Symbol:
Iyd
Name:
iodotyrosine deiodinase
RGD ID:
1309288
Description:
Predicted to enable FMN binding activity and iodotyrosine deiodinase activity. Predicted to be involved in thyroid hormone metabolic process and tyrosine metabolic process. Predicted to be located in cytoplasmic vesicle membrane and nucleoplasm. Predicted to be active in plasma membrane. Human ortholog(s) of this gene implicated in thyroid dyshormonogenesis 4. Orthologous to human IYD (iodotyrosine deiodinase); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
iodotyrosine dehalogenase 1; iodotyrosine deiodinase 1; IYD-1; LOC308129; MGC109018; RGD1309288; similar to RIKEN cDNA 0610009A07
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IYD (iodotyrosine deiodinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Iyd (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Iyd (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IYD (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IYD (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Iyd (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IYD (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IYD (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Iyd (iodotyrosine deiodinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
OR2AK2 (olfactory receptor family 2 subfamily AK member 2) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Iyd (iodotyrosine deiodinase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IYD (iodotyrosine deiodinase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sup-18
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG46439
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
iyd
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 42,410,099 - 42,425,414 (+) NCBI GRCr8 mRatBN7.2 1 40,003,999 - 40,019,323 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 40,004,041 - 40,019,319 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 40,523,642 - 40,538,881 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 46,510,840 - 46,526,081 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 40,606,684 - 40,621,964 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 40,086,513 - 40,100,966 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 40,086,470 - 40,101,840 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 41,435,347 - 41,449,800 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 34,244,640 - 34,259,649 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 34,247,584 - 34,262,592 (+) NCBI Celera 1 35,702,067 - 35,717,263 (+) NCBI Celera Cytogenetic Map 1 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Iyd Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of IYD mRNA] CTD PMID:31150632 Iyd Rat (1->4)-beta-D-glucan multiple interactions ISO RGD:1319553 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IYD mRNA CTD PMID:36331819 Iyd Rat 1,2-dinitrobenzene multiple interactions ISO RGD:1345868 6480464 1,2-dinitrobenzene inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 1,4-bis(2-ethylhexyl) sulfosuccinate multiple interactions ISO RGD:1345868 6480464 Dioctyl Sulfosuccinic Acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 1-monolauroylglycerol multiple interactions ISO RGD:1345868 6480464 1-monomyristin inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of IYD mRNA CTD PMID:25380136 Iyd Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of IYD mRNA CTD PMID:32145629 Iyd Rat 17beta-estradiol decreases expression ISO RGD:1319553 6480464 Estradiol results in decreased expression of IYD mRNA CTD PMID:39298647 Iyd Rat 2,2',4,5'-Tetrabromodiphenyl ether decreases activity ISO RGD:1345868 6480464 2,2',4,5'-tetrabromodiphenyl ether analog results in decreased activity of IYD protein CTD PMID:24012475 Iyd Rat 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) multiple interactions ISO RGD:1345868 6480464 2,2'-methylenebis(4-methyl-6-tert-butylphenol) inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1345868 6480464 Tetrachlorodibenzodioxin affects the expression of IYD mRNA CTD PMID:22298810 Iyd Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IYD mRNA CTD PMID:21215274 Iyd Rat 2,4,5-trichlorophenol multiple interactions ISO RGD:1345868 6480464 2,4,5-trichlorophenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 2,4-di-tert-butylphenol multiple interactions ISO RGD:1345868 6480464 2,4-di-tert-butylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 2,6-di-tert-butylphenol multiple interactions ISO RGD:1345868 6480464 2,6-di-tert-butylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 3,3',4',5-tetrachlorosalicylanilide multiple interactions ISO RGD:1345868 6480464 3,3',4',5-tetrachlorosalicylanilide inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 3,3',5,5'-tetrabromobisphenol A multiple interactions ISO RGD:1345868 6480464 tetrabromobisphenol A inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 3-nitrotyrosine multiple interactions ISO RGD:1345868 6480464 3-nitrotyrosine inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 4,4'-sulfonyldiphenol decreases expression ISO RGD:1319553 6480464 bisphenol S results in decreased expression of IYD mRNA CTD PMID:39298647 Iyd Rat 4,5-dichloro-2-n-octyl-3(2H)-isothiazolone multiple interactions ISO RGD:1345868 6480464 Kathon 930 inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1319553 6480464 Fenretinide results in increased expression of IYD mRNA CTD PMID:28973697 Iyd Rat 4-nonylphenol multiple interactions ISO RGD:1345868 6480464 4-nonylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 4-octylphenol multiple interactions ISO RGD:1345868 6480464 4-octylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 4-tert-Octylphenol multiple interactions ISO RGD:1345868 6480464 4-tert-octylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 Propylthiouracil inhibits the reaction [TG protein affects the localization of IYD protein]; Propylthiouracil inhibits the more ... CTD PMID:30814441 Iyd Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of IYD mRNA CTD PMID:30814441 Iyd Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of IYD mRNA CTD PMID:31881176 Iyd Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of IYD mRNA CTD PMID:28959563 Iyd Rat aflatoxin B1 decreases expression ISO RGD:1345868 6480464 Aflatoxin B1 results in decreased expression of IYD mRNA CTD PMID:27153756 Iyd Rat benzalkonium chloride multiple interactions ISO RGD:1345868 6480464 Benzalkonium Compounds inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat benzbromarone decreases activity ISO RGD:1345868 6480464 Benzbromarone results in decreased activity of IYD protein CTD PMID:24012475 Iyd Rat benzo[a]pyrene decreases methylation ISO RGD:1345868 6480464 Benzo(a)pyrene results in decreased methylation of IYD 5' UTR CTD PMID:27901495 Iyd Rat benzo[a]pyrene decreases expression ISO RGD:1345868 6480464 Benzo(a)pyrene results in decreased expression of IYD mRNA CTD PMID:32234424 Iyd Rat benzo[a]pyrene increases methylation ISO RGD:1345868 6480464 Benzo(a)pyrene results in increased methylation of IYD 3' UTR CTD PMID:27901495 Iyd Rat benzo[a]pyrene affects methylation ISO RGD:1345868 6480464 Benzo(a)pyrene affects the methylation of IYD promoter CTD PMID:27901495 Iyd Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IYD mRNA CTD PMID:25181051|PMID:32145629 Iyd Rat bisphenol A decreases expression ISO RGD:1319553 6480464 bisphenol A results in decreased expression of IYD mRNA CTD PMID:33221593 Iyd Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of IYD gene CTD PMID:28505145 Iyd Rat Bisphenol A diglycidyl ether multiple interactions ISO RGD:1345868 6480464 bisphenol A diglycidyl ether inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat bithionol multiple interactions ISO RGD:1345868 6480464 Bithionol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat Brilliant Blue multiple interactions ISO RGD:1345868 6480464 brilliant blue inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat bromophenol blue multiple interactions ISO RGD:1345868 6480464 Bromphenol Blue inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat calcitriol increases expression ISO RGD:1345868 6480464 Calcitriol results in increased expression of IYD mRNA CTD PMID:21592394 Iyd Rat calcitriol multiple interactions ISO RGD:1345868 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IYD mRNA CTD PMID:21592394 Iyd Rat captan increases expression ISO RGD:1319553 6480464 Captan results in increased expression of IYD mRNA CTD PMID:31558096 Iyd Rat cetyltrimethylammonium ion multiple interactions ISO RGD:1345868 6480464 Cetrimonium inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat chlordecone multiple interactions ISO RGD:1345868 6480464 Chlordecone inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat chlorhexidine multiple interactions ISO RGD:1345868 6480464 Chlorhexidine inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat clomiphene multiple interactions ISO RGD:1345868 6480464 Clomiphene inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat cyclosporin A decreases expression ISO RGD:1345868 6480464 Cyclosporine results in decreased expression of IYD mRNA CTD PMID:20106945 Iyd Rat cyclosporin A decreases expression ISO RGD:1319553 6480464 Cyclosporine results in decreased expression of IYD mRNA CTD PMID:19770486 Iyd Rat DDT multiple interactions ISO RGD:1345868 6480464 DDT inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dibutyl phthalate multiple interactions ISO RGD:1345868 6480464 Dibutyl Phthalate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat Dichlorophen multiple interactions ISO RGD:1345868 6480464 Dichlorophen inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dicofol multiple interactions ISO RGD:1345868 6480464 Dicofol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat Didecyldimethylammonium multiple interactions ISO RGD:1345868 6480464 didecyldimethylammonium inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dinocap multiple interactions ISO RGD:1345868 6480464 dinocap inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dioxygen multiple interactions ISO RGD:1319553 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of IYD mRNA CTD PMID:30529165 Iyd Rat Dodecyl gallate multiple interactions ISO RGD:1345868 6480464 lauryl gallate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dodecylbenzenesulfonic acid multiple interactions ISO RGD:1345868 6480464 dodecylbenzenesulfonic acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat dodecyltrimethylammonium ion multiple interactions ISO RGD:1345868 6480464 dodecyltrimethylammonium inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of IYD mRNA CTD PMID:29391264 Iyd Rat eosin YS dye multiple interactions ISO RGD:1345868 6480464 Eosine Yellowish-(YS) inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat erythrosin B decreases activity ISO RGD:1345868 6480464 Erythrosine results in decreased activity of IYD protein CTD PMID:24012475 Iyd Rat Fast green FCF multiple interactions ISO RGD:1345868 6480464 Fast Green FCF inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat fenthion increases expression ISO RGD:1319553 6480464 Fenthion results in increased expression of IYD mRNA CTD PMID:34813904 Iyd Rat flusalan multiple interactions ISO RGD:1345868 6480464 fluorophene inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of IYD mRNA CTD PMID:24136188|PMID:24793618 Iyd Rat folpet increases expression ISO RGD:1319553 6480464 folpet results in increased expression of IYD mRNA CTD PMID:31558096 Iyd Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of IYD mRNA CTD PMID:24136188 Iyd Rat hexadecanoic acid multiple interactions ISO RGD:1345868 6480464 Palmitic Acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat linoleic acid multiple interactions ISO RGD:1345868 6480464 Linoleic Acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat masoprocol multiple interactions ISO RGD:1345868 6480464 Masoprocol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat methidathion increases expression ISO RGD:1319553 6480464 methidathion results in increased expression of IYD mRNA CTD PMID:34813904 Iyd Rat methimazole multiple interactions EXP 6480464 Methimazole inhibits the reaction [TG protein affects the localization of IYD protein]; Methimazole inhibits the more ... CTD PMID:30814441 Iyd Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of IYD mRNA CTD PMID:30814441 Iyd Rat methyl linoleate multiple interactions ISO RGD:1345868 6480464 methyl linoleate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat Methylbenzethonium chloride multiple interactions ISO RGD:1345868 6480464 methylbenzethonium chloride inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat methylene blue multiple interactions ISO RGD:1345868 6480464 Methylene Blue inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat methyltrioctylammonium chloride multiple interactions ISO RGD:1345868 6480464 trioctylmethylammonium inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat monoiodotyrosine increases metabolic processing ISO RGD:1345868 6480464 IYD protein results in increased metabolism of Monoiodotyrosine CTD PMID:33352258 Iyd Rat monoiodotyrosine multiple interactions ISO RGD:1345868 6480464 1,2-dinitrobenzene inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine]; 1-monomyristin inhibits the more ... CTD PMID:33352258 Iyd Rat morin multiple interactions ISO RGD:1345868 6480464 morin inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat NADP zwitterion increases oxidation ISO RGD:1345868 6480464 IYD protein results in increased oxidation of NADP CTD PMID:33352258 Iyd Rat NADP(+) increases oxidation ISO RGD:1345868 6480464 IYD protein results in increased oxidation of NADP CTD PMID:33352258 Iyd Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of IYD mRNA CTD PMID:24136188 Iyd Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of IYD mRNA CTD PMID:24136188 Iyd Rat nitrofurazone multiple interactions ISO RGD:1345868 6480464 Nitrofurazone inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat O-methyleugenol decreases expression ISO RGD:1345868 6480464 methyleugenol results in decreased expression of IYD mRNA CTD PMID:32234424 Iyd Rat octyl gallate multiple interactions ISO RGD:1345868 6480464 octyl gallate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat okadaic acid decreases expression ISO RGD:1345868 6480464 Okadaic Acid results in decreased expression of IYD mRNA CTD PMID:38832940 Iyd Rat oleic acid multiple interactions ISO RGD:1345868 6480464 Oleic Acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat p-tert-Amylphenol multiple interactions ISO RGD:1345868 6480464 4-tert-octylphenol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat paracetamol affects expression ISO RGD:1319553 6480464 Acetaminophen affects the expression of IYD mRNA CTD PMID:17562736 Iyd Rat paracetamol decreases expression ISO RGD:1345868 6480464 Acetaminophen results in decreased expression of IYD mRNA CTD PMID:29067470 Iyd Rat perfluorodecanoic acid multiple interactions ISO RGD:1345868 6480464 perfluorodecanoic acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1345868 6480464 perfluorooctane sulfonic acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1319553 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of IYD mRNA CTD PMID:36331819 Iyd Rat perfluoroundecanoic acid multiple interactions ISO RGD:1345868 6480464 perfluoroundecanoic acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat phthalaldehyde multiple interactions ISO RGD:1345868 6480464 o-Phthalaldehyde inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat rac-1-monolauroylglycerol multiple interactions ISO RGD:1345868 6480464 1-monomyristin inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat resveratrol multiple interactions ISO RGD:1345868 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of IYD mRNA CTD PMID:23557933 Iyd Rat riboflavin multiple interactions ISO RGD:1345868 6480464 Riboflavin inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat rose bengal decreases activity ISO RGD:1345868 6480464 Rose Bengal results in decreased activity of IYD protein CTD PMID:24012475 Iyd Rat rotenone affects expression EXP 6480464 Rotenone affects the expression of IYD mRNA CTD PMID:28374803 Iyd Rat Sirius red 4B multiple interactions ISO RGD:1345868 6480464 Direct Red 81 inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat sodium arsenite decreases expression ISO RGD:1345868 6480464 sodium arsenite results in decreased expression of IYD mRNA CTD PMID:29301061 Iyd Rat sodium dodecyl sulfate multiple interactions ISO RGD:1345868 6480464 Sodium Dodecyl Sulfate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat sodium iodide decreases expression EXP 6480464 Sodium Iodide results in decreased expression of IYD mRNA CTD PMID:30814441 Iyd Rat sodium myristyl sulfate multiple interactions ISO RGD:1345868 6480464 Sodium Tetradecyl Sulfate inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat tamoxifen multiple interactions ISO RGD:1345868 6480464 Tamoxifen inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat testosterone multiple interactions ISO RGD:1345868 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of IYD mRNA CTD PMID:21592394 Iyd Rat testosterone increases expression ISO RGD:1345868 6480464 Testosterone results in increased expression of IYD mRNA CTD PMID:21592394 Iyd Rat Tetrachlorobisphenol A multiple interactions ISO RGD:1345868 6480464 tetrachlorodian inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat tetrachloromethane decreases expression ISO RGD:1319553 6480464 Carbon Tetrachloride results in decreased expression of IYD mRNA CTD PMID:27339419|PMID:31919559 Iyd Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of IYD mRNA] CTD PMID:31150632 Iyd Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of IYD mRNA CTD PMID:31150632 Iyd Rat tetradecanoic acid multiple interactions ISO RGD:1345868 6480464 Myristic Acid inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of IYD mRNA CTD PMID:34492290 Iyd Rat tribromosalicylanilide multiple interactions ISO RGD:1345868 6480464 tribromsalan inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat triclosan multiple interactions ISO RGD:1345868 6480464 Triclosan inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat triclosan decreases activity ISO RGD:1345868 6480464 Triclosan results in decreased activity of IYD protein CTD PMID:24012475 Iyd Rat triflumizole multiple interactions ISO RGD:1345868 6480464 triflumizol inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat troglitazone multiple interactions ISO RGD:1345868 6480464 Troglitazone inhibits the reaction [IYD protein results in increased metabolism of Monoiodotyrosine] CTD PMID:33352258 Iyd Rat valproic acid affects expression ISO RGD:1319553 6480464 Valproic Acid affects the expression of IYD mRNA CTD PMID:17963808 Iyd Rat zoledronic acid decreases expression ISO RGD:1345868 6480464 zoledronic acid results in decreased expression of IYD mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dinitrobenzene (ISO) 1,4-bis(2-ethylhexyl) sulfosuccinate (ISO) 1-monolauroylglycerol (ISO) 1-naphthyl isothiocyanate (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,5'-Tetrabromodiphenyl ether (ISO) 2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,5-trichlorophenol (ISO) 2,4-di-tert-butylphenol (ISO) 2,6-di-tert-butylphenol (ISO) 3,3',4',5-tetrachlorosalicylanilide (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-nitrotyrosine (ISO) 4,4'-sulfonyldiphenol (ISO) 4,5-dichloro-2-n-octyl-3(2H)-isothiazolone (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nonylphenol (ISO) 4-octylphenol (ISO) 4-tert-Octylphenol (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) benzalkonium chloride (ISO) benzbromarone (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bithionol (ISO) Brilliant Blue (ISO) bromophenol blue (ISO) calcitriol (ISO) captan (ISO) cetyltrimethylammonium ion (ISO) chlordecone (ISO) chlorhexidine (ISO) clomiphene (ISO) cyclosporin A (ISO) DDT (ISO) dibutyl phthalate (ISO) Dichlorophen (ISO) dicofol (ISO) Didecyldimethylammonium (ISO) dinocap (ISO) dioxygen (ISO) Dodecyl gallate (ISO) dodecylbenzenesulfonic acid (ISO) dodecyltrimethylammonium ion (ISO) endosulfan (EXP) eosin YS dye (ISO) erythrosin B (ISO) Fast green FCF (ISO) fenthion (ISO) flusalan (ISO) flutamide (EXP) folpet (ISO) glafenine (EXP) hexadecanoic acid (ISO) linoleic acid (ISO) masoprocol (ISO) methidathion (ISO) methimazole (EXP) methyl linoleate (ISO) Methylbenzethonium chloride (ISO) methylene blue (ISO) methyltrioctylammonium chloride (ISO) monoiodotyrosine (ISO) morin (ISO) NADP zwitterion (ISO) NADP(+) (ISO) nefazodone (EXP) nimesulide (EXP) nitrofurazone (ISO) O-methyleugenol (ISO) octyl gallate (ISO) okadaic acid (ISO) oleic acid (ISO) p-tert-Amylphenol (ISO) paracetamol (ISO) perfluorodecanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluoroundecanoic acid (ISO) phthalaldehyde (ISO) rac-1-monolauroylglycerol (ISO) resveratrol (ISO) riboflavin (ISO) rose bengal (ISO) rotenone (EXP) Sirius red 4B (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sodium iodide (EXP) sodium myristyl sulfate (ISO) tamoxifen (ISO) testosterone (ISO) Tetrachlorobisphenol A (ISO) tetrachloromethane (EXP,ISO) tetradecanoic acid (ISO) thioacetamide (EXP) tribromosalicylanilide (ISO) triclosan (ISO) triflumizole (ISO) troglitazone (ISO) valproic acid (ISO) zoledronic acid (ISO)
Iyd Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 42,410,099 - 42,425,414 (+) NCBI GRCr8 mRatBN7.2 1 40,003,999 - 40,019,323 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 40,004,041 - 40,019,319 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 40,523,642 - 40,538,881 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 46,510,840 - 46,526,081 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 40,606,684 - 40,621,964 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 40,086,513 - 40,100,966 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 40,086,470 - 40,101,840 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 41,435,347 - 41,449,800 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 34,244,640 - 34,259,649 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 34,247,584 - 34,262,592 (+) NCBI Celera 1 35,702,067 - 35,717,263 (+) NCBI Celera Cytogenetic Map 1 p11 NCBI
IYD Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 150,369,012 - 150,405,969 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 150,368,892 - 150,405,969 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 150,690,148 - 150,727,105 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 150,731,721 - 150,767,457 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 150,782,141 - 150,817,878 NCBI Celera 6 151,424,947 - 151,460,709 (+) NCBI Celera Cytogenetic Map 6 q25.1 NCBI HuRef 6 148,255,114 - 148,290,675 (+) NCBI HuRef CHM1_1 6 150,954,100 - 150,989,630 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 151,569,713 - 151,606,528 (+) NCBI T2T-CHM13v2.0
Iyd Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 3,490,274 - 3,504,880 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 3,490,240 - 3,504,877 (+) Ensembl GRCm39 Ensembl GRCm38 10 3,540,274 - 3,554,880 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 3,540,240 - 3,554,877 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 6,791,664 - 6,806,262 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 6,791,664 - 6,806,262 (-) NCBI MGSCv36 mm8 Celera 10 3,484,500 - 3,499,071 (+) NCBI Celera Cytogenetic Map 10 A1 NCBI cM Map 10 2.06 NCBI
Iyd Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955439 11,033,302 - 11,060,150 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955439 10,998,797 - 11,060,078 (-) NCBI ChiLan1.0 ChiLan1.0
IYD Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 170,384,566 - 170,422,587 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 168,278,049 - 168,316,060 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 148,178,638 - 148,216,122 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 152,886,367 - 152,922,152 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 152,886,373 - 152,922,152 (+) Ensembl panpan1.1 panPan2
IYD Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 1 40,890,402 - 40,908,437 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 1 40,890,435 - 40,908,439 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 1 41,728,455 - 41,748,252 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 1 41,072,192 - 41,090,715 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 1 41,072,213 - 41,090,215 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 1 40,947,672 - 40,967,446 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 1 40,791,294 - 40,809,809 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 1 41,295,459 - 41,313,980 (+) NCBI UU_Cfam_GSD_1.0
Iyd Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 136,202,719 - 136,221,695 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936489 3,454,757 - 3,472,474 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936489 3,454,757 - 3,472,423 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IYD Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 15,756,550 - 15,779,164 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 15,756,536 - 15,779,380 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 17,891,407 - 17,908,117 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IYD Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 77,794,539 - 77,828,841 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 77,795,079 - 77,822,379 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 50,104,222 - 50,134,595 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Iyd
.
Predicted Target Of
Count of predictions: 44 Count of miRNA genes: 40 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000021895 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1331732 Srn4 Serum renin concentration QTL 4 4.467 renin activity (VT:0005581) plasma renin activity level (CMO:0000116) 1 35239598 78430678 Rat 631688 Hcas2 Hepatocarcinoma susceptibility QTL 2 3 0.0001 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 5925874 115540829 Rat 1357397 Bw41 Body weight QTL 41 4.19 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 1578650 Bmd6 Bone mineral density QTL 6 12.2 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 1 509108 43284926 Rat 1578651 Bmd7 Bone mineral density QTL 7 14.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 1 509108 43284926 Rat 1358359 Sradr1 Stress Responsive Adrenal Weight QTL 1 4.74 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 1 30882023 123479925 Rat 1331792 Rf29 Renal function QTL 29 4.589 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 1 35239598 78430678 Rat 2313062 Bmd73 Bone mineral density QTL 73 3.9 0.0001 tibia mineral mass (VT:1000283) compact volumetric bone mineral density (CMO:0001730) 1 11481312 82174945 Rat 8552900 Pigfal1 Plasma insulin-like growth factor 1 level QTL 1 7.4 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 1554320 Bmd1 Bone mineral density QTL 1 12.2 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 509108 86060548 Rat 1354643 Foco2 Food consumption QTL 2 7.17 0.0001 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 1 33449848 78449848 Rat 2313065 Bss67 Bone structure and strength QTL 67 3.1 0.0001 tibia area (VT:1000281) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 7421626 Bp360 Blood pressure QTL 360 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 4393289 49393289 Rat 1357400 Bw62 Body weight QTL62 4.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 1 22340647 67340647 Rat 1357401 Bw43 Body weight QTL 43 3.75 body mass (VT:0001259) body weight (CMO:0000012) 1 22340647 49361612 Rat 2313069 Bss68 Bone structure and strength QTL 68 2.9 0.0001 tibia size trait (VT:0100001) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 631495 Bp96 Blood pressure QTL 96 4.52 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 22340647 102268831 Rat 631494 Bp95 Blood pressure QTL 95 40 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 16206210 49268520 Rat 2313075 Bss66 Bone structure and strength QTL 66 3.4 0.0001 tibia length (VT:0004357) tibia length (CMO:0000450) 1 11481312 82174945 Rat 5684998 Bss101 Bone structure and strength QTL 101 3.6 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 1 15431621 49361612 Rat 70225 Bp58 Blood pressure QTL 58 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32356093 162846471 Rat 5684999 Bss102 Bone structure and strength QTL 102 5.5 7e-07 tibia strength trait (VT:1000284) tibia stiffness (CMO:0001735) 1 15431621 49361612 Rat 1300167 Hrtrt2 Heart rate QTL 2 4.35 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 11481312 75088344 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 2313077 Bss69 Bone structure and strength QTL 69 3.5 0.0001 tibia strength trait (VT:1000284) bone polar moment of inertia (CMO:0001558) 1 11481312 82174945 Rat 1578756 Iddm22 Insulin dependent diabetes mellitus QTL 22 2.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 11835181 56835181 Rat 631508 Sald1 Serum aldosterone level QTL 1 3.7 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 1 9856001 54856001 Rat 1331785 Rf27 Renal function QTL 27 4.643 urine sodium amount (VT:0006274) urine sodium level (CMO:0000129) 1 28879780 78430678 Rat 1300172 Bp172 Blood pressure QTL 172 3.56 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 32737273 90665040 Rat 724520 Bp145 Blood pressure QTL 145 2.1 0.0024 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 20784828 65784828 Rat 1558642 Prcr2 Prostate cancer resistance QTL 2 4.3 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 1 20763158 44095856 Rat 2313092 Bmd72 Bone mineral density QTL 72 2.5 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 1 11481312 82174945 Rat 2313097 Bss70 Bone structure and strength QTL 70 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 1 11481312 82174945 Rat 9589820 Insglur3 Insulin/glucose ratio QTL 3 10.75 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 1 34836858 79836858 Rat 738020 Pia8 Pristane induced arthritis QTL 8 4.7 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 1 1 65833076 Rat 1600360 Mcs16 Mammary carcinoma susceptibility QTL 16 2.4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 2244390 43433040 Rat 1354599 Bw29 Body weight QTL 29 3.46 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 33449848 78449848 Rat 1578669 Bss9 Bone structure and strength QTL 9 6.3 femur morphology trait (VT:0000559) bone trabecular cross-sectional area (CMO:0002311) 1 509108 43284926 Rat 2302038 Pia31 Pristane induced arthritis QTL 31 5.5 0.001 blood autoantibody amount (VT:0003725) serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111) 1 10992065 55992065 Rat 8552948 Pigfal11 Plasma insulin-like growth factor 1 level QTL 11 4.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 1 34836858 79836858 Rat 634353 Rends2 Renal damage susceptibility QTL 2 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 1 19333571 56983283 Rat
RH132943
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 40,018,919 - 40,019,124 (+) MAPPER mRatBN7.2 Rnor_6.0 1 40,100,563 - 40,100,767 NCBI Rnor6.0 Rnor_5.0 1 41,449,397 - 41,449,601 UniSTS Rnor5.0 RGSC_v3.4 1 34,259,246 - 34,259,450 UniSTS RGSC3.4 Celera 1 35,716,860 - 35,717,064 UniSTS Cytogenetic Map 1 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
4
32
84
82
86
59
9
59
5
162
51
71
40
31
27
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021895 ⟹ ENSRNOP00000021893
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 40,004,041 - 40,019,319 (+) Ensembl Rnor_6.0 Ensembl 1 40,086,470 - 40,101,840 (+) Ensembl
RefSeq Acc Id:
NM_001025000 ⟹ NP_001020171
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 42,410,138 - 42,425,414 (+) NCBI mRatBN7.2 1 40,004,041 - 40,019,323 (+) NCBI Rnor_6.0 1 40,086,513 - 40,100,966 (+) NCBI Rnor_5.0 1 41,435,347 - 41,449,800 (+) NCBI RGSC_v3.4 1 34,244,640 - 34,259,649 (+) RGD Celera 1 35,702,067 - 35,717,263 (+) RGD
Sequence:
CTTCAGACCATGTTTCTCCTCACTCCAGTCTTGGTAGCAGTTGTCTGTATCTTGGTCATATGGGTCTTTAAAAATGCTGACAGGAGTCTGGAGGAAAAGAAGGAGGAGGCTCGAGCTCAGCCCTGGGT
hide sequence
RefSeq Acc Id:
XM_039110644 ⟹ XP_038966572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 42,410,099 - 42,425,414 (+) NCBI mRatBN7.2 1 40,003,999 - 40,018,788 (+) NCBI
RefSeq Acc Id:
NP_001020171 ⟸ NM_001025000
- UniProtKB:
Q5BK17 (UniProtKB/Swiss-Prot), A6KIK2 (UniProtKB/TrEMBL)
- Sequence:
MFLLTPVLVAVVCILVIWVFKNADRSLEEKKEEARAQPWVDEDLKDNTEHLQVEEDTEEWQESEESVEHILFSHTRYPEQEMRMRSQEFYELLSKRRSIRFISSEPVPMEVIDNVIKAAGTAPSGAHT
hide sequence
Ensembl Acc Id:
ENSRNOP00000021893 ⟸ ENSRNOT00000021895
RefSeq Acc Id:
XP_038966572 ⟸ XM_039110644
- Peptide Label:
isoform X1
RGD ID: 13689582 Promoter ID: EPDNEW_R107 Type: multiple initiation site Name: Iyd_1 Description: iodotyrosine deiodinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 40,086,503 - 40,086,563 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-02-26
Iyd
iodotyrosine deiodinase
RGD1309288
similar to RIKEN cDNA 0610009A07
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-12-06
RGD1309288
similar to RIKEN cDNA 0610009A07
RGD1309288_predicted
similar to RIKEN cDNA 0610009A07 (predicted)
Symbol and Name updated
1559027 APPROVED
2005-01-20
RGD1309288_predicted
similar to RIKEN cDNA 0610009A07 (predicted)
LOC308129_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC308129_predicted
similar to RIKEN cDNA 0610009A07 (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
