Symbol:
Cfhr1
Name:
complement factor H-related 1
RGD ID:
1310510
Description:
Predicted to enable complement component C3b binding activity and identical protein binding activity. Predicted to be involved in complement activation and cytolysis by host of symbiont cells. Predicted to be part of protein-containing complex. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in acute myeloid leukemia; age related macular degeneration 1; atypical hemolytic-uremic syndrome; and multiple myeloma. Orthologous to several human genes including CFHR1 (complement factor H related 1); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Cfhl1; complement component factor h-like 1; complement factor H-related protein 1; LOC289057
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 53,946,298 - 53,961,282 (-) NCBI GRCr8 mRatBN7.2 13 51,395,583 - 51,410,571 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 51,369,211 - 51,410,592 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 53,980,575 - 53,995,565 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 55,268,495 - 55,283,485 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 52,535,312 - 52,550,292 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 56,862,666 - 56,877,650 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 56,836,994 - 56,877,650 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 61,880,591 - 61,908,385 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 53,135,397 - 53,150,381 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 53,129,611 - 53,164,476 (-) NCBI Celera 13 51,655,453 - 51,670,441 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cfhr1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CFHR1 mRNA] CTD PMID:31150632 Cfhr1 Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1321454 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CFHR2 mRNA CTD PMID:36331819 Cfhr1 Rat 1,2-dichloroethane decreases expression ISO RGD:1321454 6480464 ethylene dichloride results in decreased expression of CFHR2 mRNA CTD PMID:28960355 Cfhr1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1321454 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of CFHR2 mRNA] CTD PMID:22206623 Cfhr1 Rat 1,2-dimethylhydrazine decreases expression ISO RGD:1321454 6480464 1,2-Dimethylhydrazine results in decreased expression of CFHR2 mRNA CTD PMID:22206623 Cfhr1 Rat 17beta-estradiol affects expression ISO RGD:1321454 6480464 Estradiol affects the expression of CFHR1 mRNA; Estradiol affects the expression of CFHR2 mRNA CTD PMID:15598610|PMID:39298647 Cfhr1 Rat 17beta-estradiol decreases expression ISO RGD:1321454 6480464 Estradiol results in decreased expression of CFHR1 mRNA CTD PMID:39298647 Cfhr1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1321454 6480464 Tetrachlorodibenzodioxin results in increased expression of CFHR1 mRNA CTD PMID:19770486 Cfhr1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CFHL1 mRNA CTD PMID:21724226 Cfhr1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO RGD:1321454 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of CFHR1 mRNA; 2,2',4,4',5-brominated diphenyl ether affects the expression more ... CTD PMID:38648751 Cfhr1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of CFHR1 mRNA CTD PMID:21346803 Cfhr1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO RGD:1321454 6480464 3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of CFHR1 mRNA] CTD PMID:19467301 Cfhr1 Rat 4,4'-sulfonyldiphenol affects expression ISO RGD:1321454 6480464 bisphenol S affects the expression of CFHR1 mRNA; bisphenol S affects the expression of CFHR2 more ... CTD PMID:39298647 Cfhr1 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of CFHR1 mRNA CTD PMID:31881176 Cfhr1 Rat aconitine increases expression EXP 6480464 Aconitine results in increased expression of CFHR1 protein CTD PMID:33236894 Cfhr1 Rat aflatoxin B1 decreases expression ISO RGD:1321454 6480464 Aflatoxin B1 results in decreased expression of CFHR1 mRNA CTD PMID:19770486 Cfhr1 Rat aflatoxin B1 decreases methylation ISO RGD:1346225 6480464 Aflatoxin B1 results in decreased methylation of CFHR1 gene CTD PMID:27153756 Cfhr1 Rat benzo[a]pyrene decreases expression ISO RGD:1321454 6480464 Benzo(a)pyrene results in decreased expression of CFHR1 mRNA CTD PMID:19770486 Cfhr1 Rat benzo[a]pyrene decreases expression ISO RGD:1346225 6480464 Benzo(a)pyrene results in decreased expression of CFHR1 mRNA CTD PMID:32234424 Cfhr1 Rat benzo[a]pyrene increases expression ISO RGD:1321454 6480464 Benzo(a)pyrene results in increased expression of CFHR2 mRNA CTD PMID:19770486 Cfhr1 Rat benzo[a]pyrene affects methylation ISO RGD:1346225 6480464 Benzo(a)pyrene affects the methylation of CFHR1 promoter CTD PMID:27901495 Cfhr1 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1346225 6480464 Benzo(a)pyrene results in increased mutagenesis of CFHR1 gene CTD PMID:25435355 Cfhr1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1321454 6480464 Diethylhexyl Phthalate results in decreased expression of CFHR2 mRNA CTD PMID:28085963 Cfhr1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CFHR1 mRNA CTD PMID:25181051 Cfhr1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CFHR1 mRNA CTD PMID:32145629 Cfhr1 Rat bisphenol A decreases methylation ISO RGD:1321454 6480464 bisphenol A results in decreased methylation of CFHR2 promoter CTD PMID:27312807 Cfhr1 Rat bisphenol A increases expression ISO RGD:1321454 6480464 bisphenol A results in increased expression of CFHR1 mRNA; bisphenol A results in increased expression more ... CTD PMID:25594700|PMID:30245210|PMID:33221593 Cfhr1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CFHR1 mRNA CTD PMID:30903817 Cfhr1 Rat bisphenol F increases expression ISO RGD:1321454 6480464 bisphenol F results in increased expression of CFHR1 mRNA CTD PMID:38685157 Cfhr1 Rat cadmium atom multiple interactions ISO RGD:1346225 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CFHR1 more ... CTD PMID:35301059 Cfhr1 Rat cadmium dichloride multiple interactions ISO RGD:1346225 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of CFHR1 more ... CTD PMID:35301059 Cfhr1 Rat carbon nanotube increases expression ISO RGD:1321454 6480464 Nanotubes, Carbon analog results in increased expression of CFHR2 mRNA CTD PMID:25620056 Cfhr1 Rat CGP 52608 multiple interactions ISO RGD:1346225 6480464 CGP 52608 promotes the reaction [RORA protein binds to CFHR1 gene] CTD PMID:28238834 Cfhr1 Rat cisplatin increases expression ISO RGD:1346225 6480464 Cisplatin results in increased expression of CFHR1 protein CTD PMID:16803524 Cfhr1 Rat doxorubicin decreases expression ISO RGD:1346225 6480464 Doxorubicin results in decreased expression of CFHR1 mRNA CTD PMID:29803840 Cfhr1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of CFHR1 mRNA CTD PMID:29391264 Cfhr1 Rat fenthion increases expression ISO RGD:1321454 6480464 Fenthion results in increased expression of CFHR2 mRNA CTD PMID:34813904 Cfhr1 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of CFHR1 mRNA CTD PMID:24136188 Cfhr1 Rat folic acid multiple interactions ISO RGD:1321454 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in decreased expression of CFHR2 mRNA] CTD PMID:22206623 Cfhr1 Rat folic acid decreases expression ISO RGD:1321454 6480464 Folic Acid results in decreased expression of CFHR2 mRNA CTD PMID:25629700 Cfhr1 Rat furan decreases expression EXP 6480464 furan results in decreased expression of CFHR1 mRNA CTD PMID:25539665 Cfhr1 Rat lead diacetate decreases expression ISO RGD:1321454 6480464 lead acetate results in decreased expression of CFHR1 mRNA CTD PMID:22609695 Cfhr1 Rat levofloxacin increases expression EXP 6480464 Levofloxacin results in increased expression of CFHR1 mRNA CTD PMID:24136188 Cfhr1 Rat lipopolysaccharide multiple interactions ISO RGD:1346225 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CFHR1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Cfhr1 Rat methidathion decreases expression ISO RGD:1321454 6480464 methidathion results in decreased expression of CFHR2 mRNA CTD PMID:34813904 Cfhr1 Rat methotrexate affects expression ISO RGD:1321454 6480464 Methotrexate affects the expression of CFHR1 mRNA CTD PMID:18502557 Cfhr1 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of CFHR1 mRNA CTD PMID:19638242 Cfhr1 Rat N-nitrosodiethylamine decreases expression ISO RGD:1321454 6480464 Diethylnitrosamine results in decreased expression of CFHR1 mRNA CTD PMID:24535843 Cfhr1 Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of CFHR1 mRNA CTD PMID:24136188 Cfhr1 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of CFHR1 mRNA CTD PMID:33484710 Cfhr1 Rat O-methyleugenol decreases expression ISO RGD:1346225 6480464 methyleugenol results in decreased expression of CFHR1 mRNA CTD PMID:32234424 Cfhr1 Rat okadaic acid decreases expression ISO RGD:1346225 6480464 Okadaic Acid results in decreased expression of CFHR1 mRNA CTD PMID:38832940 Cfhr1 Rat paracetamol affects expression ISO RGD:1321454 6480464 Acetaminophen affects the expression of CFHR1 mRNA CTD PMID:17562736 Cfhr1 Rat paracetamol multiple interactions ISO RGD:1321454 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in decreased expression of CFHR1 mRNA] CTD PMID:29246445 Cfhr1 Rat paracetamol decreases expression ISO RGD:1321454 6480464 Acetaminophen results in decreased expression of CFHR1 mRNA CTD PMID:29246445 Cfhr1 Rat pentachlorophenol decreases expression ISO RGD:1321454 6480464 Pentachlorophenol results in decreased expression of CFHR2 mRNA CTD PMID:23892564 Cfhr1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1321454 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of CFHR2 mRNA CTD PMID:36331819 Cfhr1 Rat pirinixic acid decreases expression ISO RGD:1321454 6480464 pirinixic acid results in decreased expression of CFHR1 mRNA; pirinixic acid results in decreased expression more ... CTD PMID:23811191 Cfhr1 Rat progesterone increases expression ISO RGD:1346225 6480464 Progesterone results in increased expression of CFHR1 mRNA CTD PMID:20864642 Cfhr1 Rat S-(1,2-dichlorovinyl)-L-cysteine increases expression ISO RGD:1346225 6480464 S-(1,2-dichlorovinyl)cysteine results in increased expression of CFHR1 mRNA CTD PMID:35811015 Cfhr1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO RGD:1346225 6480464 [S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CFHR1 mRNA; [S-(1,2-dichlorovinyl)cysteine more ... CTD PMID:35811015 Cfhr1 Rat sodium arsenite decreases expression ISO RGD:1346225 6480464 sodium arsenite results in decreased expression of CFHR1 mRNA CTD PMID:29301061 Cfhr1 Rat sodium arsenite increases expression ISO RGD:1346225 6480464 sodium arsenite results in increased expression of CFHR1 mRNA CTD PMID:38568856 Cfhr1 Rat tetrachloromethane decreases expression ISO RGD:1321454 6480464 Carbon Tetrachloride results in decreased expression of CFHR1 mRNA; Carbon Tetrachloride results in decreased expression more ... CTD PMID:27339419|PMID:31919559 Cfhr1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of CFHR1 mRNA] CTD PMID:31150632 Cfhr1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CFHR1 mRNA CTD PMID:31150632 Cfhr1 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of CFHL1 mRNA; Thioacetamide results in decreased expression of CFHR1 more ... CTD PMID:23411599|PMID:34492290 Cfhr1 Rat trimellitic anhydride decreases expression ISO RGD:1321454 6480464 trimellitic anhydride results in decreased expression of CFHR2 mRNA CTD PMID:19042947 Cfhr1 Rat valproic acid decreases methylation ISO RGD:1346225 6480464 Valproic Acid results in decreased methylation of CFHR1 gene CTD PMID:29154799
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Cfhr1 Rat complement component C3b binding enables IBA MGI:3611575|MGI:3646434|MGI:88385|PANTHER:PTN000449073 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Cfhr1 Rat identical protein binding enables ISO RGD:1346225 1624291 UniProtKB:Q03591 PMID:19528535, PMID:23487775, PMID:23728178, PMID:31273197 RGD PMID:19528535|PMID:23487775|PMID:23728178|PMID:31273197 Cfhr1 Rat protein binding enables ISO RGD:1346225 1624291 UniProtKB:P01031|UniProtKB:P02741|UniProtKB:P26022-PRO_0000023545|UniProtKB:P36980|UniProtKB:Q9BXR6|UniProtKB:Q9UHX3 PMID:19528535, PMID:22786770, PMID:23487775, PMID:23728178, PMID:28533443, PMID:31273197, PMID:33961781 RGD PMID:19528535|PMID:22786770|PMID:23487775|PMID:23728178|PMID:28533443|PMID:31273197|PMID:33961781 Cfhr1 Rat protein binding enables ISO RGD:1346225,UniProtKB:Q03591-PRO_0000005896 1624291 UniProtKB:P01024 PMID:27814381 RGD PMID:27814381
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 4,4'-sulfonyldiphenol (ISO) acetamide (EXP) aconitine (EXP) aflatoxin B1 (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) cisplatin (ISO) doxorubicin (ISO) endosulfan (EXP) fenthion (ISO) flutamide (EXP) folic acid (ISO) furan (EXP) lead diacetate (ISO) levofloxacin (EXP) lipopolysaccharide (ISO) methidathion (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP,ISO) nefazodone (EXP) nitrofen (EXP) O-methyleugenol (ISO) okadaic acid (ISO) paracetamol (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) progesterone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) tetrachloromethane (EXP,ISO) thioacetamide (EXP) trimellitic anhydride (ISO) valproic acid (ISO)
Cfhr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 53,946,298 - 53,961,282 (-) NCBI GRCr8 mRatBN7.2 13 51,395,583 - 51,410,571 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 51,369,211 - 51,410,592 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 53,980,575 - 53,995,565 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 55,268,495 - 55,283,485 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 52,535,312 - 52,550,292 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 56,862,666 - 56,877,650 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 56,836,994 - 56,877,650 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 61,880,591 - 61,908,385 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 53,135,397 - 53,150,381 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 53,129,611 - 53,164,476 (-) NCBI Celera 13 51,655,453 - 51,670,441 (-) NCBI Celera Cytogenetic Map 13 q13 NCBI
CFHR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 196,819,731 - 196,832,189 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 196,819,731 - 196,837,159 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 196,788,861 - 196,801,319 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 195,055,484 - 195,067,942 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 193,520,554 - 193,532,974 NCBI Celera 1 179,323,256 - 179,323,617 (-) NCBI Celera Cytogenetic Map 1 q31.3 NCBI CHM1_1 1 198,211,105 - 198,223,561 (+) NCBI CHM1_1
Cfhr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 139,474,802 - 139,487,960 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 139,474,791 - 139,488,010 (-) Ensembl GRCm39 Ensembl GRCm38 1 139,547,064 - 139,560,222 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 139,547,053 - 139,560,272 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 141,443,641 - 141,456,799 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 141,363,475 - 141,376,633 (-) NCBI MGSCv36 mm8 Celera 1 142,179,893 - 142,194,148 (-) NCBI Celera Cytogenetic Map 1 F NCBI cM Map 1 61.62 NCBI
.
Predicted Target Of
Count of predictions: 32 Count of miRNA genes: 29 Interacting mature miRNAs: 30 Transcripts: ENSRNOT00000017195 Prediction methods: Miranda Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 9589141 Insul28 Insulin level QTL 28 10.82 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 13 9313465 54313465 Rat 6893344 Cm79 Cardiac mass QTL 79 1.5 0.04 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 43720770 62022792 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 61391 Bp5 Blood pressure QTL 5 5.6 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 22301875 67301875 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 2317040 Aia21 Adjuvant induced arthritis QTL 21 2.75 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 631645 Bp121 Blood pressure QTL 121 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 14915655 59915655 Rat 2317046 Aia8 Adjuvant induced arthritis QTL 8 3.9700000286102295 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 13 9831541 54831541 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 1331784 Bp222 Blood pressure QTL 222 2.944 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 17694436 53050594 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 2301962 Cm72 Cardiac mass QTL 72 4.12 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 13 31241331 58363171 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat 9589164 Gluco66 Glucose level QTL 66 6.67 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 13 15158722 60158722 Rat 7411662 Foco29 Food consumption QTL 29 20.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 13 9313465 54313465 Rat
RH127572
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 51,384,811 - 51,385,000 (+) MAPPER mRatBN7.2 mRatBN7.2 13 51,384,811 - 51,384,999 (+) MAPPER mRatBN7.2 mRatBN7.2 13 51,410,889 - 51,411,077 (+) MAPPER mRatBN7.2 Rnor_6.0 13 56,877,969 - 56,878,156 NCBI Rnor6.0 Rnor_6.0 13 56,851,895 - 56,852,082 NCBI Rnor6.0 Rnor_5.0 13 61,870,072 - 61,870,259 UniSTS Rnor5.0 Rnor_5.0 13 61,896,146 - 61,896,333 UniSTS Rnor5.0 RGSC_v3.4 13 53,124,626 - 53,124,813 UniSTS RGSC3.4 RGSC_v3.4 13 53,150,700 - 53,150,887 UniSTS RGSC3.4 Celera 13 51,670,760 - 51,670,947 UniSTS Celera 13 51,644,682 - 51,644,869 UniSTS Cytogenetic Map 13 q13 UniSTS
RH127927
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 51,395,687 - 51,395,894 (+) MAPPER mRatBN7.2 Rnor_6.0 13 56,862,771 - 56,862,977 NCBI Rnor6.0 Rnor_5.0 13 61,880,948 - 61,881,154 UniSTS Rnor5.0 RGSC_v3.4 13 53,135,502 - 53,135,708 UniSTS RGSC3.4 Celera 13 51,655,558 - 51,655,764 UniSTS Cytogenetic Map 13 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
6
8
12
40
85
83
57
19
57
5
136
49
22
17
29
26
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000017195 ⟹ ENSRNOP00000017195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 51,395,334 - 51,410,592 (-) Ensembl Rnor_6.0 Ensembl 13 56,862,670 - 56,877,650 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000079040 ⟹ ENSRNOP00000071663
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 51,369,211 - 51,410,532 (-) Ensembl Rnor_6.0 Ensembl 13 56,836,994 - 56,877,611 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105248 ⟹ ENSRNOP00000077196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 51,374,998 - 51,410,532 (-) Ensembl
RefSeq Acc Id:
NM_001044227 ⟹ NP_001037692
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 53,946,298 - 53,961,282 (-) NCBI mRatBN7.2 13 51,395,583 - 51,410,571 (-) NCBI Rnor_6.0 13 56,862,666 - 56,877,650 (-) NCBI Rnor_5.0 13 61,880,591 - 61,908,385 (-) NCBI RGSC_v3.4 13 53,135,397 - 53,150,381 (-) RGD Celera 13 51,655,453 - 51,670,441 (-) RGD
Sequence:
GAAGGAGCACCACGGCTGGAGTGTCCACGGCTTCAGAAGATGGGGTTCTGTCGCCTGTTGTTCTTAGTCAATGTCCTCCTAACCTCATGGTTCTCTTCTGCCAAAGGGGAAGGGATCCATTGTGATTT
hide sequence
RefSeq Acc Id:
NP_001037692 ⟸ NM_001044227
- Peptide Label:
precursor
- UniProtKB:
Q5I0M3 (UniProtKB/TrEMBL), F7ESI5 (UniProtKB/TrEMBL)
- Sequence:
MGFCRLLFLVNVLLTSWFSSAKGEGIHCDFPKIRHGIVYDEKKYEPFSPVPGGKILYYSCEYNFASPSSSFWNPIICTEAGWSPVPKCLRICFFPSVENGHSTSSGQTHKEGDIVQIVCNQGYSLQNN
hide sequence
Ensembl Acc Id:
ENSRNOP00000071663 ⟸ ENSRNOT00000079040
Ensembl Acc Id:
ENSRNOP00000017195 ⟸ ENSRNOT00000017195
Ensembl Acc Id:
ENSRNOP00000077196 ⟸ ENSRNOT00000105248
RGD ID: 13698867 Promoter ID: EPDNEW_R9392 Type: initiation region Name: Cfhr1_1 Description: complement factor H-related 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 56,877,669 - 56,877,729 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2012-07-16
Cfhr1
complement factor H-related 1
Cfhl1
complement component factor h-like 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
Cfhl1
complement component factor h-like 1
Cfhl1_predicted
complement component factor h-like 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Cfhl1_predicted
complement component factor h-like 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
