Symbol:
Schip1
Name:
schwannomin interacting protein 1
RGD ID:
1309962
Description:
Predicted to enable identical protein binding activity. Predicted to be involved in positive regulation of hippo signaling. Predicted to act upstream of or within several processes, including face morphogenesis; fibroblast migration; and luteinization. Predicted to be located in cytosol and nuclear body. Predicted to be active in cell junction and plasma membrane. Orthologous to several human genes including IQCJ-SCHIP1 (IQCJ-SCHIP1 readthrough); INTERACTS WITH 4,4'-diaminodiphenylmethane; 6-propyl-2-thiouracil; allopurinol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC295105; schwannomin-interacting protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 154,437,217 - 155,198,560 (+) NCBI GRCr8 mRatBN7.2 2 152,127,171 - 152,888,587 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 152,126,953 - 152,888,585 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 159,254,429 - 160,014,724 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 157,304,939 - 158,065,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 151,937,697 - 152,698,002 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 172,312,290 - 173,087,236 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 172,312,298 - 172,459,165 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 192,261,956 - 192,275,730 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 191,602,249 - 191,796,738 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 157,848,639 - 158,631,796 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 158,406,527 - 158,581,774 (+) NCBI Celera 2 146,498,127 - 147,247,765 (+) NCBI Celera Cytogenetic Map 2 q32 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Schip1 Rat 1,2-dimethylhydrazine increases expression ISO RGD:1320588 6480464 1,2-Dimethylhydrazine results in increased expression of SCHIP1 mRNA CTD PMID:22206623 Schip1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1320588 6480464 Tetrachlorodibenzodioxin affects the expression of SCHIP1 mRNA CTD PMID:21570461 Schip1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4,4'-diaminodiphenylmethane results in increased expression of SCHIP1 mRNA CTD PMID:30723492 Schip1 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1320588 6480464 Fenretinide results in increased expression of SCHIP1 mRNA CTD PMID:28973697 Schip1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SCHIP1 mRNA CTD PMID:30047161 Schip1 Rat acetazolamide increases expression ISO RGD:1320588 6480464 Acetazolamide results in increased expression of SCHIP1 mRNA CTD PMID:19274763 Schip1 Rat afimoxifene multiple interactions ISO RGD:1320587 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of SCHIP1 mRNA] CTD PMID:21233418 Schip1 Rat aflatoxin B1 decreases expression ISO RGD:1320588 6480464 Aflatoxin B1 results in decreased expression of SCHIP1 mRNA CTD PMID:19770486 Schip1 Rat Aflatoxin B2 alpha increases methylation ISO RGD:1320587 6480464 aflatoxin B2 results in increased methylation of SCHIP1 intron CTD PMID:30157460 Schip1 Rat all-trans-retinoic acid increases expression ISO RGD:1320587 6480464 Tretinoin results in increased expression of SCHIP1 mRNA CTD PMID:23724009 Schip1 Rat allopurinol increases expression EXP 6480464 Allopurinol results in increased expression of SCHIP1 mRNA CTD PMID:37876353 Schip1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SCHIP1 mRNA CTD PMID:30779732 Schip1 Rat arsane multiple interactions ISO RGD:1320587 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCHIP1 more ... CTD PMID:32525701 Schip1 Rat arsane affects methylation ISO RGD:1320587 6480464 Arsenic affects the methylation of SCHIP1 gene CTD PMID:25304211 Schip1 Rat arsenic atom multiple interactions ISO RGD:1320587 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCHIP1 more ... CTD PMID:32525701 Schip1 Rat arsenic atom affects methylation ISO RGD:1320587 6480464 Arsenic affects the methylation of SCHIP1 gene CTD PMID:25304211 Schip1 Rat atrazine decreases expression ISO RGD:1320587 6480464 Atrazine results in decreased expression of SCHIP1 mRNA CTD PMID:22378314 Schip1 Rat benzo[a]pyrene increases expression ISO RGD:1320588 6480464 Benzo(a)pyrene results in increased expression of SCHIP1 mRNA CTD PMID:22228805 Schip1 Rat benzo[a]pyrene decreases methylation ISO RGD:1320588 6480464 Benzo(a)pyrene results in decreased methylation of SCHIP1 intron CTD PMID:27901495 Schip1 Rat benzo[a]pyrene affects methylation ISO RGD:1320587 6480464 Benzo(a)pyrene affects the methylation of SCHIP1 promoter CTD PMID:27901495 Schip1 Rat benzo[a]pyrene increases mutagenesis ISO RGD:1320587 6480464 Benzo(a)pyrene results in increased mutagenesis of SCHIP1 gene CTD PMID:25435355 Schip1 Rat benzo[a]pyrene increases expression ISO RGD:1320587 6480464 Benzo(a)pyrene results in increased expression of SCHIP1 mRNA CTD PMID:20106945 Schip1 Rat benzo[a]pyrene decreases expression ISO RGD:1320588 6480464 Benzo(a)pyrene results in decreased expression of SCHIP1 mRNA CTD PMID:19770486 Schip1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1320587 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of SCHIP1 mRNA CTD PMID:19150397 Schip1 Rat benzo[e]pyrene increases methylation ISO RGD:1320587 6480464 benzo(e)pyrene results in increased methylation of SCHIP1 intron CTD PMID:30157460 Schip1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SCHIP1 mRNA CTD PMID:18164116 Schip1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SCHIP1 mRNA CTD PMID:25181051 Schip1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SCHIP1 mRNA CTD PMID:30816183|PMID:32528016 Schip1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of SCHIP1 gene CTD PMID:28505145 Schip1 Rat bisphenol A decreases expression ISO RGD:1320587 6480464 bisphenol A results in decreased expression of SCHIP1 mRNA CTD PMID:25047013|PMID:29275510 Schip1 Rat bortezomib decreases expression ISO RGD:1320587 6480464 Bortezomib results in decreased expression of SCHIP1 mRNA CTD PMID:20977926 Schip1 Rat calcium silicate decreases expression ISO RGD:1320588 6480464 calcium silicate results in decreased expression of SCHIP1 mRNA CTD PMID:29279043 Schip1 Rat cantharidin decreases expression ISO RGD:1320588 6480464 Cantharidin results in decreased expression of SCHIP1 mRNA CTD PMID:36907384 Schip1 Rat CGP 52608 multiple interactions ISO RGD:1320587 6480464 CGP 52608 promotes the reaction [RORA protein binds to SCHIP1 gene] CTD PMID:28238834 Schip1 Rat choline multiple interactions ISO RGD:1320588 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Schip1 Rat cisplatin increases expression ISO RGD:1320587 6480464 Cisplatin results in increased expression of SCHIP1 mRNA CTD PMID:27392435 Schip1 Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of SCHIP1 mRNA CTD PMID:30047161 Schip1 Rat copper(II) sulfate increases expression ISO RGD:1320587 6480464 Copper Sulfate results in increased expression of SCHIP1 mRNA CTD PMID:19549813 Schip1 Rat crocidolite asbestos decreases expression ISO RGD:1320588 6480464 Asbestos, Crocidolite results in decreased expression of SCHIP1 mRNA CTD PMID:29279043 Schip1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of SCHIP1 mRNA CTD PMID:26577399 Schip1 Rat cyclosporin A decreases expression ISO RGD:1320587 6480464 Cyclosporine results in decreased expression of SCHIP1 mRNA CTD PMID:20106945 Schip1 Rat cyclosporin A increases methylation ISO RGD:1320587 6480464 Cyclosporine results in increased methylation of SCHIP1 promoter CTD PMID:27989131 Schip1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SCHIP1 mRNA CTD PMID:21266533 Schip1 Rat dibutyl phthalate increases expression ISO RGD:1320588 6480464 Dibutyl Phthalate results in increased expression of SCHIP1 mRNA CTD PMID:17361019|PMID:21266533 Schip1 Rat dorsomorphin multiple interactions ISO RGD:1320587 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Schip1 Rat doxorubicin increases expression ISO RGD:1320587 6480464 Doxorubicin results in increased expression of SCHIP1 mRNA CTD PMID:29803840 Schip1 Rat entinostat decreases expression ISO RGD:1320587 6480464 entinostat results in decreased expression of SCHIP1 mRNA CTD PMID:27188386 Schip1 Rat folic acid multiple interactions ISO RGD:1320588 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Schip1 Rat furan increases expression EXP 6480464 furan results in increased expression of SCHIP1 mRNA CTD PMID:27387713 Schip1 Rat genistein decreases expression ISO RGD:1320587 6480464 Genistein results in decreased expression of SCHIP1 mRNA CTD PMID:20884965 Schip1 Rat herbicide multiple interactions ISO RGD:1320587 6480464 [Herbicides results in increased abundance of mesotrione] which affects the methylation of SCHIP1 gene CTD PMID:34516295 Schip1 Rat L-methionine multiple interactions ISO RGD:1320588 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ... CTD PMID:20938992 Schip1 Rat lead diacetate increases expression ISO RGD:1320588 6480464 lead acetate results in increased expression of SCHIP1 mRNA CTD PMID:21829687 Schip1 Rat mesotrione multiple interactions ISO RGD:1320587 6480464 [Herbicides results in increased abundance of mesotrione] which affects the methylation of SCHIP1 gene CTD PMID:34516295 Schip1 Rat methapyrilene increases methylation ISO RGD:1320587 6480464 Methapyrilene results in increased methylation of SCHIP1 intron CTD PMID:30157460 Schip1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of SCHIP1 mRNA CTD PMID:30047161 Schip1 Rat mitoxantrone affects response to substance ISO RGD:1320587 6480464 SCHIP1 protein affects the susceptibility to Mitoxantrone CTD PMID:16217747 Schip1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SCHIP1 mRNA CTD PMID:18164116 Schip1 Rat paracetamol decreases expression ISO RGD:1320587 6480464 Acetaminophen results in decreased expression of SCHIP1 mRNA CTD PMID:21420995 Schip1 Rat pirinixic acid multiple interactions ISO RGD:1320587 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Schip1 Rat SB 431542 multiple interactions ISO RGD:1320587 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Schip1 Rat silicon dioxide increases expression ISO RGD:1320588 6480464 Silicon Dioxide results in increased expression of SCHIP1 mRNA CTD PMID:23221170 Schip1 Rat silver atom increases expression ISO RGD:1320587 6480464 Silver results in increased expression of SCHIP1 mRNA CTD PMID:28959546 Schip1 Rat silver(0) increases expression ISO RGD:1320587 6480464 Silver results in increased expression of SCHIP1 mRNA CTD PMID:28959546 Schip1 Rat sodium arsenate multiple interactions ISO RGD:1320587 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of SCHIP1 more ... CTD PMID:32525701 Schip1 Rat sodium arsenate increases expression ISO RGD:1320588 6480464 sodium arsenate results in increased expression of SCHIP1 mRNA CTD PMID:21795629 Schip1 Rat sodium arsenite affects expression ISO RGD:1320587 6480464 sodium arsenite affects the expression of SCHIP1 mRNA CTD PMID:34032870 Schip1 Rat temozolomide increases expression ISO RGD:1320587 6480464 Temozolomide results in increased expression of SCHIP1 mRNA CTD PMID:31758290 Schip1 Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of SCHIP1 mRNA CTD PMID:21515302 Schip1 Rat tetrachloromethane affects expression ISO RGD:1320588 6480464 Carbon Tetrachloride affects the expression of SCHIP1 mRNA CTD PMID:17484886 Schip1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SCHIP1 mRNA CTD PMID:34492290 Schip1 Rat titanium dioxide increases methylation ISO RGD:1320588 6480464 titanium dioxide results in increased methylation of SCHIP1 gene CTD PMID:35295148 Schip1 Rat titanium dioxide decreases methylation ISO RGD:1320588 6480464 titanium dioxide results in decreased methylation of SCHIP1 gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Schip1 Rat trichostatin A multiple interactions ISO RGD:1320587 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Schip1 Rat triptonide increases expression ISO RGD:1320588 6480464 triptonide results in increased expression of SCHIP1 mRNA CTD PMID:33045310 Schip1 Rat valproic acid decreases methylation ISO RGD:1320587 6480464 Valproic Acid results in decreased methylation of SCHIP1 gene CTD PMID:29154799 Schip1 Rat valproic acid affects expression ISO RGD:1320587 6480464 Valproic Acid affects the expression of SCHIP1 mRNA CTD PMID:25979313 Schip1 Rat valproic acid affects expression ISO RGD:1320588 6480464 Valproic Acid affects the expression of SCHIP1 mRNA CTD PMID:17963808 Schip1 Rat zinc atom multiple interactions ISO RGD:1320587 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SCHIP1 mRNA CTD PMID:18593933 Schip1 Rat zinc(0) multiple interactions ISO RGD:1320587 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of SCHIP1 mRNA CTD PMID:18593933
Biological Process
estrogen metabolic process (IEA,ISO) face morphogenesis (IEA,ISO) female gonad development (IEA,ISO) fibroblast migration (IEA,ISO) kidney development (IEA,ISO) luteinization (IEA,ISO) platelet-derived growth factor receptor signaling pathway (IEA,ISO) positive regulation of hippo signaling (IBA) post-embryonic development (IEA,ISO) roof of mouth development (IEA,ISO) skeletal system morphogenesis (IEA,ISO) smooth muscle tissue development (IEA,ISO)
Schip1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 154,437,217 - 155,198,560 (+) NCBI GRCr8 mRatBN7.2 2 152,127,171 - 152,888,587 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 152,126,953 - 152,888,585 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 159,254,429 - 160,014,724 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 157,304,939 - 158,065,238 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 151,937,697 - 152,698,002 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 172,312,290 - 173,087,236 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 172,312,298 - 172,459,165 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 192,261,956 - 192,275,730 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Rnor_5.0 2 191,602,249 - 191,796,738 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 157,848,639 - 158,631,796 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 158,406,527 - 158,581,774 (+) NCBI Celera 2 146,498,127 - 147,247,765 (+) NCBI Celera Cytogenetic Map 2 q32 NCBI
SCHIP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 159,273,244 - 159,897,359 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 159,273,244 - 159,897,629 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 158,991,033 - 159,615,148 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 160,474,238 - 161,097,833 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 160,474,245 - 161,097,841 NCBI Celera 3 157,413,298 - 158,036,888 (+) NCBI Celera Cytogenetic Map 3 q25.32-q25.33 NCBI HuRef 3 156,387,582 - 157,011,650 (+) NCBI HuRef CHM1_1 3 158,953,931 - 159,578,052 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 162,047,599 - 162,671,965 (+) NCBI T2T-CHM13v2.0
Schip1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 67,972,135 - 68,533,815 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 67,972,135 - 68,533,814 (+) Ensembl GRCm39 Ensembl GRCm38 3 68,064,802 - 68,626,482 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 68,064,802 - 68,626,481 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 67,696,154 - 68,430,404 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 68,660,436 - 68,714,362 (+) NCBI MGSCv36 mm8 Celera 3 68,016,690 - 68,758,776 (+) NCBI Celera Cytogenetic Map 3 E1 NCBI cM Map 3 31.44 NCBI
Schip1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 9,980,467 - 10,504,308 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 10,364,261 - 10,502,799 (+) NCBI ChiLan1.0 ChiLan1.0
SCHIP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 157,224,331 - 157,836,221 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 157,229,063 - 157,840,953 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 156,307,829 - 156,919,728 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 164,357,503 - 164,969,361 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 164,837,723 - 164,968,769 (+) Ensembl panpan1.1 panPan2
SCHIP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 30,980,120 - 31,771,463 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 30,979,558 - 31,024,369 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 3,509,541 - 4,324,917 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 111 Count of miRNA genes: 95 Interacting mature miRNAs: 105 Transcripts: ENSRNOT00000057473 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 12879836 Kidm61 Kidney mass QTL 61 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 185122374 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 10043136 Iddm54 Insulin dependent diabetes mellitus QTL 54 3.4 0.0001 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 143657411 190602963 Rat 12879837 Am2 Aortic mass QTL 2 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 185122374 Rat 12879838 Cm86 Cardiac mass QTL 86 0.002 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 185122374 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 12879839 Cm85 Cardiac mass QTL 85 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 185122374 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 12879845 Cm89 Cardiac mass QTL 89 0.008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 152413072 175950118 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 12879846 Cm90 Cardiac mass QTL 90 0.011 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 2 152413072 175950118 Rat 12879847 Am4 Aortic mass QTL 4 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 152413072 175950118 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879840 Bw179 Body weight QTL 179 0.005 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 185122374 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2301415 Cm67 Cardiac mass QTL 67 0.003 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 152413072 175950118 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 11565180 Kidm56 Kidney mass QTL 56 0.003 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 152413072 175950118 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1598805 Memor8 Memory QTL 8 3 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 150341585 189039377 Rat 11565181 Bw176 Body weight QTL 176 0.002 body mass (VT:0001259) body weight (CMO:0000012) 2 152413072 175950118 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 61401 Niddm2 Non-insulin dependent diabetes mellitus QTL 2 4.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 144599348 189599348 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 631520 Bp73 Blood pressure QTL 73 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147686913 168355276 Rat 1598833 Bp295 Blood pressure QTL 295 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 147798556 192798556 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 6903312 Bw112 Body weight QTL 112 3.2 0.0013 body mass (VT:0001259) body weight (CMO:0000012) 2 143657569 184114274 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
D2Rat164
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 154,505,105 - 154,505,346 (+) Marker Load Pipeline mRatBN7.2 2 152,195,074 - 152,195,315 (-) MAPPER mRatBN7.2 Rnor_6.0 2 173,019,958 - 173,020,198 NCBI Rnor6.0 Rnor_5.0 2 192,362,243 - 192,362,483 UniSTS Rnor5.0 RGSC_v3.4 2 157,916,864 - 157,917,105 RGD RGSC3.4 RGSC_v3.4 2 157,916,865 - 157,917,105 UniSTS RGSC3.4 RGSC_v3.1 2 157,866,827 - 157,867,068 RGD Celera 2 146,566,029 - 146,566,267 UniSTS RH 3.4 Map 2 998.3 UniSTS RH 3.4 Map 2 998.3 RGD RH 2.0 Map 2 717.9 RGD SHRSP x BN Map 2 63.9498 RGD Cytogenetic Map 2 q31 UniSTS
D2Mco7
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 154,848,026 - 154,848,168 (+) Marker Load Pipeline mRatBN7.2 2 152,538,025 - 152,538,167 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,671,254 - 172,671,395 NCBI Rnor6.0 Rnor_5.0 2 192,008,113 - 192,008,254 UniSTS Rnor5.0 RGSC_v3.4 2 158,273,500 - 158,273,642 RGD RGSC3.4 RGSC_v3.4 2 158,273,501 - 158,273,642 UniSTS RGSC3.4 RGSC_v3.1 2 158,223,463 - 158,223,605 RGD Celera 2 146,902,236 - 146,902,377 UniSTS Cytogenetic Map 2 q31 UniSTS
D2Mco8
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 154,723,085 - 154,723,324 (+) Marker Load Pipeline mRatBN7.2 2 152,413,072 - 152,413,311 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,795,683 - 172,795,921 NCBI Rnor6.0 Rnor_5.0 2 192,132,537 - 192,132,775 UniSTS Rnor5.0 RGSC_v3.4 2 158,146,823 - 158,147,062 RGD RGSC3.4 RGSC_v3.4 2 158,146,824 - 158,147,062 UniSTS RGSC3.4 RGSC_v3.1 2 158,096,786 - 158,097,025 RGD Celera 2 146,777,810 - 146,778,054 UniSTS Cytogenetic Map 2 q31 UniSTS
D2Mco14
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 154,847,947 - 154,848,165 (+) Marker Load Pipeline mRatBN7.2 2 152,537,946 - 152,538,164 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,671,257 - 172,671,474 NCBI Rnor6.0 Rnor_5.0 2 192,008,116 - 192,008,333 UniSTS Rnor5.0 RGSC_v3.4 2 158,273,421 - 158,273,639 RGD RGSC3.4 RGSC_v3.4 2 158,273,422 - 158,273,639 UniSTS RGSC3.4 RGSC_v3.1 2 158,223,384 - 158,223,602 RGD Celera 2 146,902,157 - 146,902,374 UniSTS Cytogenetic Map 2 q31 UniSTS
D2Got334
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,312,197 - 152,312,341 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,908,577 - 172,908,720 NCBI Rnor6.0 Rnor_5.0 2 192,245,584 - 192,245,727 UniSTS Rnor5.0 RGSC_v3.4 2 158,045,761 - 158,045,904 UniSTS RGSC3.4 Celera 2 146,677,377 - 146,677,532 UniSTS Cytogenetic Map 2 q31 UniSTS
D2Got379
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 154,437,646 - 154,437,838 (+) Marker Load Pipeline mRatBN7.2 2 152,127,600 - 152,127,792 (-) MAPPER mRatBN7.2 Rnor_6.0 2 173,086,615 - 173,086,806 NCBI Rnor6.0 Rnor_5.0 2 192,428,843 - 192,429,034 UniSTS Rnor5.0 RGSC_v3.4 2 157,849,069 - 157,849,260 UniSTS RGSC3.4 Celera 2 146,498,557 - 146,498,748 UniSTS Cytogenetic Map 2 q31 UniSTS
BF403845
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,296,390 - 152,296,551 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,924,301 - 172,924,461 NCBI Rnor6.0 Rnor_5.0 2 192,261,308 - 192,261,468 UniSTS Rnor5.0 RGSC_v3.4 2 158,029,956 - 158,030,116 UniSTS RGSC3.4 Celera 2 146,661,571 - 146,661,731 UniSTS RH 3.4 Map 2 999.1 UniSTS Cytogenetic Map 2 q31 UniSTS
RH137633
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,500,287 - 152,500,434 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,708,352 - 172,708,498 NCBI Rnor6.0 Rnor_5.0 2 192,045,402 - 192,045,548 UniSTS Rnor5.0 RGSC_v3.4 2 158,236,307 - 158,236,453 UniSTS RGSC3.4 Celera 2 146,865,002 - 146,865,148 UniSTS Cytogenetic Map 2 q31 UniSTS
AI170339
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,744,073 - 152,744,169 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,465,806 - 172,465,901 NCBI Rnor6.0 Rnor_5.0 2 191,803,368 - 191,803,463 UniSTS Rnor5.0 RGSC_v3.4 2 158,481,573 - 158,481,668 UniSTS RGSC3.4 Celera 2 147,107,387 - 147,107,482 UniSTS RH 3.4 Map 2 1001.8 UniSTS Cytogenetic Map 2 q31 UniSTS
G44760
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,775,630 - 152,775,876 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,434,032 - 172,434,277 NCBI Rnor6.0 Rnor_5.0 2 191,771,360 - 191,771,605 UniSTS Rnor5.0 RGSC_v3.4 2 158,513,404 - 158,513,649 UniSTS RGSC3.4 Celera 2 147,138,867 - 147,139,112 UniSTS Cytogenetic Map 2 q31 UniSTS
D17S1446E
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 152,832,101 - 152,832,510 (-) MAPPER mRatBN7.2 Rnor_6.0 2 172,367,777 - 172,368,185 NCBI Rnor6.0 Rnor_5.0 2 191,716,355 - 191,716,763 UniSTS Rnor5.0 Cytogenetic Map 2 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000057473 ⟹ ENSRNOP00000054283
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 152,126,953 - 152,888,584 (+) Ensembl Rnor_6.0 Ensembl 2 172,312,332 - 172,459,165 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000085876 ⟹ ENSRNOP00000069226
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 152,838,509 - 152,888,579 (+) Ensembl Rnor_6.0 Ensembl 2 172,312,298 - 172,361,779 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000096555 ⟹ ENSRNOP00000088969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 152,826,697 - 152,888,584 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000110983 ⟹ ENSRNOP00000082059
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 152,305,857 - 152,888,585 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115543 ⟹ ENSRNOP00000097397
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 152,305,226 - 152,888,584 (+) Ensembl
RefSeq Acc Id:
NM_001100666 ⟹ NP_001094136
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 154,437,217 - 155,198,560 (+) NCBI mRatBN7.2 2 152,127,171 - 152,888,587 (+) NCBI Rnor_6.0 2 172,312,290 - 173,087,236 (-) NCBI Rnor_5.0 2 191,602,249 - 191,796,738 (-) NCBI Rnor_5.0 2 192,261,956 - 192,275,730 (-) NCBI RGSC_v3.4 2 157,848,639 - 158,631,796 (+) RGD Celera 2 146,498,127 - 147,247,765 (+) RGD
Sequence:
CCGAGGAACACCGTGCGGCAGCCTCTGATTCAGTCTCCTCTTACCTGCAGGTGCTCTAGAAACTTCAAAATGCGACTGGAAGAACTAAAAAGACTACAGAATCCTTTAGAACAAGTTGATGATGGAAA
hide sequence
RefSeq Acc Id:
XM_008761080 ⟹ XP_008759302
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,060,423 - 155,198,558 (+) NCBI mRatBN7.2 2 152,750,448 - 152,888,587 (+) NCBI Rnor_6.0 2 172,312,290 - 172,459,534 (-) NCBI
Sequence:
GGAATCAGAATTCAGTGGGAAAGTGTTTGGGAGAATCCTTGGGGTGGAGTGCCAGGGCGCGCCTGGTGTAAAATGGTTAACACAAAGTCCGCGCGCGCCCCTGGGCTATGAGGGTGAAAAGTGCGCGC
hide sequence
RefSeq Acc Id:
XM_008761082 ⟹ XP_008759304
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,142,012 - 155,198,558 (+) NCBI mRatBN7.2 2 152,838,285 - 152,888,587 (+) NCBI Rnor_6.0 2 172,312,290 - 172,364,520 (-) NCBI
Sequence:
AATGCACTATTGTTTGTAAAACTTGTGTGTGTAATTAATGATAAAAGTGTAGTTTTCCTAATTCTAACTCTGTACTGAAGGCAACCCAGTTATAATGAAGGTAAATAGGTTTTGTCAGAATTTTACGT
hide sequence
RefSeq Acc Id:
XM_008761083 ⟹ XP_008759305
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,132,411 - 155,198,558 (+) NCBI mRatBN7.2 2 152,827,172 - 152,888,587 (+) NCBI Rnor_6.0 2 172,312,290 - 172,373,132 (-) NCBI
Sequence:
CTCGGCTCAGCAGCCTGCCTCCCGGTTCCGGAGGAGCAGAGCAGCTCGGAGGCTTCAGAGCAAGCTCTGTGGCTGCGCGCTTCCCAGCACAGGCAGTGCCACTGCGCAGGTTGCTCAGCGGAACAGCA
hide sequence
RefSeq Acc Id:
XM_039102019 ⟹ XP_038957947
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,059,513 - 155,198,558 (+) NCBI mRatBN7.2 2 152,749,540 - 152,888,587 (+) NCBI
RefSeq Acc Id:
XM_063281588 ⟹ XP_063137658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 154,615,306 - 155,198,558 (+) NCBI
RefSeq Acc Id:
XM_063281589 ⟹ XP_063137659
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,034,517 - 155,198,558 (+) NCBI
RefSeq Acc Id:
XM_063281590 ⟹ XP_063137660
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 155,160,567 - 155,198,558 (+) NCBI
RefSeq Acc Id:
NP_001094136 ⟸ NM_001100666
- UniProtKB:
F1M6Q1 (UniProtKB/TrEMBL)
- Sequence:
MRLEELKRLQNPLEQVDDGKYLLENHQLATDMENNIENYPLSLQPLESKVKIIQRAWREYLQRQDPLEKRSPSPPSVSSDKLSSSVSMNTFSDSSTPDYREDGMDLGSDAGSSSSSSRASSQSNSTKV
hide sequence
RefSeq Acc Id:
XP_008759302 ⟸ XM_008761080
- Peptide Label:
isoform X3
- Sequence:
MDLGSDAGSSSSSSRASSQSNSTKVTPCSECKSSSSPGGSLDLVSALEDYEEPFPVYQKKVIDE
hide sequence
RefSeq Acc Id:
XP_008759305 ⟸ XM_008761083
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I6GHN3 (UniProtKB/TrEMBL), A6J5M2 (UniProtKB/TrEMBL), Q562A8 (UniProtKB/TrEMBL)
- Sequence:
MVHQENCSYQAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSSRLQSGMNLQICFVND
hide sequence
RefSeq Acc Id:
XP_008759304 ⟸ XM_008761082
- Peptide Label:
isoform X4
- UniProtKB:
B5DFD3 (UniProtKB/TrEMBL), Q562A8 (UniProtKB/TrEMBL)
- Sequence:
MNLDRDGMDDDIISRESPLDLEGNYKKAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSL
hide sequence
Ensembl Acc Id:
ENSRNOP00000054283 ⟸ ENSRNOT00000057473
Ensembl Acc Id:
ENSRNOP00000069226 ⟸ ENSRNOT00000085876
RefSeq Acc Id:
XP_038957947 ⟸ XM_039102019
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000088969 ⟸ ENSRNOT00000096555
Ensembl Acc Id:
ENSRNOP00000082059 ⟸ ENSRNOT00000110983
Ensembl Acc Id:
ENSRNOP00000097397 ⟸ ENSRNOT00000115543
RefSeq Acc Id:
XP_063137658 ⟸ XM_063281588
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6AUB8 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063137659 ⟸ XM_063281589
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_063137660 ⟸ XM_063281590
- Peptide Label:
isoform X6
- UniProtKB:
Q562A8 (UniProtKB/TrEMBL)
RGD ID: 13691382 Promoter ID: EPDNEW_R1903 Type: single initiation site Name: Schip1_1 Description: schwannomin interacting protein 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 172,361,725 - 172,361,785 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-12-06
Schip1
schwannomin interacting protein 1
Schip1_predicted
schwannomin interacting protein 1 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-12
Schip1_predicted
schwannomin interacting protein 1 (predicted)
Symbol and Name status set to approved
70820 APPROVED
