Iyd (iodotyrosine deiodinase) - Rat Genome Database

Name: Iyd
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Iyd (iodotyrosine deiodinase) Rattus norvegicus

Analyze

Symbol:

Iyd

Name:

iodotyrosine deiodinase

RGD ID:

1309288

Description:

Predicted to enable FMN binding activity and iodotyrosine deiodinase activity. Predicted to be involved in thyroid hormone metabolic process and tyrosine metabolic process. Predicted to be located in cytoplasmic vesicle membrane; nucleoplasm; and plasma membrane. Human ortholog(s) of this gene implicated in thyroid dyshormonogenesis 4. Orthologous to human IYD (iodotyrosine deiodinase); INTERACTS WITH (+)-schisandrin B; 1-naphthyl isothiocyanate; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

iodotyrosine dehalogenase 1; iodotyrosine deiodinase 1; IYD-1; LOC308129; MGC109018; RGD1309288; similar to RIKEN cDNA 0610009A07

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IYD (iodotyrosine deiodinase)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Iyd (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Iyd (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IYD (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IYD (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Iyd (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IYD (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	IYD (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Iyd (iodotyrosine deiodinase)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	OR2AK2 (olfactory receptor family 2 subfamily AK member 2)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Iyd (iodotyrosine deiodinase)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	IYD (iodotyrosine deiodinase)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sup-18	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG46439	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	iyd	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	40,003,999 - 40,019,323 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	40,004,041 - 40,019,319 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	40,523,642 - 40,538,881 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	46,510,840 - 46,526,081 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	40,606,684 - 40,621,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	40,086,513 - 40,100,966 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	40,086,470 - 40,101,840 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	41,435,347 - 41,449,800 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	34,244,640 - 34,259,649 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	34,247,584 - 34,262,592 (+)	NCBI
Celera	1	35,702,067 - 35,717,263 (+)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital hypothyroidism (ISO)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

thyroid dyshormonogenesis 4 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dinitrobenzene (ISO)

1,4-bis(2-ethylhexyl) sulfosuccinate (ISO)

1-monolauroylglycerol (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP)

2,2',4,5'-Tetrabromodiphenyl ether (ISO)

2,2'-Methylenebis(4-methyl-6-tert-butylphenol) (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,5-trichlorophenol (ISO)

2,4-di-tert-butylphenol (ISO)

2,6-di-tert-butylphenol (ISO)

3,3',4',5-tetrachlorosalicylanilide (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-nitrotyrosine (ISO)

4,5-dichloro-2-n-octyl-3(2H)-isothiazolone (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nonylphenol (ISO)

4-octylphenol (ISO)

4-tert-Octylphenol (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

benzalkonium chloride (ISO)

benzbromarone (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bithionol (ISO)

Brilliant Blue (ISO)

bromophenol blue (ISO)

calcitriol (ISO)

captan (ISO)

cetyltrimethylammonium ion (ISO)

chlordecone (ISO)

chlorhexidine (ISO)

clomiphene (ISO)

cyclosporin A (ISO)

DDT (ISO)

dibutyl phthalate (ISO)

Dichlorophen (ISO)

dicofol (ISO)

Didecyldimethylammonium (ISO)

dinocap (ISO)

dioxygen (ISO)

Dodecyl gallate (ISO)

dodecylbenzenesulfonic acid (ISO)

dodecyltrimethylammonium ion (ISO)

endosulfan (EXP)

eosin YS dye (ISO)

erythrosin B (ISO)

Fast green FCF (ISO)

fenthion (ISO)

flusalan (ISO)

flutamide (EXP)

folpet (ISO)

glafenine (EXP)

hexadecanoic acid (ISO)

linoleic acid (ISO)

masoprocol (ISO)

methidathion (ISO)

methimazole (EXP)

methyl linoleate (ISO)

Methylbenzethonium chloride (ISO)

methylene blue (ISO)

methyltrioctylammonium chloride (ISO)

monoiodotyrosine (ISO)

morin (ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

nefazodone (EXP)

nimesulide (EXP)

nitrofurazone (ISO)

O-methyleugenol (ISO)

octyl gallate (ISO)

oleic acid (ISO)

p-tert-Amylphenol (ISO)

paracetamol (ISO)

perfluorodecanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluoroundecanoic acid (ISO)

phthalaldehyde (ISO)

rac-1-monolauroylglycerol (ISO)

resveratrol (ISO)

riboflavin (ISO)

rose bengal (ISO)

rotenone (EXP)

Sirius red 4B (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

sodium iodide (EXP)

sodium myristyl sulfate (ISO)

tamoxifen (ISO)

testosterone (ISO)

Tetrachlorobisphenol A (ISO)

tetrachloromethane (EXP,ISO)

tetradecanoic acid (ISO)

thioacetamide (EXP)

tribromosalicylanilide (ISO)

triclosan (ISO)

triflumizole (ISO)

troglitazone (ISO)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

thyroid hormone metabolic process (IBA,ISO,ISS)

tyrosine metabolic process (IBA,ISO,ISS)

Cellular Component

cytoplasmic vesicle membrane (ISO,ISS)

nucleoplasm (ISO)

plasma membrane (ISO,ISS)

Molecular Function

FMN binding (ISO,ISS)

iodotyrosine deiodinase activity (ISO,ISS)

oxidoreductase activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:15289438	PMID:15489334	PMID:16316988	PMID:25395621	PMID:25850545

Genomics

Comparative Map Data

Iyd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	40,003,999 - 40,019,323 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	40,004,041 - 40,019,319 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	40,523,642 - 40,538,881 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	46,510,840 - 46,526,081 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	40,606,684 - 40,621,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	40,086,513 - 40,100,966 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	40,086,470 - 40,101,840 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	41,435,347 - 41,449,800 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	34,244,640 - 34,259,649 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	34,247,584 - 34,262,592 (+)	NCBI
Celera	1	35,702,067 - 35,717,263 (+)	NCBI		Celera
Cytogenetic Map	1	p11	NCBI

IYD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	150,369,012 - 150,405,969 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	150,368,892 - 150,405,969 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	150,690,148 - 150,727,105 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	150,731,721 - 150,767,457 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	150,782,141 - 150,817,878	NCBI
Celera	6	151,424,947 - 151,460,709 (+)	NCBI		Celera
Cytogenetic Map	6	q25.1	NCBI
HuRef	6	148,255,114 - 148,290,675 (+)	NCBI		HuRef
CHM1_1	6	150,954,100 - 150,989,630 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	151,569,713 - 151,606,528 (+)	NCBI		T2T-CHM13v2.0

Iyd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	3,490,274 - 3,504,880 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	3,490,240 - 3,504,877 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	3,540,274 - 3,554,880 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	3,540,240 - 3,554,877 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	6,791,664 - 6,806,262 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	6,791,664 - 6,806,262 (-)	NCBI		MGSCv36	mm8
Celera	10	3,484,500 - 3,499,071 (+)	NCBI		Celera
Cytogenetic Map	10	A1	NCBI
cM Map	10	2.06	NCBI

Iyd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	11,033,302 - 11,060,150 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	10,998,797 - 11,060,078 (-)	NCBI	ChiLan1.0	ChiLan1.0

IYD
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	168,278,049 - 168,316,060 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	148,178,638 - 148,216,122 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	152,886,367 - 152,922,152 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	152,886,373 - 152,922,152 (+)	Ensembl	panpan1.1		panPan2

IYD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	40,890,402 - 40,908,437 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	40,890,435 - 40,908,439 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	41,728,455 - 41,748,252 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	41,072,192 - 41,090,715 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	41,072,213 - 41,090,215 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	40,947,672 - 40,967,446 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	40,791,294 - 40,809,809 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	41,295,459 - 41,313,980 (+)	NCBI		UU_Cfam_GSD_1.0

Iyd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	136,202,719 - 136,221,695 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	3,454,757 - 3,472,474 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936489	3,454,757 - 3,472,423 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IYD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	15,756,550 - 15,779,164 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	15,756,536 - 15,779,380 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	17,891,407 - 17,908,117 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

IYD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	77,794,539 - 77,828,841 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	77,795,079 - 77,822,379 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	50,104,222 - 50,134,595 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Iyd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	7,800,408 - 7,824,647 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624785	7,799,975 - 7,824,611 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Iyd
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	40
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000021895
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
5684998	Bss101	Bone structure and strength QTL 101	3.6		tibia strength trait (VT:1000284)	tibia ultimate force (CMO:0001734)	1	15431621	49361612	Rat
5684999	Bss102	Bone structure and strength QTL 102	5.5	0.00000072	tibia strength trait (VT:1000284)	tibia stiffness (CMO:0001735)	1	15431621	49361612	Rat
631494	Bp95	Blood pressure QTL 95	40	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	16206210	49268520	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
1558642	Prcr2	Prostate cancer resistance QTL 2	4.3		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	1	20763158	44095856	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
1357397	Bw41	Body weight QTL 41	4.19	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357401	Bw43	Body weight QTL 43	3.75		body mass (VT:0001259)	body weight (CMO:0000012)	1	22340647	49361612	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat

Markers in Region

RH132943

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	40,018,919 - 40,019,124 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	40,100,563 - 40,100,767	NCBI	Rnor6.0
Rnor_5.0	1	41,449,397 - 41,449,601	UniSTS	Rnor5.0
RGSC_v3.4	1	34,259,246 - 34,259,450	UniSTS	RGSC3.4
Celera	1	35,716,860 - 35,717,064	UniSTS
Cytogenetic Map	1	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			21	21		21				21
Low			17	16		16			3	10	3	1
Below cutoff	2	26	15	4	8	4	4	4	51		15	9	4

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039110644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474052	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000021895 ⟹ ENSRNOP00000021893

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	40,004,041 - 40,019,319 (+)	Ensembl
Rnor_6.0 Ensembl	1	40,086,470 - 40,101,840 (+)	Ensembl

RefSeq Acc Id:

NM_001025000 ⟹ NP_001020171

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	40,004,041 - 40,019,323 (+)	NCBI
Rnor_6.0	1	40,086,513 - 40,100,966 (+)	NCBI
Rnor_5.0	1	41,435,347 - 41,449,800 (+)	NCBI
RGSC_v3.4	1	34,244,640 - 34,259,649 (+)	RGD
Celera	1	35,702,067 - 35,717,263 (+)	RGD

Sequence:

show sequence

CTTCAGACCATGTTTCTCCTCACTCCAGTCTTGGTAGCAGTTGTCTGTATCTTGGTCATATGGG
TCTTTAAAAATGCTGACAGGAGTCTGGAGGAAAAGAAGGAGGAGGCTCGAGCTCAGCCCTGGGT
GGATGAAGACTTGAAAGACAACACGGAACACCTTCAAGTGGAAGAAGATACTGAGGAATGGCAA
GAGTCGGAGGAGAGTGTGGAACACATCCTATTCTCCCACACCCGATACCCAGAGCAGGAAATGA
GGATGAGATCCCAGGAATTCTATGAGCTCCTCAGTAAGAGACGCTCCATCAGATTTATCAGCAG
CGAGCCAGTCCCGATGGAAGTGATTGACAATGTCATCAAAGCAGCAGGAACAGCTCCAAGTGGA
GCCCATACAGAGCCCTGGACGTTTGTGGTGGTAAAGGACCCAGACATGAAGCATAAGATCCGAG
AGATTATCGAGGAGGAGGAAGAAATCAATTACATGAAAAGGATGGGAAAGCGATGGGTCACAGA
TCTGAAGAAACTGAGAACCAACTGGATTAAGGAGTACTTGGACACTGCCCCTGTTCTGATCCTC
ATTTTCAAACAAGTCCATGGTTTTGCGGTAAATGGGAAGAAAAAGGTCCACTACTACAACGAGA
TCAGTGTGTCCATTGCCTGTGGCATTCTGCTGGCTGCACTGCAGAATGCAGGGCTGGTGACGGT
CACTACCACTCCCCTCAACTGTGGTCCTCGTCTGAGGGTGCTCCTGGGCCGCCCCTCACATGAG
AAGCTGCTAGTGCTCCTTCCTGTGGGGTACCCTAGCAGAGGTGCCACAGTGCCTGACCTCAAGC
GGAAAACTCTGGACCAGATCATGGTGACAGTATAGACAGACAGCCCAACGAGATGCTGGGATGC
TGGGATGACACCTGCTTCCTTCTTCTCGGGTCTGCTGGCTCCTCTTGCTCTCTGAGTCAGGTCT
TCTGCAAACCAGTGTACAGGGAAGACCAATTTCCATGTAGCAATGTTTTCACACTTTCTAGAAC
TTTCAGTCAAGTAAGTAGTTTTTGATGGACTGTTCTAGTTATGTATGGGGCAAGGGACCAAAAA
AGCAGGCATACTTTAACTTCTCTAGAAAAGTATAAATGATTTTTTTCATTTACTTATAAAAGTT
ATATAGAGAAGGCACATGAGAATATGTGCTCTAGTTCCAAGAGTTACCTACGCAATAATTTTTC
ATTTAAATATTAACTAATCAAGTGTTCTTTCTGCTCTCTGCTTTCTGGTGTCATTGAGACTGAG
AATGTACTATTGAGACCTATTCTGTCACTGATTCTCATAGGGAGTCTGCCAATCTTGAATGAAT
AACCTTTAAAGTAAATAAAATATGACACTCACAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039110644 ⟹ XP_038966572

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	40,003,999 - 40,018,788 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001020171	(Get FASTA)	NCBI Sequence Viewer
	XP_038966572	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91241	(Get FASTA)	NCBI Sequence Viewer
	EDL92877	(Get FASTA)	NCBI Sequence Viewer
	Q5BK17	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001020171 ⟸ NM_001025000

- UniProtKB:

Q5BK17 (UniProtKB/Swiss-Prot), A6KIK2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MFLLTPVLVAVVCILVIWVFKNADRSLEEKKEEARAQPWVDEDLKDNTEHLQVEEDTEEWQESE
ESVEHILFSHTRYPEQEMRMRSQEFYELLSKRRSIRFISSEPVPMEVIDNVIKAAGTAPSGAHT
EPWTFVVVKDPDMKHKIREIIEEEEEINYMKRMGKRWVTDLKKLRTNWIKEYLDTAPVLILIFK
QVHGFAVNGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPSHEKLL
VLLPVGYPSRGATVPDLKRKTLDQIMVTV

hide sequence

RefSeq Acc Id:

ENSRNOP00000021893 ⟸ ENSRNOT00000021895

RefSeq Acc Id:	XP_038966572 ⟸ XM_039110644
- Peptide Label:	isoform X1

Protein Domains

Nitroreductase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK17-F1-model_v2	AlphaFold	Q5BK17	1-285	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309288	AgrOrtholog
BioCyc Gene	G2FUF-61731	BioCyc
Ensembl Genes	ENSRNOG00000016286	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000021893	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021895	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.109.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7326298	IMAGE-MGC_LOAD
InterPro	Nitroreductase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nitroreductase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:308129	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109018	IMAGE-MGC_LOAD
NCBI Gene	308129	ENTREZGENE
PANTHER	IODOTYROSINE DEIODINASE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NADPH NITROREDUCTASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Nitroreductase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Iyd	PhenoGen
Superfamily-SCOP	FMN-dependent nitroreductase-like	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
UniProt	A6KIK2	ENTREZGENE, UniProtKB/TrEMBL
	IYD1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-26	Iyd	iodotyrosine deiodinase	RGD1309288	similar to RIKEN cDNA 0610009A07	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1309288	similar to RIKEN cDNA 0610009A07	RGD1309288_predicted	similar to RIKEN cDNA 0610009A07 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309288_predicted	similar to RIKEN cDNA 0610009A07 (predicted)	LOC308129_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC308129_predicted	similar to RIKEN cDNA 0610009A07 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM