Annotator: match more ... ClinVar PMID:14991055|PMID:17576681|PMID:18257094|PMID:18322662|PMID:18386804|PMID:20301736|PMID:22190451|PMID:25741868|PMID:26380986|PMID:28492532|PMID:29566257|PMID:31836586|PMID:33407338|PMID:9536098
Only show annotations with direct experimental evidence (0 objects hidden)
Flnb Rat 1,2-dimethylhydrazine affects expression ISO RGD:1323622 6480464 1,2-Dimethylhydrazine affects the expression of FLNB mRNA CTD PMID:22206623 Flnb Rat 1-chloro-2,4-dinitrobenzene affects binding ISO RGD:1323621 6480464 Dinitrochlorobenzene binds to FLNB protein CTD PMID:32991956 Flnb Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FLNB mRNA CTD PMID:20068009 Flnb Rat 17beta-estradiol increases expression ISO RGD:1323621 6480464 Estradiol results in increased expression of FLNB mRNA CTD PMID:31614463 Flnb Rat 17beta-estradiol decreases expression ISO RGD:1323622 6480464 Estradiol results in decreased expression of FLNB mRNA CTD PMID:39298647 Flnb Rat 17beta-estradiol multiple interactions ISO RGD:1323621 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of FLNB mRNA CTD PMID:30165855 Flnb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1323621 6480464 Tetrachlorodibenzodioxin results in increased expression of FLNB mRNA CTD PMID:12377990 Flnb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FLNB mRNA CTD PMID:33387578|PMID:34747641 Flnb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1323622 6480464 Tetrachlorodibenzodioxin results in decreased expression of FLNB mRNA CTD PMID:20159946|PMID:26290441 Flnb Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of FLNB mRNA CTD PMID:32109520 Flnb Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1323621 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Flnb Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of FLNB mRNA CTD PMID:21346803 Flnb Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of FLNB mRNA CTD PMID:19692669 Flnb Rat 3,4-methylenedioxymethamphetamine decreases expression ISO RGD:1323622 6480464 N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of FLNB mRNA CTD PMID:26251327 Flnb Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of FLNB protein CTD PMID:34915118 Flnb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Flnb Rat 4,4'-sulfonyldiphenol multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] more ... CTD PMID:28628672 Flnb Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1323622 6480464 bisphenol S results in decreased expression of FLNB mRNA CTD PMID:33297965|PMID:39298647 Flnb Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1323622 6480464 bisphenol S results in increased expression of FLNB mRNA CTD PMID:30951980 Flnb Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1323622 6480464 Fenretinide results in increased expression of FLNB mRNA CTD PMID:28973697 Flnb Rat 5-aza-2'-deoxycytidine decreases expression ISO RGD:1323622 6480464 Decitabine results in decreased expression of FLNB mRNA CTD PMID:27915011 Flnb Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of FLNB mRNA CTD PMID:31881176 Flnb Rat aflatoxin B1 decreases expression ISO RGD:1323622 6480464 Aflatoxin B1 results in decreased expression of FLNB mRNA CTD PMID:19770486 Flnb Rat aflatoxin B1 increases methylation ISO RGD:1323621 6480464 Aflatoxin B1 results in increased methylation of FLNB exon CTD PMID:30157460 Flnb Rat all-trans-retinoic acid increases expression ISO RGD:1323621 6480464 Tretinoin results in increased expression of FLNB mRNA; Tretinoin results in increased expression of FLNB more ... CTD PMID:16012519|PMID:17431108|PMID:30093655 Flnb Rat all-trans-retinoic acid multiple interactions ISO RGD:1323622 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of FLNB mRNA CTD PMID:30951980 Flnb Rat antirheumatic drug decreases expression ISO RGD:1323621 6480464 Antirheumatic Agents results in decreased expression of FLNB mRNA CTD PMID:24449571 Flnb Rat arsane affects methylation ISO RGD:1323621 6480464 Arsenic affects the methylation of FLNB gene CTD PMID:25304211 Flnb Rat arsane multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat arsenic atom affects methylation ISO RGD:1323621 6480464 Arsenic affects the methylation of FLNB gene CTD PMID:25304211 Flnb Rat arsenic atom multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat arsenite(3-) increases expression ISO RGD:1323622 6480464 arsenite results in increased expression of FLNB mRNA CTD PMID:18191166 Flnb Rat arsenite(3-) multiple interactions ISO RGD:1323621 6480464 arsenite inhibits the reaction [G3BP1 protein binds to FLNB mRNA] CTD PMID:32406909 Flnb Rat arsenous acid decreases response to substance ISO RGD:1323621 6480464 FLNB protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Flnb Rat arsenous acid decreases expression ISO RGD:1323621 6480464 Arsenic Trioxide results in decreased expression of FLNB protein CTD PMID:25419056 Flnb Rat arsenous acid increases expression ISO RGD:1323621 6480464 Arsenic Trioxide results in increased expression of FLNB protein CTD PMID:30093655 Flnb Rat benzo[a]pyrene decreases expression ISO RGD:1323622 6480464 Benzo(a)pyrene results in decreased expression of FLNB mRNA CTD PMID:19770486 Flnb Rat benzo[a]pyrene increases methylation ISO RGD:1323621 6480464 Benzo(a)pyrene results in increased methylation of FLNB promoter CTD PMID:27901495 Flnb Rat benzo[a]pyrene affects methylation ISO RGD:1323621 6480464 Benzo(a)pyrene affects the methylation of FLNB exon CTD PMID:30157460 Flnb Rat benzo[a]pyrene increases methylation ISO RGD:1323622 6480464 Benzo(a)pyrene results in increased methylation of FLNB exon; Benzo(a)pyrene results in increased methylation of FLNB more ... CTD PMID:27901495 Flnb Rat benzo[a]pyrene decreases expression ISO RGD:1323621 6480464 Benzo(a)pyrene results in decreased expression of FLNB protein CTD PMID:32717239 Flnb Rat benzo[b]fluoranthene increases expression ISO RGD:1323622 6480464 benzo(b)fluoranthene results in increased expression of FLNB mRNA CTD PMID:26377693 Flnb Rat Benzo[k]fluoranthene decreases expression ISO RGD:1323621 6480464 benzo(k)fluoranthene results in decreased expression of FLNB mRNA CTD PMID:21635667 Flnb Rat beta-lapachone increases expression ISO RGD:1323621 6480464 beta-lapachone results in increased expression of FLNB mRNA CTD PMID:38218311 Flnb Rat bis(2-ethylhexyl) phthalate increases expression ISO RGD:1323621 6480464 Diethylhexyl Phthalate results in increased expression of FLNB mRNA CTD PMID:31163220 Flnb Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1323622 6480464 Diethylhexyl Phthalate results in decreased expression of FLNB mRNA CTD PMID:34319233 Flnb Rat bisphenol A increases expression ISO RGD:1323622 6480464 bisphenol A results in increased expression of FLNB mRNA CTD PMID:23704952|PMID:26063408|PMID:29165653|PMID:32156529 Flnb Rat bisphenol A increases expression ISO RGD:1323621 6480464 bisphenol A results in increased expression of FLNB protein CTD PMID:37567409 Flnb Rat bisphenol A affects expression ISO RGD:1323621 6480464 bisphenol A affects the expression of FLNB protein CTD PMID:34186270 Flnb Rat bisphenol A affects methylation ISO RGD:1323621 6480464 bisphenol A affects the methylation of FLNB gene CTD PMID:31601247 Flnb Rat bisphenol A decreases expression ISO RGD:1323621 6480464 bisphenol A results in decreased expression of FLNB protein CTD PMID:33376534 Flnb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FLNB mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Flnb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of FLNB gene CTD PMID:28505145 Flnb Rat bisphenol A multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Flnb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of FLNB mRNA CTD PMID:25181051 Flnb Rat bisphenol AF increases expression ISO RGD:1323621 6480464 bisphenol AF results in increased expression of FLNB protein CTD PMID:34186270 Flnb Rat Bisphenol B increases expression ISO RGD:1323621 6480464 bisphenol B results in increased expression of FLNB protein CTD PMID:34186270 Flnb Rat bisphenol F multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Flnb Rat bisphenol F increases expression ISO RGD:1323621 6480464 bisphenol F results in increased expression of FLNB protein CTD PMID:34186270 Flnb Rat bisphenol F multiple interactions ISO RGD:1323622 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of FLNB mRNA CTD PMID:30951980 Flnb Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of FLNB mRNA CTD PMID:32479839 Flnb Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of FLNB mRNA CTD PMID:19167457 Flnb Rat cadmium atom increases expression ISO RGD:1323621 6480464 Cadmium results in increased expression of FLNB mRNA CTD PMID:24376830 Flnb Rat cadmium atom increases oxidation ISO RGD:1323622 6480464 Cadmium results in increased oxidation of FLNB protein CTD PMID:24077948 Flnb Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of FLNB promoter CTD PMID:22457795 Flnb Rat cadmium dichloride increases expression ISO RGD:1323621 6480464 Cadmium Chloride results in increased expression of FLNB mRNA CTD PMID:38568856 Flnb Rat caffeine affects phosphorylation ISO RGD:1323621 6480464 Caffeine affects the phosphorylation of FLNB protein CTD PMID:35688186 Flnb Rat carbamazepine affects expression ISO RGD:1323621 6480464 Carbamazepine affects the expression of FLNB mRNA CTD PMID:25979313 Flnb Rat carbon nanotube increases expression ISO RGD:1323622 6480464 Nanotubes, Carbon analog results in increased expression of FLNB mRNA; Nanotubes, Carbon results in increased more ... CTD PMID:25554681|PMID:25620056 Flnb Rat chloropicrin decreases expression ISO RGD:1323621 6480464 chloropicrin results in decreased expression of FLNB mRNA CTD PMID:26352163|PMID:28476498 Flnb Rat choline multiple interactions ISO RGD:1323622 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Flnb Rat ciglitazone multiple interactions ISO RGD:1323621 6480464 [ciglitazone binds to PPARG protein alternative form] which results in increased expression of FLNB mRNA CTD PMID:16197558 Flnb Rat cisplatin decreases expression ISO RGD:1323621 6480464 Cisplatin results in decreased expression of FLNB mRNA CTD PMID:19561079|PMID:27594783 Flnb Rat cobalt dichloride decreases expression ISO RGD:1323621 6480464 cobaltous chloride results in decreased expression of FLNB mRNA CTD PMID:19320972 Flnb Rat cobalt dichloride increases expression ISO RGD:1323621 6480464 cobaltous chloride results in increased expression of FLNB mRNA CTD PMID:22941251 Flnb Rat copper atom multiple interactions ISO RGD:1323621 6480464 [Chelating Agents binds to Copper] which results in increased expression of FLNB mRNA; [NSC 689534 more ... CTD PMID:20971185|PMID:30911355 Flnb Rat copper(0) multiple interactions ISO RGD:1323621 6480464 [Chelating Agents binds to Copper] which results in increased expression of FLNB mRNA; [NSC 689534 more ... CTD PMID:20971185|PMID:30911355 Flnb Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of FLNB mRNA CTD PMID:26577399 Flnb Rat cyclosporin A increases expression ISO RGD:1323621 6480464 Cyclosporine results in increased expression of FLNB mRNA CTD PMID:20106945 Flnb Rat dexamethasone multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Flnb Rat diarsenic trioxide decreases response to substance ISO RGD:1323621 6480464 FLNB protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 Flnb Rat diarsenic trioxide decreases expression ISO RGD:1323621 6480464 Arsenic Trioxide results in decreased expression of FLNB protein CTD PMID:25419056 Flnb Rat diarsenic trioxide increases expression ISO RGD:1323621 6480464 Arsenic Trioxide results in increased expression of FLNB protein CTD PMID:30093655 Flnb Rat dibenz[a,h]anthracene increases expression ISO RGD:1323622 6480464 1,2,5,6-dibenzanthracene results in increased expression of FLNB mRNA CTD PMID:26377693 Flnb Rat dibenzo[a,l]pyrene decreases expression ISO RGD:1323622 6480464 dibenzo(a,l)pyrene results in decreased expression of FLNB mRNA CTD PMID:25908611 Flnb Rat dicrotophos increases expression ISO RGD:1323621 6480464 dicrotophos results in increased expression of FLNB mRNA CTD PMID:28302478 Flnb Rat dimethylselenide multiple interactions ISO RGD:1323621 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of FLNB-AS1 more ... CTD PMID:33656867 Flnb Rat dorsomorphin multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Flnb Rat doxorubicin increases expression ISO RGD:1323621 6480464 Doxorubicin results in increased expression of FLNB mRNA CTD PMID:29803840 Flnb Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of FLNB mRNA CTD PMID:29391264 Flnb Rat entinostat multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ... CTD PMID:27188386 Flnb Rat entinostat increases expression ISO RGD:1323621 6480464 entinostat results in increased expression of FLNB mRNA CTD PMID:26272509|PMID:27188386 Flnb Rat enzyme inhibitor multiple interactions ISO RGD:1323621 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Flnb Rat ethanol increases expression ISO RGD:1323621 6480464 Ethanol results in increased expression of FLNB mRNA CTD PMID:28986285 Flnb Rat ethylparaben increases expression ISO RGD:1323621 6480464 ethyl-p-hydroxybenzoate results in increased expression of FLNB mRNA CTD PMID:37690743 Flnb Rat fenamidone increases expression ISO RGD:1323622 6480464 fenamidone results in increased expression of FLNB mRNA CTD PMID:27029645 Flnb Rat fenthion decreases expression ISO RGD:1323622 6480464 Fenthion results in decreased expression of FLNB mRNA CTD PMID:34813904 Flnb Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of FLNB mRNA CTD PMID:24136188 Flnb Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of FLNB mRNA CTD PMID:24793618 Flnb Rat folic acid multiple interactions ISO RGD:1323622 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Flnb Rat FR900359 affects phosphorylation ISO RGD:1323621 6480464 FR900359 affects the phosphorylation of FLNB protein CTD PMID:37730182 Flnb Rat furan increases methylation EXP 6480464 furan results in increased methylation of FLNB gene CTD PMID:22079235 Flnb Rat furfural multiple interactions ISO RGD:1323621 6480464 [pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization more ... CTD PMID:38598786 Flnb Rat genistein increases methylation EXP 6480464 Genistein results in increased methylation of FLNB gene CTD PMID:28505145 Flnb Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of FLNB mRNA CTD PMID:33387578 Flnb Rat glycidyl methacrylate increases expression ISO RGD:1323621 6480464 glycidyl methacrylate results in increased expression of FLNB protein CTD PMID:36641056 Flnb Rat glyphosate decreases expression ISO RGD:1323621 6480464 Glyphosate results in decreased expression of FLNB mRNA CTD PMID:31295307 Flnb Rat hydrogen peroxide multiple interactions ISO RGD:1323622 6480464 N-(oxo-5,6-dihydrophenanthridin-2-yl)-N,N-dimethylacetamide hydrochloride promotes the reaction [Hydrogen Peroxide results in increased phosphorylation of FLNB protein] CTD PMID:31494107 Flnb Rat hydroxyl multiple interactions ISO RGD:1323621 6480464 [[Hydroxyl Radical results in increased oxidation of dimethylselenide] which results in decreased expression of FLNB-AS1 more ... CTD PMID:33656867 Flnb Rat indometacin multiple interactions ISO RGD:1323621 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Flnb Rat inulin multiple interactions ISO RGD:1323622 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FLNB mRNA CTD PMID:36331819 Flnb Rat ivermectin decreases expression ISO RGD:1323621 6480464 Ivermectin results in decreased expression of FLNB protein CTD PMID:32959892 Flnb Rat L-methionine multiple interactions ISO RGD:1323622 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Flnb Rat manganese atom multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat manganese(0) multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat manganese(II) chloride multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat menadione decreases expression ISO RGD:1323622 6480464 Vitamin K 3 results in decreased expression of FLNB mRNA CTD PMID:25270620 Flnb Rat mercury atom increases expression ISO RGD:1323621 6480464 Mercury results in increased expression of FLNB mRNA CTD PMID:19937285 Flnb Rat mercury dibromide increases expression ISO RGD:1323621 6480464 mercuric bromide results in increased expression of FLNB mRNA CTD PMID:26272509 Flnb Rat mercury dibromide multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Flnb Rat mercury(0) increases expression ISO RGD:1323621 6480464 Mercury results in increased expression of FLNB mRNA CTD PMID:19937285 Flnb Rat methamphetamine increases expression ISO RGD:1323622 6480464 Methamphetamine results in increased expression of FLNB mRNA CTD PMID:26307267 Flnb Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of FLNB mRNA CTD PMID:30467583 Flnb Rat methidathion decreases expression ISO RGD:1323622 6480464 methidathion results in decreased expression of FLNB mRNA CTD PMID:34813904 Flnb Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of FLNB gene CTD PMID:35440735 Flnb Rat methylmercury chloride increases expression ISO RGD:1323621 6480464 methylmercuric chloride results in increased expression of FLNB mRNA CTD PMID:28001369 Flnb Rat okadaic acid increases expression ISO RGD:1323621 6480464 Okadaic Acid results in increased expression of FLNB mRNA CTD PMID:38832940 Flnb Rat ozone multiple interactions ISO RGD:1323621 6480464 [[Ozone results in increased oxidation of dimethylselenide] which results in decreased expression of FLNB-AS1 mRNA] more ... CTD PMID:33656867 Flnb Rat panobinostat increases expression ISO RGD:1323621 6480464 panobinostat results in increased expression of FLNB mRNA CTD PMID:26272509 Flnb Rat paracetamol affects expression ISO RGD:1323622 6480464 Acetaminophen affects the expression of FLNB mRNA CTD PMID:17562736 Flnb Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of FLNB mRNA CTD PMID:33387578 Flnb Rat paracetamol increases expression ISO RGD:1323621 6480464 Acetaminophen results in increased expression of FLNB mRNA CTD PMID:29067470 Flnb Rat paracetamol decreases expression ISO RGD:1323621 6480464 Acetaminophen results in decreased expression of FLNB mRNA CTD PMID:21420995 Flnb Rat perfluorononanoic acid increases expression ISO RGD:1323621 6480464 perfluoro-n-nonanoic acid results in increased expression of FLNB mRNA CTD PMID:32588087 Flnb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1323622 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of FLNB mRNA CTD PMID:36331819 Flnb Rat phenobarbital decreases expression ISO RGD:1323622 6480464 Phenobarbital results in decreased expression of FLNB mRNA CTD PMID:23091169 Flnb Rat phenylmercury acetate increases expression ISO RGD:1323621 6480464 Phenylmercuric Acetate results in increased expression of FLNB mRNA CTD PMID:26272509 Flnb Rat phenylmercury acetate multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Flnb Rat piroxicam decreases expression ISO RGD:1323621 6480464 Piroxicam results in decreased expression of FLNB mRNA CTD PMID:21858171 Flnb Rat quercetin increases expression ISO RGD:1323621 6480464 Quercetin results in increased expression of FLNB mRNA CTD PMID:21632981 Flnb Rat raloxifene multiple interactions ISO RGD:1323621 6480464 [Raloxifene Hydrochloride co-treated with ESR2 protein] results in decreased expression of FLNB mRNA; ESR2 protein more ... CTD PMID:14699072|PMID:19059307 Flnb Rat raloxifene affects expression ISO RGD:1323621 6480464 Raloxifene Hydrochloride affects the expression of FLNB mRNA CTD PMID:14699072 Flnb Rat rofecoxib increases expression ISO RGD:1323621 6480464 rofecoxib results in increased expression of FLNB mRNA CTD PMID:17070997 Flnb Rat SB 431542 multiple interactions ISO RGD:1323621 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of FLNB more ... CTD PMID:27188386|PMID:37664457 Flnb Rat silicon dioxide affects secretion ISO RGD:1323621 6480464 Silicon Dioxide analog affects the secretion of FLNB protein CTD PMID:25895662 Flnb Rat sodium arsenate increases expression ISO RGD:1323622 6480464 sodium arsenate results in increased expression of FLNB mRNA CTD PMID:21795629 Flnb Rat sodium arsenite multiple interactions ISO RGD:1323621 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Flnb Rat sodium arsenite increases expression ISO RGD:1323622 6480464 sodium arsenite results in increased expression of FLNB mRNA CTD PMID:36209798 Flnb Rat sodium chloride multiple interactions ISO RGD:1323621 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of FLNB protein; [Sodium Chloride co-treated more ... CTD PMID:38598786 Flnb Rat Soman increases expression EXP 6480464 Soman results in increased expression of FLNB mRNA CTD PMID:19281266 Flnb Rat sulindac increases expression EXP 6480464 Sulindac results in increased expression of FLNB mRNA CTD PMID:24136188 Flnb Rat sunitinib decreases expression ISO RGD:1323621 6480464 Sunitinib results in decreased expression of FLNB mRNA CTD PMID:31533062 Flnb Rat tamoxifen increases expression ISO RGD:1323622 6480464 Tamoxifen results in increased expression of FLNB mRNA CTD PMID:25123088 Flnb Rat tamoxifen affects expression ISO RGD:1323621 6480464 Tamoxifen affects the expression of FLNB mRNA CTD PMID:14699072 Flnb Rat tamoxifen multiple interactions ISO RGD:1323621 6480464 [Tamoxifen co-treated with ESR2 protein] results in decreased expression of FLNB mRNA CTD PMID:19059307 Flnb Rat tert-butyl hydroperoxide increases expression ISO RGD:1323621 6480464 tert-Butylhydroperoxide results in increased expression of FLNB mRNA CTD PMID:15336504 Flnb Rat tetrachloromethane increases expression ISO RGD:1323622 6480464 Carbon Tetrachloride results in increased expression of FLNB mRNA CTD PMID:17484886 Flnb Rat thiram increases expression ISO RGD:1323621 6480464 Thiram results in increased expression of FLNB mRNA CTD PMID:38568856 Flnb Rat titanium dioxide decreases expression ISO RGD:1323622 6480464 titanium dioxide results in decreased expression of FLNB mRNA CTD PMID:29264374 Flnb Rat titanium dioxide decreases methylation ISO RGD:1323622 6480464 titanium dioxide results in decreased methylation of FLNB gene CTD PMID:35295148 Flnb Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of FLNB gene CTD PMID:27618143 Flnb Rat trichostatin A increases expression ISO RGD:1323621 6480464 trichostatin A results in increased expression of FLNB mRNA CTD PMID:24935251 Flnb Rat trichostatin A affects expression ISO RGD:1323621 6480464 trichostatin A affects the expression of FLNB mRNA CTD PMID:28542535 Flnb Rat trichostatin A multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Flnb Rat triphenyl phosphate affects expression ISO RGD:1323621 6480464 triphenyl phosphate affects the expression of FLNB mRNA CTD PMID:37042841 Flnb Rat valproic acid increases expression ISO RGD:1323621 6480464 Valproic Acid results in increased expression of FLNB mRNA CTD PMID:23179753|PMID:24383497|PMID:26272509|PMID:28001369 Flnb Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of FLNB mRNA CTD PMID:29427782 Flnb Rat valproic acid multiple interactions ISO RGD:1323621 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Flnb Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of FLNB mRNA CTD PMID:19015723
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) Benzo[k]fluoranthene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) carbamazepine (ISO) carbon nanotube (ISO) chloropicrin (ISO) choline (ISO) ciglitazone (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) dibenzo[a,l]pyrene (ISO) dicrotophos (ISO) dimethylselenide (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) enzyme inhibitor (ISO) ethanol (ISO) ethylparaben (ISO) fenamidone (ISO) fenthion (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) FR900359 (ISO) furan (EXP) furfural (ISO) genistein (EXP) gentamycin (EXP) glycidyl methacrylate (ISO) glyphosate (ISO) hydrogen peroxide (ISO) hydroxyl (ISO) indometacin (ISO) inulin (ISO) ivermectin (ISO) L-methionine (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) menadione (ISO) mercury atom (ISO) mercury dibromide (ISO) mercury(0) (ISO) methamphetamine (ISO) methapyrilene (EXP) methidathion (ISO) methoxychlor (EXP) methylmercury chloride (ISO) okadaic acid (ISO) ozone (ISO) panobinostat (ISO) paracetamol (EXP,ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) piroxicam (ISO) quercetin (ISO) raloxifene (ISO) rofecoxib (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (ISO) Soman (EXP) sulindac (EXP) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) valproic acid (EXP,ISO) vinclozolin (EXP)
1.
Mutations in FLNB cause boomerang dysplasia.
Bicknell LS, etal., J Med Genet. 2005 Jul;42(7):e43.
2.
A molecular and clinical study of Larsen syndrome caused by mutations in FLNB.
Bicknell LS, etal., J Med Genet. 2007 Feb;44(2):89-98. Epub 2006 Jun 26.
3.
Integrin inactivators: balancing cellular functions in vitro and in vivo.
Bouvard D, etal., Nat Rev Mol Cell Biol. 2013 Jul;14(7):430-42. doi: 10.1038/nrm3599. Epub 2013 May 30.
4.
Disruption of the Flnb gene in mice phenocopies the human disease spondylocarpotarsal synostosis syndrome.
Farrington-Rock C, etal., Hum Mol Genet. 2008 Mar 1;17(5):631-41. Epub 2007 Jul 17.
5.
Mutations in two regions of FLNB result in atelosteogenesis I and III.
Farrington-Rock C, etal., Hum Mutat. 2006 Jul;27(7):705-10.
6.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
7.
Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
Jugessur A, etal., PLoS One. 2010 Jul 9;5(7):e11493. doi: 10.1371/journal.pone.0011493.
8.
Mutations in the gene encoding filamin B disrupt vertebral segmentation, joint formation and skeletogenesis.
Krakow D, etal., Nat Genet. 2004 Apr;36(4):405-10. Epub 2004 Feb 29.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
11.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Comprehensive gene review and curation
RGD comprehensive gene curation
15.
Filamin A and Filamin B are co-expressed within neurons during periods of neuronal migration and can physically interact.
Sheen VL, etal., Hum Mol Genet. 2002 Nov 1;11(23):2845-54.
16.
Three novel missense mutations in the filamin B gene are associated with isolated congenital talipes equinovarus.
Yang H, etal., Hum Genet. 2016 Oct;135(10):1181-9. doi: 10.1007/s00439-016-1701-7. Epub 2016 Jul 9.
Flnb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 19,392,212 - 19,525,278 (-) NCBI GRCr8 mRatBN7.2 15 16,961,999 - 17,095,059 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 16,962,003 - 17,095,006 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 19,136,669 - 19,269,742 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 20,095,144 - 20,228,215 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 18,350,059 - 18,483,132 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 18,750,152 - 18,883,019 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 18,750,118 - 18,883,005 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 22,716,606 - 22,849,401 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 18,949,027 - 19,082,504 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 18,950,017 - 19,108,490 (-) NCBI Celera 15 16,918,384 - 17,051,016 (-) NCBI Celera Cytogenetic Map 15 p14 NCBI
FLNB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 58,008,422 - 58,172,251 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 58,008,398 - 58,172,251 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 57,994,149 - 58,157,978 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 57,969,167 - 58,133,018 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 57,969,200 - 58,133,015 NCBI Celera 3 58,008,139 - 58,172,548 (+) NCBI Celera Cytogenetic Map 3 p14.3 NCBI HuRef 3 58,091,507 - 58,255,398 (+) NCBI HuRef CHM1_1 3 57,944,271 - 58,108,169 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 58,048,835 - 58,212,708 (+) NCBI T2T-CHM13v2.0
Flnb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 14,518,185 - 14,651,852 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 14,518,185 - 14,651,816 (-) Ensembl GRCm39 Ensembl GRCm38 14 7,817,921 - 7,951,588 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 7,817,957 - 7,951,588 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 8,650,471 - 8,784,102 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 6,608,366 - 6,743,464 (+) NCBI MGSCv36 mm8 Celera 14 3,438,528 - 3,574,962 (+) NCBI Celera Cytogenetic Map 14 A1 NCBI cM Map 14 4.59 NCBI
Flnb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955430 7,680,394 - 7,832,124 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955430 7,680,394 - 7,832,124 (+) NCBI ChiLan1.0 ChiLan1.0
FLNB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 57,978,724 - 58,142,635 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 57,983,508 - 58,147,409 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 57,943,263 - 58,107,115 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 59,359,234 - 59,521,989 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 59,359,234 - 59,521,989 (+) Ensembl panpan1.1 panPan2
FLNB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 32,394,755 - 32,533,440 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 32,396,165 - 32,533,275 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 32,324,259 - 32,462,636 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 32,668,416 - 32,806,815 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 32,668,423 - 32,806,776 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 32,123,648 - 32,261,938 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 32,480,340 - 32,618,596 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 32,652,257 - 32,790,526 (-) NCBI UU_Cfam_GSD_1.0
Flnb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 175,129,741 - 175,274,947 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936473 8,268,496 - 8,411,975 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936473 8,268,326 - 8,413,955 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FLNB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 39,789,739 - 39,938,746 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 39,789,259 - 39,938,751 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 43,752,537 - 43,820,891 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FLNB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 19,304,822 - 19,468,037 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 19,304,781 - 19,468,036 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 147,393,314 - 147,556,732 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Flnb
.
Predicted Target Of
Count of predictions: 360 Count of miRNA genes: 200 Interacting mature miRNAs: 244 Transcripts: ENSRNOT00000066546 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 631273 Lecl2 Lens clarity QTL 2 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 15 10596089 55596089 Rat 2300167 Bmd63 Bone mineral density QTL 63 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 2300173 Bmd62 Bone mineral density QTL 62 12.8 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 15 11111142 56111142 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat 61424 Scl1 Serum cholesterol level QTL 1 7.7 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 15 16725528 80672115 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 1582251 Gluco24 Glucose level QTL 24 3.2 0.0008 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 15 5530756 50530756 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 2317750 Glom26 Glomerulus QTL 26 4.3 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 15 12496141 65205939 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 2293688 Bss29 Bone structure and strength QTL 29 5.31 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 15 11111142 56111142 Rat 5685002 Bss103 Bone structure and strength QTL 103 2.8 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 15 14481165 28469888 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat
RH127642
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 16,962,035 - 16,962,218 (+) MAPPER mRatBN7.2 Rnor_6.0 15 18,750,189 - 18,750,371 NCBI Rnor6.0 Rnor_6.0 15 17,958,825 - 17,959,007 NCBI Rnor6.0 Rnor_5.0 15 22,716,643 - 22,716,825 UniSTS Rnor5.0 Rnor_5.0 15 21,939,082 - 21,939,264 UniSTS Rnor5.0 RGSC_v3.4 15 18,949,060 - 18,949,242 UniSTS RGSC3.4 Celera 15 16,918,417 - 16,918,599 UniSTS RH 3.4 Map 15 144.4 UniSTS Cytogenetic Map 15 p14 UniSTS
BE121117
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 17,086,598 - 17,086,749 (+) MAPPER mRatBN7.2 Rnor_6.0 15 18,874,552 - 18,874,702 NCBI Rnor6.0 Rnor_5.0 15 22,840,956 - 22,841,106 UniSTS Rnor5.0 RGSC_v3.4 15 19,074,097 - 19,074,247 UniSTS RGSC3.4 Celera 15 17,042,619 - 17,042,769 UniSTS RH 3.4 Map 15 139.7 UniSTS Cytogenetic Map 15 p14 UniSTS
RH135239
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 17,073,737 - 17,073,917 (+) MAPPER mRatBN7.2 Rnor_6.0 15 18,861,693 - 18,861,872 NCBI Rnor6.0 Rnor_5.0 15 22,828,097 - 22,828,276 UniSTS Rnor5.0 RGSC_v3.4 15 19,061,238 - 19,061,417 UniSTS RGSC3.4 Celera 15 17,029,738 - 17,029,917 UniSTS Cytogenetic Map 15 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066546 ⟹ ENSRNOP00000061198
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 16,962,003 - 17,095,006 (-) Ensembl Rnor_6.0 Ensembl 15 18,750,156 - 18,882,959 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088264 ⟹ ENSRNOP00000070399
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 16,962,003 - 17,095,006 (-) Ensembl Rnor_6.0 Ensembl 15 18,750,118 - 18,883,005 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106091 ⟹ ENSRNOP00000092630
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 16,962,003 - 17,095,006 (-) Ensembl
RefSeq Acc Id:
NM_001107288 ⟹ NP_001100758
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 19,392,216 - 19,525,209 (-) NCBI mRatBN7.2 15 16,962,003 - 17,095,006 (-) NCBI Rnor_6.0 15 18,750,156 - 18,882,959 (-) NCBI Rnor_5.0 15 22,716,606 - 22,849,401 (-) NCBI RGSC_v3.4 15 18,949,027 - 19,082,504 (-) RGD Celera 15 16,918,384 - 17,051,016 (-) RGD
Sequence:
GCGGCTAGTGTAGCAACGCTTTCGAGCCCCCTTCCCACTTGCCTCAGTTCCCCTTCCCCGGGCCCTTAGGGCTTTTCATCTCAGTCCCTGAAGCTCGTTGCCTCCGCTCACTCTCTGCCTCCAGGATG
hide sequence
RefSeq Acc Id:
XM_006251780 ⟹ XP_006251842
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 19,392,212 - 19,525,278 (-) NCBI mRatBN7.2 15 16,961,999 - 17,095,059 (-) NCBI Rnor_6.0 15 18,750,152 - 18,883,019 (-) NCBI Rnor_5.0 15 22,716,606 - 22,849,401 (-) NCBI
Sequence:
AGGCGCCAGGCCAGGCAACTTGCGCGCCCGGGGACGGACGAAGACAGTCCAGCTCCTGTTGCGG
hide sequence
RefSeq Acc Id:
XM_006251781 ⟹ XP_006251843
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 19,392,212 - 19,525,272 (-) NCBI mRatBN7.2 15 16,961,999 - 17,095,059 (-) NCBI Rnor_6.0 15 18,750,152 - 18,883,019 (-) NCBI Rnor_5.0 15 22,716,606 - 22,849,401 (-) NCBI
Sequence:
AGGCGCCAGGCCAGGCAACTTGCGCGCCCGGGGACGGACGAAGACAGTCCAGCTCCTGTTGCGGCTAGTGTAGCAACGCTTTCGAGCCCCCTTCCCACTTGCCTCAGTTCCCCTTCCCCGGGCCCTTA
hide sequence
RefSeq Acc Id:
NP_001100758 ⟸ NM_001107288
- UniProtKB:
D4A8D5 (UniProtKB/TrEMBL), A6K0C4 (UniProtKB/TrEMBL), A0A8I6GK95 (UniProtKB/TrEMBL)
- Sequence:
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVW
hide sequence
RefSeq Acc Id:
XP_006251843 ⟸ XM_006251781
- Peptide Label:
isoform X2
- Sequence:
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHH
hide sequence
RefSeq Acc Id:
XP_006251842 ⟸ XM_006251780
- Peptide Label:
isoform X1
- Sequence:
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQKRMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILHYSISMPVW
hide sequence
Ensembl Acc Id:
ENSRNOP00000061198 ⟸ ENSRNOT00000066546
Ensembl Acc Id:
ENSRNOP00000070399 ⟸ ENSRNOT00000088264
Ensembl Acc Id:
ENSRNOP00000092630 ⟸ ENSRNOT00000106091
RGD ID: 13699594 Promoter ID: EPDNEW_R10117 Type: initiation region Name: Flnb_1 Description: filamin B SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 18,882,974 - 18,883,034 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Flnb
filamin B
LOC100911261
filamin-B-like
Data merged from RGD:6493869
737654 PROVISIONAL
2016-01-11
Flnb
filamin B
Flnb
filamin B, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-05
LOC100911261
filamin-B-like
Symbol and Name status set to provisional
70820 PROVISIONAL
2012-01-17
Flnb
filamin B, beta
Flnb
filamin, beta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Flnb
filamin, beta
Flnb_predicted
filamin, beta (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Flnb_predicted
filamin, beta (predicted)
Symbol and Name status set to approved
70820 APPROVED
