Symbol:
Kirrel3
Name:
kirre like nephrin family adhesion molecule 3
RGD ID:
1311382
Description:
Predicted to enable cell adhesion molecule binding activity. Predicted to be involved in hemopoiesis; homophilic cell adhesion via plasma membrane adhesion molecules; and nervous system development. Predicted to act upstream of or within glomerulus morphogenesis; inter-male aggressive behavior; and nervous system development. Predicted to be located in several cellular components, including axon; dendritic shaft; and synaptic vesicle. Predicted to be active in cell-cell junction and plasma membrane. Orthologous to human KIRREL3 (kirre like nephrin family adhesion molecule 3); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
kin of IRRE like 3; kin of IRRE like 3 (Drosophila); kin of IRRE-like protein 3; LOC315546
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 41,123,692 - 41,663,528 (+) NCBI GRCr8 mRatBN7.2 8 32,865,779 - 33,407,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 32,862,776 - 33,405,676 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 36,938,412 - 37,478,071 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 35,221,433 - 35,761,111 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 33,084,303 - 33,623,950 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 35,692,525 - 36,254,755 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 36,125,999 - 36,254,753 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 35,722,596 - 36,273,792 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 34,300,350 - 34,835,957 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 34,425,084 - 34,844,541 (+) NCBI Celera 8 34,284,951 - 34,824,973 (+) NCBI Celera Cytogenetic Map 8 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kirrel3 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of KIRREL3 mRNA CTD PMID:26496021 Kirrel3 Rat 17beta-estradiol increases expression ISO Kirrel3 (Mus musculus) 6480464 Estradiol results in increased expression of KIRREL3 mRNA CTD PMID:39298647 Kirrel3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KIRREL3 mRNA CTD PMID:32109520 Kirrel3 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Kirrel3 Rat 2-palmitoylglycerol increases expression ISO KIRREL3 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of KIRREL3 mRNA CTD PMID:37199045 Kirrel3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Kirrel3 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of KIRREL3 mRNA CTD PMID:25172293 Kirrel3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KIRREL3 mRNA CTD PMID:28628672 Kirrel3 Rat 4,4'-sulfonyldiphenol increases methylation ISO Kirrel3 (Mus musculus) 6480464 bisphenol S results in increased methylation of KIRREL3 exon CTD PMID:33297965 Kirrel3 Rat 4,4'-sulfonyldiphenol decreases methylation ISO KIRREL3 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of KIRREL3 gene CTD PMID:31601247 Kirrel3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KIRREL3 mRNA CTD PMID:24780913 Kirrel3 Rat 8-Br-cAMP increases expression ISO KIRREL3 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in increased expression of KIRREL3 mRNA CTD PMID:22079614 Kirrel3 Rat aflatoxin B1 increases expression ISO KIRREL3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of KIRREL3 mRNA CTD PMID:22100608 Kirrel3 Rat aflatoxin B1 increases methylation ISO KIRREL3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KIRREL3 intron CTD PMID:30157460 Kirrel3 Rat Aflatoxin B2 alpha decreases methylation ISO KIRREL3 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of KIRREL3 exon and aflatoxin B2 results in decreased methylation of KIRREL3 intron CTD PMID:30157460 Kirrel3 Rat arsane multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat arsenic atom multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat atrazine increases expression ISO KIRREL3 (Homo sapiens) 6480464 Atrazine results in increased expression of KIRREL3 mRNA CTD PMID:22378314 Kirrel3 Rat benzo[a]pyrene decreases methylation ISO KIRREL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KIRREL3 3' UTR and Benzo(a)pyrene results in decreased methylation of KIRREL3 exon CTD PMID:27901495 Kirrel3 Rat benzo[a]pyrene affects methylation ISO KIRREL3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of KIRREL3 exon and Benzo(a)pyrene affects the methylation of KIRREL3 intron CTD PMID:30157460 Kirrel3 Rat benzo[a]pyrene increases methylation ISO KIRREL3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KIRREL3 promoter CTD PMID:27901495 Kirrel3 Rat benzo[e]pyrene increases methylation ISO KIRREL3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of KIRREL3 intron CTD PMID:30157460 Kirrel3 Rat bis(2-ethylhexyl) phthalate decreases expression ISO KIRREL3 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of KIRREL3 mRNA CTD PMID:31163220 Kirrel3 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of KIRREL3 mRNA CTD PMID:33789034 Kirrel3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of KIRREL3 gene CTD PMID:28505145 Kirrel3 Rat bisphenol A decreases expression ISO Kirrel3 (Mus musculus) 6480464 bisphenol A results in decreased expression of KIRREL3 mRNA CTD PMID:32156529 Kirrel3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KIRREL3 mRNA CTD PMID:34947998 Kirrel3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KIRREL3 mRNA CTD PMID:25181051 more ... Kirrel3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of KIRREL3 mRNA CTD PMID:26496021 Kirrel3 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of KIRREL3 mRNA CTD PMID:32479839 Kirrel3 Rat cadmium atom multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KIRREL3 mRNA CTD PMID:35301059 Kirrel3 Rat cadmium atom multiple interactions ISO Kirrel3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KIRREL3 mRNA CTD PMID:37325564 Kirrel3 Rat cadmium dichloride multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KIRREL3 mRNA CTD PMID:35301059 Kirrel3 Rat cadmium dichloride multiple interactions ISO Kirrel3 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of KIRREL3 mRNA CTD PMID:37325564 Kirrel3 Rat carbamazepine affects expression ISO KIRREL3 (Homo sapiens) 6480464 Carbamazepine affects the expression of KIRREL3 mRNA CTD PMID:25979313 Kirrel3 Rat casticin decreases expression ISO Kirrel3 (Mus musculus) 6480464 casticin results in decreased expression of KIRREL3 mRNA CTD PMID:28444820 Kirrel3 Rat CGP 52608 multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KIRREL3 gene] CTD PMID:28238834 Kirrel3 Rat chlorpyrifos increases expression ISO Kirrel3 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KIRREL3 mRNA CTD PMID:37019170 Kirrel3 Rat chromium(6+) multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of KIRREL3 mRNA CTD PMID:38479592 Kirrel3 Rat cisplatin multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KIRREL3 mRNA CTD PMID:27392435 Kirrel3 Rat cisplatin decreases expression ISO KIRREL3 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KIRREL3 mRNA CTD PMID:27392435 and PMID:27594783 Kirrel3 Rat cocaine increases expression ISO Kirrel3 (Mus musculus) 6480464 Cocaine results in increased expression of KIRREL3 mRNA CTD PMID:18355967 Kirrel3 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of KIRREL3 mRNA CTD PMID:26033743 Kirrel3 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of KIRREL3 mRNA CTD PMID:26033743 Kirrel3 Rat crocidolite asbestos increases expression ISO Kirrel3 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of KIRREL3 mRNA CTD PMID:29279043 Kirrel3 Rat dexamethasone multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KIRREL3 mRNA CTD PMID:28628672 Kirrel3 Rat dorsomorphin multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIRREL3 mRNA CTD PMID:27188386 Kirrel3 Rat folic acid decreases expression ISO Kirrel3 (Mus musculus) 6480464 Folic Acid results in decreased expression of KIRREL3 mRNA CTD PMID:25629700 Kirrel3 Rat indometacin multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in decreased expression of KIRREL3 mRNA CTD PMID:28628672 Kirrel3 Rat lead diacetate increases expression ISO Kirrel3 (Mus musculus) 6480464 lead acetate results in increased expression of KIRREL3 mRNA CTD PMID:20542052 Kirrel3 Rat lipopolysaccharide multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Kirrel3 Rat lipopolysaccharide decreases expression ISO KIRREL3 (Homo sapiens) 6480464 Lipopolysaccharides results in decreased expression of KIRREL3 mRNA CTD PMID:35811015 Kirrel3 Rat manganese atom multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat manganese(0) multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat manganese(II) chloride multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat methapyrilene increases methylation ISO KIRREL3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of KIRREL3 intron CTD PMID:30157460 Kirrel3 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KIRREL3 gene CTD PMID:35440735 Kirrel3 Rat monosodium L-glutamate increases expression ISO Kirrel3 (Mus musculus) 6480464 Sodium Glutamate results in increased expression of KIRREL3 mRNA CTD PMID:22078008 Kirrel3 Rat nickel sulfate decreases expression ISO KIRREL3 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of KIRREL3 mRNA CTD PMID:22714537 Kirrel3 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KIRREL3 mRNA CTD PMID:30723492 Kirrel3 Rat perfluorooctane-1-sulfonic acid affects expression ISO Kirrel3 (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of KIRREL3 mRNA CTD PMID:19429403 Kirrel3 Rat perfluorooctanoic acid affects expression ISO Kirrel3 (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of KIRREL3 mRNA CTD PMID:19429403 Kirrel3 Rat potassium bromate decreases expression EXP 6480464 potassium bromate results in decreased expression of KIRREL3 mRNA CTD PMID:23588252 Kirrel3 Rat propanal increases expression ISO KIRREL3 (Homo sapiens) 6480464 propionaldehyde results in increased expression of KIRREL3 mRNA CTD PMID:26079696 Kirrel3 Rat rifampicin decreases expression ISO KIRREL3 (Homo sapiens) 6480464 Rifampin results in decreased expression of KIRREL3 mRNA CTD PMID:24552687 Kirrel3 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Kirrel3 Rat SB 431542 multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIRREL3 mRNA CTD PMID:27188386 Kirrel3 Rat silicon dioxide increases expression ISO KIRREL3 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of KIRREL3 mRNA CTD PMID:25895662 Kirrel3 Rat sodium arsenite affects methylation ISO KIRREL3 (Homo sapiens) 6480464 sodium arsenite affects the methylation of KIRREL3 gene CTD PMID:28589171 Kirrel3 Rat sodium arsenite multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of KIRREL3 mRNA CTD PMID:39836092 Kirrel3 Rat sodium arsenite increases expression ISO KIRREL3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KIRREL3 mRNA CTD PMID:29301061 Kirrel3 Rat testosterone decreases expression ISO Kirrel3 (Mus musculus) 6480464 Testosterone results in decreased expression of KIRREL3 mRNA CTD PMID:19693291 Kirrel3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KIRREL3 mRNA CTD PMID:34492290 Kirrel3 Rat thiram decreases expression ISO KIRREL3 (Homo sapiens) 6480464 Thiram results in decreased expression of KIRREL3 mRNA CTD PMID:38568856 Kirrel3 Rat titanium dioxide increases expression ISO Kirrel3 (Mus musculus) 6480464 titanium dioxide results in increased expression of KIRREL3 mRNA CTD PMID:35295148 Kirrel3 Rat titanium dioxide decreases methylation ISO Kirrel3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KIRREL3 gene CTD PMID:35295148 Kirrel3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of KIRREL3 mRNA CTD PMID:33387578 Kirrel3 Rat trichostatin A increases expression ISO KIRREL3 (Homo sapiens) 6480464 trichostatin A results in increased expression of KIRREL3 mRNA CTD PMID:24935251 Kirrel3 Rat valproic acid multiple interactions ISO KIRREL3 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of KIRREL3 mRNA CTD PMID:27188386 Kirrel3 Rat valproic acid increases expression ISO KIRREL3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KIRREL3 mRNA CTD PMID:23179753 more ... Kirrel3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KIRREL3 mRNA CTD PMID:19015723
17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-palmitoylglycerol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbamazepine (ISO) casticin (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) cocaine (ISO) copper atom (EXP) copper(0) (EXP) crocidolite asbestos (ISO) dexamethasone (ISO) dorsomorphin (ISO) folic acid (ISO) indometacin (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methoxychlor (EXP) monosodium L-glutamate (ISO) nickel sulfate (ISO) paracetamol (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) potassium bromate (EXP) propanal (ISO) rifampicin (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) testosterone (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
cell-cell adhesion (IBA) glomerulus morphogenesis (IEA,ISO) hemopoiesis (IEA,ISO) hippocampus development (IEA,ISO) homophilic cell adhesion via plasma membrane adhesion molecules (IEA,ISO) inter-male aggressive behavior (IEA,ISO) neuron migration (IEA,ISO) neuron projection morphogenesis (IEA,ISO) principal sensory nucleus of trigeminal nerve development (IEA,ISO) synapse assembly (IBA,IEA,ISO)
Kirrel3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 41,123,692 - 41,663,528 (+) NCBI GRCr8 mRatBN7.2 8 32,865,779 - 33,407,555 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 32,862,776 - 33,405,676 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 36,938,412 - 37,478,071 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 35,221,433 - 35,761,111 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 33,084,303 - 33,623,950 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 35,692,525 - 36,254,755 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 36,125,999 - 36,254,753 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 35,722,596 - 36,273,792 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 34,300,350 - 34,835,957 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 34,425,084 - 34,844,541 (+) NCBI Celera 8 34,284,951 - 34,824,973 (+) NCBI Celera Cytogenetic Map 8 q21 NCBI
KIRREL3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 126,423,358 - 127,000,870 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 126,423,358 - 127,003,460 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 126,293,253 - 126,870,766 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 125,799,613 - 126,375,701 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 125,799,684 - 126,375,615 NCBI Celera 11 123,459,514 - 124,037,646 (-) NCBI Celera Cytogenetic Map 11 q24.2 NCBI HuRef 11 122,817,366 - 122,817,789 (-) NCBI HuRef HuRef 11 122,238,286 - 122,410,924 (-) NCBI HuRef CHM1_1 11 126,179,676 - 126,756,915 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 126,454,803 - 127,036,590 (-) NCBI T2T-CHM13v2.0
Kirrel3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 34,396,850 - 34,952,103 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 34,397,190 - 34,948,012 (+) Ensembl GRCm39 Ensembl GRCm38 9 34,485,853 - 35,040,807 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 34,485,894 - 35,036,716 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 34,296,316 - 34,843,889 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 34,238,296 - 34,785,975 (+) NCBI MGSCv36 mm8 Celera 9 31,740,583 - 32,293,826 (+) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 18.97 NCBI
Kirrel3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 27,428,360 - 27,991,321 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 27,428,360 - 27,994,458 (-) NCBI ChiLan1.0 ChiLan1.0
KIRREL3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 127,105,851 - 127,690,728 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 128,213,408 - 128,798,315 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 121,236,962 - 121,821,806 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 125,146,563 - 125,726,452 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 125,146,563 - 125,723,504 (-) Ensembl panpan1.1 panPan2
KIRREL3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 7,583,530 - 8,124,045 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 7,583,805 - 8,123,080 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 7,645,744 - 8,184,370 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 7,538,980 - 8,078,718 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 7,539,227 - 8,078,660 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 7,996,350 - 8,148,415 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 7,583,374 - 8,122,445 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 7,616,414 - 8,156,314 (+) NCBI UU_Cfam_GSD_1.0
Kirrel3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 108,652,952 - 108,687,285 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936572 5,239,573 - 5,796,368 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936572 5,763,098 - 5,797,410 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KIRREL3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 53,491,991 - 53,664,072 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 53,493,735 - 54,066,490 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 59,332,982 - 59,498,767 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KIRREL3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 117,553,388 - 118,122,895 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 117,551,940 - 117,687,637 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 7,949,043 - 8,520,592 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kirrel3
.
Predicted Target Of
Count of predictions: 463 Count of miRNA genes: 235 Interacting mature miRNAs: 290 Transcripts: ENSRNOT00000013036 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61337 Bp22 Blood pressure QTL 22 5.1 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 42692818 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 70206 Alc20 Alcohol consumption QTL 20 2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 8 30848154 40713225 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
D8Rat100
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,343,218 - 33,343,426 (+) MAPPER mRatBN7.2 Rnor_6.0 8 36,181,831 - 36,182,038 NCBI Rnor6.0 Rnor_5.0 8 36,203,861 - 36,204,068 UniSTS Rnor5.0 RGSC_v3.4 8 34,773,456 - 34,773,664 RGD RGSC3.4 RGSC_v3.4 8 34,773,457 - 34,773,664 UniSTS RGSC3.4 RGSC_v3.1 8 34,782,222 - 34,782,430 RGD Celera 8 34,761,230 - 34,761,437 UniSTS FHH x ACI Map 8 26.99 RGD FHH x ACI Map 8 26.99 UniSTS Cytogenetic Map 8 q21 UniSTS
D3Mco55
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 8 41,419,558 - 41,419,722 (+) Marker Load Pipeline mRatBN7.2 8 33,161,693 - 33,161,853 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,996,819 - 35,996,978 NCBI Rnor6.0 Rnor_5.0 8 36,023,372 - 36,023,531 UniSTS Rnor5.0 RGSC_v3.4 8 34,589,399 - 34,589,558 UniSTS RGSC3.4 RGSC_v3.4 3 168,596,925 - 168,597,084 UniSTS RGSC3.4 Celera 8 34,580,747 - 34,580,906 UniSTS Cytogenetic Map 8 q21 UniSTS
D8Got342
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 32,880,533 - 32,880,641 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,707,396 - 35,707,503 NCBI Rnor6.0 Rnor_5.0 8 35,737,551 - 35,737,658 UniSTS Rnor5.0 RGSC_v3.4 8 34,315,019 - 34,315,126 UniSTS RGSC3.4 Celera 8 34,299,654 - 34,299,761 UniSTS Cytogenetic Map 8 q21 UniSTS
BF386659
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,400,488 - 33,400,638 (+) MAPPER mRatBN7.2 Rnor_6.0 8 36,249,564 - 36,249,713 NCBI Rnor6.0 Rnor_5.0 8 36,268,601 - 36,268,750 UniSTS Rnor5.0 RGSC_v3.4 8 34,830,766 - 34,830,915 UniSTS RGSC3.4 Celera 8 34,819,782 - 34,819,931 UniSTS RH 3.4 Map 8 286.2 UniSTS Cytogenetic Map 8 q21 UniSTS
BF394891
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 32,894,130 - 32,894,332 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,721,222 - 35,721,423 NCBI Rnor6.0 Rnor_5.0 8 35,751,377 - 35,751,578 UniSTS Rnor5.0 RGSC_v3.4 8 34,329,087 - 34,329,288 UniSTS RGSC3.4 Celera 8 34,313,575 - 34,313,776 UniSTS RH 3.4 Map 8 283.8 UniSTS Cytogenetic Map 8 q21 UniSTS
BF400294
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 32,993,617 - 32,993,805 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,826,848 - 35,827,035 NCBI Rnor6.0 Rnor_5.0 8 35,855,280 - 35,855,467 UniSTS Rnor5.0 RGSC_v3.4 8 34,419,393 - 34,419,580 UniSTS RGSC3.4 Celera 8 34,413,267 - 34,413,454 UniSTS RH 3.4 Map 8 284.7 UniSTS Cytogenetic Map 8 q21 UniSTS
BF399480
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,164,860 - 33,165,015 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,999,983 - 36,000,137 NCBI Rnor6.0 Rnor_5.0 8 36,026,536 - 36,026,690 UniSTS Rnor5.0 RGSC_v3.4 8 34,592,566 - 34,592,720 UniSTS RGSC3.4 Celera 8 34,583,896 - 34,584,050 UniSTS RH 3.4 Map 8 285.5 UniSTS Cytogenetic Map 8 q21 UniSTS
AU047192
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,346,612 - 33,346,771 (+) MAPPER mRatBN7.2 Rnor_6.0 8 36,185,225 - 36,185,383 NCBI Rnor6.0 Rnor_5.0 8 36,207,255 - 36,207,413 UniSTS Rnor5.0 RGSC_v3.4 8 34,776,851 - 34,777,009 UniSTS RGSC3.4 Celera 8 34,764,624 - 34,764,782 UniSTS Cytogenetic Map 8 q21 UniSTS
RH138076
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,123,938 - 33,124,083 (+) MAPPER mRatBN7.2 Rnor_6.0 8 35,958,153 - 35,958,297 NCBI Rnor6.0 Rnor_5.0 8 35,986,322 - 35,986,466 UniSTS Rnor5.0 RGSC_v3.4 8 34,549,693 - 34,549,837 UniSTS RGSC3.4 Celera 8 34,543,076 - 34,543,220 UniSTS RH 3.4 Map 8 285.6 UniSTS Cytogenetic Map 8 q21 UniSTS
RH139479
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 33,405,283 - 33,405,464 (+) MAPPER mRatBN7.2 Rnor_6.0 8 36,254,359 - 36,254,539 NCBI Rnor6.0 Rnor_5.0 8 36,273,396 - 36,273,576 UniSTS Rnor5.0 RGSC_v3.4 8 34,835,561 - 34,835,741 UniSTS RGSC3.4 Celera 8 34,824,577 - 34,824,757 UniSTS RH 3.4 Map 8 288.6 UniSTS Cytogenetic Map 8 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
49
113
65
64
33
25
33
6
189
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000013036 ⟹ ENSRNOP00000013036
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 32,866,169 - 33,405,676 (+) Ensembl Rnor_6.0 Ensembl 8 36,125,999 - 36,254,753 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088046 ⟹ ENSRNOP00000073469
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 32,862,776 - 33,405,676 (+) Ensembl Rnor_6.0 Ensembl 8 36,126,081 - 36,253,721 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103546 ⟹ ENSRNOP00000080508
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 32,862,776 - 33,405,676 (+) Ensembl
RefSeq Acc Id:
NM_001048215 ⟹ NP_001041680
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,773 - 41,663,524 (+) NCBI mRatBN7.2 8 32,865,865 - 33,405,680 (+) NCBI Rnor_6.0 8 35,692,525 - 36,254,755 (+) NCBI Rnor_5.0 8 35,722,596 - 36,273,792 (+) NCBI RGSC_v3.4 8 34,300,350 - 34,835,957 (+) RGD Celera 8 34,284,951 - 34,824,973 (+) RGD
Sequence:
AGCCGTGTGCCTGGGATACTAAGAGCCAGAGAATGGATCTGCTCCGAGTGGGGACATTGCTGAGGATCCCGGCTTCCCGAGGTGGCTGAAAACAAGCATTTGGTTTCGGCTGCCTGCAGATACCTGGA
hide sequence
RefSeq Acc Id:
XM_039081392 ⟹ XP_038937320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,693 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,780 - 33,407,555 (+) NCBI
RefSeq Acc Id:
XM_039081393 ⟹ XP_038937321
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,692 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,779 - 33,407,555 (+) NCBI
RefSeq Acc Id:
XM_039081394 ⟹ XP_038937322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,695 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,783 - 33,407,555 (+) NCBI
RefSeq Acc Id:
XM_039081395 ⟹ XP_038937323
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,694 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,782 - 33,407,555 (+) NCBI
RefSeq Acc Id:
XM_039081396 ⟹ XP_038937324
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,694 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,782 - 33,404,801 (+) NCBI
RefSeq Acc Id:
XM_039081397 ⟹ XP_038937325
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,696 - 41,663,528 (+) NCBI mRatBN7.2 8 32,865,784 - 33,404,801 (+) NCBI
RefSeq Acc Id:
XM_063265411 ⟹ XP_063121481
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 41,123,694 - 41,663,528 (+) NCBI
RefSeq Acc Id:
NP_001041680 ⟸ NM_001048215
- Peptide Label:
precursor
- UniProtKB:
Q09GS6 (UniProtKB/TrEMBL), E9PTD7 (UniProtKB/TrEMBL)
- Sequence:
MRPFQLDLLFLCFFLFSQELGLQRRGCCLVLGYMAKDKFRRMNEGQVYSFSQQPQDQVVVSGQPVTLLCAIPEYDGFVLWIKDGLALGVGRDLSSYPQYLVVGNHLSGEHHLKILRAELQDDAVYECQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000073469 ⟸ ENSRNOT00000088046
Ensembl Acc Id:
ENSRNOP00000013036 ⟸ ENSRNOT00000013036
RefSeq Acc Id:
XP_038937321 ⟸ XM_039081393
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038937320 ⟸ XM_039081392
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038937323 ⟸ XM_039081395
- Peptide Label:
isoform X4
RefSeq Acc Id:
XP_038937324 ⟸ XM_039081396
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_038937322 ⟸ XM_039081394
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038937325 ⟸ XM_039081397
- Peptide Label:
isoform X7
Ensembl Acc Id:
ENSRNOP00000080508 ⟸ ENSRNOT00000103546
RefSeq Acc Id:
XP_063121481 ⟸ XM_063265411
- Peptide Label:
isoform X6
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-06-21
Kirrel3
kirre like nephrin family adhesion molecule 3
Kirrel3
kin of IRRE like 3 (Drosophila)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Kirrel3
kin of IRRE like 3 (Drosophila)
Kirrel3_predicted
kin of IRRE like 3 (Drosophila) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Kirrel3_predicted
kin of IRRE like 3 (Drosophila) (predicted)
Symbol and Name status set to approved
70820 APPROVED
