Symbol:
Prkcsh
Name:
PRKCSH beta subunit of glucosidase II
RGD ID:
1309628
Description:
Predicted to enable several functions, including calcium ion binding activity; protein kinase C binding activity; and transmembrane transporter binding activity. Predicted to be involved in N-glycan processing and liver development. Predicted to act upstream of or within in utero embryonic development; negative regulation of neuron projection development; and nitrogen cycle metabolic process. Predicted to be located in endoplasmic reticulum. Predicted to be part of glucosidase II complex. Human ortholog(s) of this gene implicated in liver disease and polycystic liver disease 1. Orthologous to human PRKCSH (PRKCSH beta subunit of glucosidase II); PARTICIPATES IN Endoplasmic Reticulum-associated degradation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,5-hexanedione; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
glucosidase 2 subunit beta; LOC300445; protein kinase C substrate 80K-H
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 28,810,836 - 28,822,503 (+) NCBI GRCr8 mRatBN7.2 8 20,534,787 - 20,546,493 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 20,534,880 - 20,546,492 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 24,563,846 - 24,575,397 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 22,860,989 - 22,872,540 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 20,764,484 - 20,776,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 23,014,802 - 23,026,507 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 23,014,956 - 23,026,503 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 23,069,586 - 23,081,291 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 21,107,041 - 21,144,270 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 21,106,881 - 21,117,476 (+) NCBI Celera 8 21,925,450 - 21,937,160 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkcsh Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PRKCSH mRNA CTD PMID:22079256 Prkcsh Rat (-)-epigallocatechin 3-gallate increases expression ISO PRKCSH (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PRKCSH protein CTD PMID:31195006 Prkcsh Rat (S)-nicotine decreases expression ISO PRKCSH (Homo sapiens) 6480464 Nicotine results in decreased expression of PRKCSH mRNA CTD PMID:16949557 Prkcsh Rat 14-Deoxy-11,12-didehydroandrographolide decreases expression ISO PRKCSH (Homo sapiens) 6480464 14-deoxy-11 and 12-didehydroandrographolide results in decreased expression of PRKCSH mRNA CTD PMID:22101062 Prkcsh Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Prkcsh (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Prkcsh Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO PRKCSH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prkcsh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Prkcsh (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCSH mRNA CTD PMID:17942748 Prkcsh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PRKCSH mRNA CTD PMID:33387578 and PMID:34747641 Prkcsh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Prkcsh (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PRKCSH mRNA CTD PMID:21570461 Prkcsh Rat 2,4,6-tribromophenol increases expression ISO PRKCSH (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Prkcsh Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of PRKCSH protein CTD PMID:19033394 Prkcsh Rat 2,6-dimethoxyphenol multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Prkcsh Rat 2-bromohexadecanoic acid multiple interactions ISO PRKCSH (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PRKCSH protein] CTD PMID:38195004 Prkcsh Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO PRKCSH (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of PRKCSH protein CTD PMID:31675489 Prkcsh Rat 4,4'-sulfonyldiphenol decreases expression ISO Prkcsh (Mus musculus) 6480464 bisphenol S results in decreased expression of PRKCSH mRNA CTD PMID:39298647 Prkcsh Rat 4,4'-sulfonyldiphenol increases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol S results in increased expression of PRKCSH protein CTD PMID:34186270 Prkcsh Rat acrolein multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRKCSH mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PRKCSH mRNA CTD PMID:32699268 Prkcsh Rat aflatoxin B1 increases methylation ISO PRKCSH (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of PRKCSH intron CTD PMID:30157460 Prkcsh Rat Aflatoxin B2 alpha decreases methylation ISO PRKCSH (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of PRKCSH intron CTD PMID:30157460 Prkcsh Rat alpha-pinene multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRKCSH mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased expression of PRKCSH mRNA CTD PMID:32699268 Prkcsh Rat asbestos affects expression ISO PRKCSH (Homo sapiens) 6480464 Asbestos affects the expression of PRKCSH mRNA CTD PMID:17297452 Prkcsh Rat benzatropine multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of PRKCSH protein CTD PMID:34122009 Prkcsh Rat beta-lapachone decreases expression ISO PRKCSH (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PRKCSH mRNA CTD PMID:38218311 Prkcsh Rat bis(2-ethylhexyl) phthalate increases expression ISO Prkcsh (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PRKCSH mRNA CTD PMID:33754040 Prkcsh Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PRKCSH mRNA CTD PMID:25181051 and PMID:34947998 Prkcsh Rat bisphenol A decreases expression ISO Prkcsh (Mus musculus) 6480464 bisphenol A results in decreased expression of PRKCSH protein CTD PMID:35999755 Prkcsh Rat bisphenol A increases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol A results in increased expression of PRKCSH protein CTD PMID:37567409 Prkcsh Rat bisphenol A decreases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol A results in decreased expression of PRKCSH protein CTD PMID:31675489 Prkcsh Rat bisphenol A affects expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol A affects the expression of PRKCSH mRNA CTD PMID:30903817 Prkcsh Rat bisphenol AF increases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol AF results in increased expression of PRKCSH protein CTD PMID:34186270 Prkcsh Rat Bisphenol B increases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol B results in increased expression of PRKCSH protein CTD PMID:34186270 Prkcsh Rat bisphenol F increases expression ISO PRKCSH (Homo sapiens) 6480464 bisphenol F results in increased expression of PRKCSH protein CTD PMID:34186270 Prkcsh Rat Brodifacoum increases expression EXP 6480464 bromfenacoum results in increased expression of PRKCSH protein CTD PMID:28903499 Prkcsh Rat butan-1-ol multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PRKCSH mRNA CTD PMID:29432896 Prkcsh Rat cadmium atom decreases expression ISO PRKCSH (Homo sapiens) 6480464 Cadmium results in decreased expression of PRKCSH mRNA CTD PMID:23369406 Prkcsh Rat cadmium atom multiple interactions ISO PRKCSH (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PRKCSH protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PRKCSH protein CTD PMID:38195004 Prkcsh Rat cadmium dichloride multiple interactions ISO PRKCSH (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PRKCSH protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of PRKCSH protein CTD PMID:38195004 Prkcsh Rat caffeine increases expression ISO PRKCSH (Homo sapiens) 6480464 Caffeine results in increased expression of PRKCSH protein CTD PMID:31195006 Prkcsh Rat carfilzomib increases response to substance ISO Prkcsh (Mus musculus) 6480464 PRKCSH gene mutant form results in increased susceptibility to carfilzomib CTD PMID:21685914 Prkcsh Rat chlorpyrifos increases expression ISO Prkcsh (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PRKCSH mRNA CTD PMID:37019170 Prkcsh Rat clofibrate multiple interactions ISO Prkcsh (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PRKCSH mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PRKCSH mRNA] CTD PMID:17585979 Prkcsh Rat clofibrate decreases expression ISO Prkcsh (Mus musculus) 6480464 Clofibrate results in decreased expression of PRKCSH mRNA CTD PMID:17585979 Prkcsh Rat CU-O LINKAGE decreases expression ISO PRKCSH (Homo sapiens) 6480464 cupric oxide results in decreased expression of PRKCSH protein CTD PMID:25470785 Prkcsh Rat Cuprizon multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in increased expression of PRKCSH protein and [Cuprizone co-treated with Haloperidol] results in increased expression of PRKCSH protein CTD PMID:34122009 Prkcsh Rat decabromodiphenyl ether increases expression ISO PRKCSH (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of PRKCSH protein CTD PMID:31675489 Prkcsh Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of PRKCSH mRNA CTD PMID:21266533 Prkcsh Rat dicrotophos increases expression ISO PRKCSH (Homo sapiens) 6480464 dicrotophos results in increased expression of PRKCSH mRNA CTD PMID:28302478 Prkcsh Rat diethylstilbestrol increases expression ISO PRKCSH (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of PRKCSH mRNA CTD PMID:15766595 Prkcsh Rat diethylstilbestrol increases expression ISO Prkcsh (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of PRKCSH mRNA CTD PMID:14648872 Prkcsh Rat doxorubicin affects expression ISO PRKCSH (Homo sapiens) 6480464 Doxorubicin affects the expression of PRKCSH protein CTD PMID:29385562 Prkcsh Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of PRKCSH protein CTD PMID:31464424 Prkcsh Rat endosulfan affects expression EXP 6480464 Endosulfan affects the expression of PRKCSH mRNA CTD PMID:31464424 Prkcsh Rat enzyme inhibitor multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of PRKCSH protein CTD PMID:23301498 Prkcsh Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PRKCSH mRNA CTD PMID:24136188 Prkcsh Rat furfural multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PRKCSH protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of PRKCSH protein CTD PMID:38598786 Prkcsh Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PRKCSH mRNA CTD PMID:22061828 Prkcsh Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of PRKCSH mRNA CTD PMID:24136188 Prkcsh Rat haloperidol multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Cuprizone co-treated with Haloperidol] results in increased expression of PRKCSH protein CTD PMID:34122009 Prkcsh Rat hydralazine multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PRKCSH mRNA CTD PMID:17183730 Prkcsh Rat ivermectin decreases expression ISO PRKCSH (Homo sapiens) 6480464 Ivermectin results in decreased expression of PRKCSH protein CTD PMID:32959892 Prkcsh Rat Monobutylphthalate decreases expression ISO Prkcsh (Mus musculus) 6480464 monobutyl phthalate results in decreased expression of PRKCSH protein CTD PMID:20553848 Prkcsh Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases response to substance ISO Prkcsh (Mus musculus) 6480464 PRKCSH gene mutant form results in increased susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde CTD PMID:21685914 Prkcsh Rat N-methyl-4-phenylpyridinium decreases expression ISO Prkcsh (Mus musculus) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PRKCSH protein CTD PMID:26558463 Prkcsh Rat nicotine decreases expression ISO PRKCSH (Homo sapiens) 6480464 Nicotine results in decreased expression of PRKCSH mRNA CTD PMID:16949557 Prkcsh Rat nitrates multiple interactions ISO Prkcsh (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRKCSH mRNA CTD PMID:35964746 Prkcsh Rat ochratoxin A multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [ochratoxin A results in increased acetylation of PRKCSH promoter] which results in increased expression of PRKCSH mRNA CTD PMID:29098329 Prkcsh Rat ochratoxin A increases expression ISO PRKCSH (Homo sapiens) 6480464 ochratoxin A results in increased expression of PRKCSH mRNA CTD PMID:29098329 Prkcsh Rat ochratoxin A increases acetylation ISO PRKCSH (Homo sapiens) 6480464 ochratoxin A results in increased acetylation of PRKCSH promoter CTD PMID:29098329 Prkcsh Rat ozone multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of PRKCSH mRNA more ... CTD PMID:32699268 Prkcsh Rat paracetamol multiple interactions ISO Prkcsh (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of PRKCSH mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of PRKCSH mRNA] CTD PMID:17585979 Prkcsh Rat paracetamol increases expression ISO PRKCSH (Homo sapiens) 6480464 Acetaminophen results in increased expression of PRKCSH mRNA CTD PMID:22230336 Prkcsh Rat paracetamol affects expression ISO Prkcsh (Mus musculus) 6480464 Acetaminophen affects the expression of PRKCSH mRNA CTD PMID:17562736 Prkcsh Rat phenobarbital decreases expression ISO Prkcsh (Mus musculus) 6480464 Phenobarbital results in decreased expression of PRKCSH protein CTD PMID:35881160 Prkcsh Rat phenobarbital decreases expression ISO PRKCSH (Homo sapiens) 6480464 Phenobarbital results in decreased expression of PRKCSH protein CTD PMID:35881160 Prkcsh Rat potassium chromate increases expression ISO PRKCSH (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PRKCSH mRNA CTD PMID:22079256 Prkcsh Rat potassium chromate multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PRKCSH mRNA CTD PMID:22079256 Prkcsh Rat SB 431542 multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PRKCSH protein CTD PMID:37664457 Prkcsh Rat serpentine asbestos increases expression ISO PRKCSH (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of PRKCSH mRNA CTD PMID:29523930 Prkcsh Rat sodium arsenite increases expression ISO PRKCSH (Homo sapiens) 6480464 sodium arsenite results in increased expression of PRKCSH mRNA CTD PMID:17879257 and PMID:38568856 Prkcsh Rat sodium chloride multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of PRKCSH protein more ... CTD PMID:38598786 Prkcsh Rat sulindac sulfide decreases expression ISO PRKCSH (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PRKCSH mRNA CTD PMID:16184548 Prkcsh Rat titanium dioxide increases expression ISO PRKCSH (Homo sapiens) 6480464 titanium dioxide results in increased expression of PRKCSH protein CTD PMID:30910687 Prkcsh Rat triphenyl phosphate affects expression ISO PRKCSH (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PRKCSH mRNA CTD PMID:37042841 Prkcsh Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of PRKCSH protein CTD PMID:32519852 Prkcsh Rat valproic acid multiple interactions ISO PRKCSH (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of PRKCSH mRNA CTD PMID:17183730 Prkcsh Rat valproic acid affects expression ISO Prkcsh (Mus musculus) 6480464 Valproic Acid affects the expression of PRKCSH mRNA CTD PMID:17292431 Prkcsh Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PRKCSH mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 14-Deoxy-11,12-didehydroandrographolide (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2,5-hexanedione (EXP) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) acrolein (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) alpha-pinene (ISO) asbestos (ISO) benzatropine (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) Brodifacoum (EXP) butan-1-ol (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carfilzomib (ISO) chlorpyrifos (ISO) clofibrate (ISO) CU-O LINKAGE (ISO) Cuprizon (ISO) decabromodiphenyl ether (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) diethylstilbestrol (ISO) doxorubicin (ISO) endosulfan (EXP) enzyme inhibitor (ISO) flutamide (EXP) furfural (ISO) gentamycin (EXP) glafenine (EXP) haloperidol (ISO) hydralazine (ISO) ivermectin (ISO) Monobutylphthalate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-4-phenylpyridinium (ISO) nicotine (ISO) nitrates (ISO) ochratoxin A (ISO) ozone (ISO) paracetamol (ISO) phenobarbital (ISO) potassium chromate (ISO) SB 431542 (ISO) serpentine asbestos (ISO) sodium arsenite (ISO) sodium chloride (ISO) sulindac sulfide (ISO) titanium dioxide (ISO) triphenyl phosphate (ISO) Triptolide (EXP) valproic acid (ISO) vinclozolin (EXP)
1.
Abnormal hepatocystin caused by truncating PRKCSH mutations leads to autosomal dominant polycystic liver disease.
Drenth JP, etal., Hepatology. 2004 Apr;39(4):924-31. doi: 10.1002/hep.20141.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
4.
Identification of 80K-H as a protein involved in GLUT4 vesicle trafficking.
Hodgkinson CP, etal., Biochem J. 2005 Jun 15;388(Pt 3):785-93.
5.
Mutations in PRKCSH cause isolated autosomal dominant polycystic liver disease.
Li A, etal., Am J Hum Genet. 2003 Mar;72(3):691-703. Epub 2003 Jan 15.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Comprehensive gene review and curation
RGD comprehensive gene curation
13.
Hepatocystin contributes to interferon-mediated antiviral response to hepatitis B virus by regulating hepatocyte nuclear factor 4α.
Shin GC, etal., Biochim Biophys Acta. 2014 Sep;1842(9):1648-57. doi: 10.1016/j.bbadis.2014.04.016. Epub 2014 Apr 25.
Prkcsh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 28,810,836 - 28,822,503 (+) NCBI GRCr8 mRatBN7.2 8 20,534,787 - 20,546,493 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 20,534,880 - 20,546,492 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 24,563,846 - 24,575,397 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 22,860,989 - 22,872,540 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 20,764,484 - 20,776,034 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 23,014,802 - 23,026,507 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 23,014,956 - 23,026,503 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 23,069,586 - 23,081,291 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 21,107,041 - 21,144,270 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 21,106,881 - 21,117,476 (+) NCBI Celera 8 21,925,450 - 21,937,160 (+) NCBI Celera Cytogenetic Map 8 q13 NCBI
PRKCSH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 11,435,635 - 11,450,968 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 11,435,284 - 11,450,968 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 11,546,456 - 11,561,783 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 11,407,269 - 11,422,783 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 11,407,268 - 11,422,783 NCBI Celera 19 11,441,004 - 11,456,521 (+) NCBI Celera Cytogenetic Map 19 p13.2 NCBI HuRef 19 11,121,465 - 11,136,774 (+) NCBI HuRef CHM1_1 19 11,546,291 - 11,561,813 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 11,563,157 - 11,578,487 (+) NCBI T2T-CHM13v2.0
Prkcsh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 21,914,314 - 21,925,521 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 21,914,102 - 21,925,518 (+) Ensembl GRCm39 Ensembl GRCm38 9 22,002,988 - 22,014,245 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 22,002,806 - 22,014,222 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 21,807,479 - 21,818,666 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 21,753,437 - 21,764,624 (+) NCBI MGSCv36 mm8 Celera 9 19,272,723 - 19,283,910 (+) NCBI Celera Cytogenetic Map 9 A3 NCBI cM Map 9 8.04 NCBI
Prkcsh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 2,331,569 - 2,337,946 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 2,331,075 - 2,338,479 (+) NCBI ChiLan1.0 ChiLan1.0
PRKCSH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 16,347,888 - 16,363,595 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 15,347,265 - 15,364,284 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 10,981,398 - 10,997,062 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 11,693,620 - 11,707,610 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 11,693,620 - 11,707,728 (+) Ensembl panpan1.1 panPan2
PRKCSH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 49,905,246 - 49,916,551 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 20 49,905,248 - 49,916,463 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 49,775,959 - 49,787,692 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 50,423,129 - 50,434,871 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 50,423,115 - 50,434,799 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 49,633,425 - 49,645,158 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 50,059,568 - 50,071,314 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 50,302,755 - 50,314,497 (-) NCBI UU_Cfam_GSD_1.0
Prkcsh Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 208,843,072 - 208,853,320 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 1,501,419 - 1,511,625 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 1,501,425 - 1,511,634 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKCSH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 70,097,444 - 70,114,446 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 70,097,424 - 70,114,460 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 70,332,429 - 70,349,468 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKCSH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 10,360,392 - 10,375,785 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 10,360,751 - 10,374,208 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 9,511,189 - 9,526,419 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkcsh
.
Predicted Target Of
Count of predictions: 205 Count of miRNA genes: 127 Interacting mature miRNAs: 143 Transcripts: ENSRNOT00000018009 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 9590084 Insglur5 Insulin/glucose ratio QTL 5 18.54 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 8 1 24597739 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat
RH128469
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 20,546,338 - 20,546,488 (+) MAPPER mRatBN7.2 Rnor_6.0 8 23,026,353 - 23,026,502 NCBI Rnor6.0 Rnor_5.0 8 23,081,137 - 23,081,286 UniSTS Rnor5.0 Celera 8 21,937,008 - 21,937,157 UniSTS Cytogenetic Map 8 q13 UniSTS
RH129453
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 20,546,305 - 20,546,465 (+) MAPPER mRatBN7.2 Rnor_6.0 8 23,026,320 - 23,026,479 NCBI Rnor6.0 Rnor_5.0 8 23,081,104 - 23,081,263 UniSTS Rnor5.0 Celera 8 21,936,975 - 21,937,134 UniSTS RH 3.4 Map 8 183.7 UniSTS Cytogenetic Map 8 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018009 ⟹ ENSRNOP00000018009
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 20,534,880 - 20,546,491 (+) Ensembl Rnor_6.0 Ensembl 8 23,014,956 - 23,026,503 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000095656 ⟹ ENSRNOP00000081881
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 20,534,880 - 20,546,492 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000103948 ⟹ ENSRNOP00000086800
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 20,534,890 - 20,546,487 (+) Ensembl
RefSeq Acc Id:
NM_001106806 ⟹ NP_001100276
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,810,953 - 28,822,503 (+) NCBI mRatBN7.2 8 20,534,941 - 20,546,491 (+) NCBI Rnor_6.0 8 23,014,956 - 23,026,505 (+) NCBI Rnor_5.0 8 23,069,586 - 23,081,291 (+) NCBI RGSC_v3.4 8 21,107,041 - 21,144,270 (+) RGD Celera 8 21,925,450 - 21,937,160 (+) RGD
Sequence:
ATTGACCTTTGCTTCTGCCTCGTTGAAAGGACATCGCGTATCTTCCTGCCGCAGAACACACTTCCGGTCTCGGCCCGGACGGGATGTTGCTGCTGCTGCTGCTGCTACCCCTCTGTTGGGCAGTAGAA
hide sequence
RefSeq Acc Id:
XM_006242633 ⟹ XP_006242695
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,810,897 - 28,822,503 (+) NCBI mRatBN7.2 8 20,534,881 - 20,546,493 (+) NCBI Rnor_6.0 8 23,014,907 - 23,026,507 (+) NCBI Rnor_5.0 8 23,069,586 - 23,081,291 (+) NCBI
Sequence:
CTTTCTGCTGCAGGAACCGTGGCTGCTGAGCTAACCTGGTGTGGTGGCTATTGACCTTTGCTTCTGCCTCGTGTAGGTGATGAAGTACAGTGAAAGGACATCGCGTATCTTCCTGCCGCAGAACACAC
hide sequence
RefSeq Acc Id:
XM_006242634 ⟹ XP_006242696
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,810,836 - 28,822,503 (+) NCBI mRatBN7.2 8 20,534,787 - 20,546,493 (+) NCBI Rnor_6.0 8 23,014,802 - 23,026,507 (+) NCBI Rnor_5.0 8 23,069,586 - 23,081,291 (+) NCBI
Sequence:
TCTGGCACTCGCACTCTTGCCACTCCTAACATGGCGTCCTCGAGTTGCCGTTCGCCAAGCGTGGTGAGCAAAACGGAAGTGACGTACCCTAGAGCGTTCCGTTCTCTTTCTGCTGCAGGAACCGTGGC
hide sequence
RefSeq Acc Id:
XM_063265066 ⟹ XP_063121136
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 28,810,861 - 28,822,503 (+) NCBI
RefSeq Acc Id:
NP_001100276 ⟸ NM_001106806
- Peptide Label:
precursor
- UniProtKB:
B1WC34 (UniProtKB/TrEMBL), F7EM53 (UniProtKB/TrEMBL), A0A8I6ADW9 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLLLPLCWAVEVKRPRGVSLSNHHFYDESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKGRKEKESLQQ
hide sequence
RefSeq Acc Id:
XP_006242696 ⟸ XM_006242634
- Peptide Label:
isoform X2
- UniProtKB:
A6JNX3 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLLLPLCWAVEVKRPRGVSLSNHHFYDESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEP
hide sequence
RefSeq Acc Id:
XP_006242695 ⟸ XM_006242633
- Peptide Label:
isoform X1
- UniProtKB:
B1WC34 (UniProtKB/TrEMBL), F7EM53 (UniProtKB/TrEMBL), A0A8I6ADW9 (UniProtKB/TrEMBL)
- Sequence:
MLLLLLLLPLCWAVEVKRPRGVSLSNHHFYDESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKGRKEKESLQQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000018009 ⟸ ENSRNOT00000018009
Ensembl Acc Id:
ENSRNOP00000086800 ⟸ ENSRNOT00000103948
Ensembl Acc Id:
ENSRNOP00000081881 ⟸ ENSRNOT00000095656
RefSeq Acc Id:
XP_063121136 ⟸ XM_063265066
- Peptide Label:
isoform X1
- UniProtKB:
B1WC34 (UniProtKB/TrEMBL), F7EM53 (UniProtKB/TrEMBL), A0A8I6ADW9 (UniProtKB/TrEMBL)
RGD ID: 13695802 Promoter ID: EPDNEW_R6324 Type: multiple initiation site Name: Prkcsh_1 Description: protein kinase C substrate 80K-H SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6325 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 23,014,905 - 23,014,965 EPDNEW
RGD ID: 13695801 Promoter ID: EPDNEW_R6325 Type: multiple initiation site Name: Prkcsh_2 Description: protein kinase C substrate 80K-H SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6324 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 23,015,312 - 23,015,372 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-12-29
Prkcsh
PRKCSH beta subunit of glucosidase II
Prkcsh
protein kinase C substrate 80K-H
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Prkcsh
protein kinase C substrate 80K-H
Prkcsh_predicted
protein kinase C substrate 80K-H (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Prkcsh_predicted
protein kinase C substrate 80K-H (predicted)
Symbol and Name status set to approved
70820 APPROVED
