Advanced Search (OLGA)

Gene: Ubap2l (ubiquitin associated protein 2-like) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ubap2l

Name:

ubiquitin associated protein 2-like

RGD ID:

1308707

Description:

Predicted to be involved in several processes, including binding activity of sperm to zona pellucida; hematopoietic stem cell homeostasis; and positive regulation of stress granule assembly. Predicted to be part of PcG protein complex. Predicted to be active in cytoplasm and nucleus. Orthologous to human UBAP2L (ubiquitin associated protein 2 like); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Atp8b2; Atpase, class I, type 8B, member 2; EP1; LOC361984; similar to ubiquitin-associated protein 2-like isoform 1; ubiquitin-associated protein 2-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UBAP2L (ubiquitin associated protein 2 like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Ubap2l (ubiquitin-associated protein 2-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ubap2l (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UBAP2L (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UBAP2L (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ubap2l (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UBAP2L (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	UBAP2L (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ubap2l (ubiquitin associated protein 2 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	UBAP2L (ubiquitin associated protein 2 like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ubap2l (ubiquitin-associated protein 2-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ubap2l (ubiquitin associated protein 2-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pqn-59	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	lig	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,736,378 - 177,791,746 (-)	NCBI		GRCr8
mRatBN7.2	2	175,438,703 - 175,494,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	175,438,703 - 175,493,998 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	182,585,047 - 182,640,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	180,607,425 - 180,662,830 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	175,208,128 - 175,263,431 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	189,334,341 - 189,400,334 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,334,341 - 189,400,323 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,766,347 - 208,832,798 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,236,653 - 182,274,323 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,188,831 - 182,224,512 (-)	NCBI
Celera	2	169,378,164 - 169,433,055 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	Charcot-Marie-Tooth disease type 2		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Charcot-Marie-Tooth disease type 2	ClinVar	PMID:28492532 and PMID:29845577
Ubap2l	Rat	Developmental Disabilities		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:35977029
Ubap2l	Rat	dyschromatosis symmetrica hereditaria		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Symmetrical dyschromatosis of extremities	ClinVar	PMID:28492532
Ubap2l	Rat	gastrointestinal stromal tumor		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Ubap2l	Rat	immunodeficiency 42		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autosomal recessive mendelian susceptibility to mycobacterial diseases due to complete RORgamma receptor deficiency	ClinVar	PMID:28492532
Ubap2l	Rat	MHC class II deficiency		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: MHC class II deficiency	ClinVar	PMID:28492532
Ubap2l	Rat	NEURODEVELOPMENTAL DISORDER WITH IMPAIRED LANGUAGE, BEHAVIORAL ABNORMALITIES, AND DYSMORPHIC FACIES		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder with impaired language more ...	ClinVar	PMID:25741868 and PMID:35977029
Ubap2l	Rat	Neurodevelopmental Disorders		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868 and PMID:35977029
Ubap2l	Rat	parathyroid carcinoma		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532
Ubap2l	Rat	severe congenital neutropenia 3		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Kostmann syndrome	ClinVar	PMID:17187068 and PMID:28492532
Ubap2l	Rat	severe congenital neutropenia 5		ISO	UBAP2L (Homo sapiens)	8554872	ClinVar Annotator: match by term: Congenital neutropenia-myelofibrosis-nephromegaly syndrome	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	NEURODEVELOPMENTAL DISORDER WITH IMPAIRED LANGUAGE, BEHAVIORAL ABNORMALITIES, AND DYSMORPHIC FACIES		ISO	UBAP2L (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of UBAP2L mRNA	CTD	PMID:22206623
Ubap2l	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ubap2l (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of UBAP2L mRNA	CTD	PMID:22206623
Ubap2l	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UBAP2L mRNA	CTD	PMID:17942748
Ubap2l	Rat	17beta-estradiol	affects expression	ISO	UBAP2L (Homo sapiens)	6480464	Estradiol affects the expression of UBAP2L mRNA	CTD	PMID:22574217
Ubap2l	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of UBAP2L mRNA	CTD	PMID:17942748
Ubap2l	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of UBAP2L mRNA	CTD	PMID:33387578
Ubap2l	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ubap2l (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of UBAP2L mRNA	CTD	PMID:21570461
Ubap2l	Rat	2-bromohexadecanoic acid	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of UBAP2L protein]	CTD	PMID:38195004
Ubap2l	Rat	2-methylcholine	affects expression	ISO	UBAP2L (Homo sapiens)	6480464	beta-methylcholine affects the expression of UBAP2L mRNA	CTD	PMID:21179406
Ubap2l	Rat	3,4-methylenedioxymethamphetamine	increases methylation	ISO	Ubap2l (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of UBAP2L promoter	CTD	PMID:26251327
Ubap2l	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of UBAP2L mRNA	CTD	PMID:26251327
Ubap2l	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of UBAP2L protein	CTD	PMID:34915118
Ubap2l	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of UBAP2L mRNA	CTD	PMID:28628672
Ubap2l	Rat	acrolein	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of UBAP2L mRNA	CTD	PMID:32845096
Ubap2l	Rat	aflatoxin B1	increases expression	ISO	Ubap2l (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of UBAP2L mRNA	CTD	PMID:19770486
Ubap2l	Rat	aflatoxin B1	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of UBAP2L mRNA	CTD	PMID:22100608
Ubap2l	Rat	all-trans-retinoic acid	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Tretinoin results in decreased expression of UBAP2L protein	CTD	PMID:30093655
Ubap2l	Rat	arsenite(3-)	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to UBAP2L protein]	CTD	PMID:32406909
Ubap2l	Rat	arsenous acid	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of UBAP2L protein	CTD	PMID:30093655
Ubap2l	Rat	benzatropine	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Benztropine results in decreased expression of UBAP2L protein	CTD	PMID:34122009
Ubap2l	Rat	benzo[a]pyrene	increases expression	ISO	Ubap2l (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of UBAP2L mRNA	CTD	PMID:19770486
Ubap2l	Rat	benzo[a]pyrene	increases methylation	ISO	UBAP2L (Homo sapiens)	6480464	Benzo(a)pyrene results in increased methylation of UBAP2L promoter	CTD	PMID:27901495
Ubap2l	Rat	benzo[a]pyrene	affects methylation	ISO	UBAP2L (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of UBAP2L exon	CTD	PMID:30157460
Ubap2l	Rat	benzo[e]pyrene	decreases methylation	ISO	UBAP2L (Homo sapiens)	6480464	benzo(e)pyrene results in decreased methylation of UBAP2L exon	CTD	PMID:30157460
Ubap2l	Rat	beta-lapachone	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	beta-lapachone results in increased expression of UBAP2L mRNA	CTD	PMID:38218311
Ubap2l	Rat	beta-lapachone	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	beta-lapachone results in decreased expression of UBAP2L mRNA	CTD	PMID:38218311
Ubap2l	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of UBAP2L mRNA	CTD	PMID:33754040
Ubap2l	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of UBAP2L mRNA and bisphenol A results in decreased expression of UBAP2L protein	CTD	PMID:32145629
Ubap2l	Rat	bisphenol A	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	bisphenol A results in decreased expression of UBAP2L mRNA	CTD	PMID:33221593
Ubap2l	Rat	bisphenol A	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	bisphenol A results in decreased expression of UBAP2L protein	CTD	PMID:37567409
Ubap2l	Rat	bisphenol AF	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	bisphenol AF results in increased expression of UBAP2L protein	CTD	PMID:34186270
Ubap2l	Rat	bisphenol F	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of UBAP2L mRNA	CTD	PMID:28628672
Ubap2l	Rat	Brodifacoum	decreases expression	EXP		6480464	bromfenacoum results in decreased expression of UBAP2L protein	CTD	PMID:28903499
Ubap2l	Rat	butanal	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	butyraldehyde results in decreased expression of UBAP2L mRNA	CTD	PMID:26079696
Ubap2l	Rat	cadmium atom	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of UBAP2L protein] more ...	CTD	PMID:35301059 and PMID:38195004
Ubap2l	Rat	cadmium dichloride	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of UBAP2L mRNA	CTD	PMID:38568856
Ubap2l	Rat	cadmium dichloride	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of UBAP2L protein] more ...	CTD	PMID:35301059 and PMID:38195004
Ubap2l	Rat	caffeine	affects phosphorylation	ISO	UBAP2L (Homo sapiens)	6480464	Caffeine affects the phosphorylation of UBAP2L protein	CTD	PMID:35688186
Ubap2l	Rat	cannabidiol	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Cannabidiol results in decreased expression of UBAP2L protein	CTD	PMID:34122009
Ubap2l	Rat	chlorpyrifos	increases expression	ISO	Ubap2l (Mus musculus)	6480464	Chlorpyrifos results in increased expression of UBAP2L mRNA	CTD	PMID:37019170
Ubap2l	Rat	clofibrate	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of UBAP2L mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of UBAP2L mRNA]	CTD	PMID:17585979
Ubap2l	Rat	cobalt dichloride	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of UBAP2L mRNA	CTD	PMID:19320972 and PMID:19376846
Ubap2l	Rat	coumarin	affects phosphorylation	ISO	UBAP2L (Homo sapiens)	6480464	coumarin affects the phosphorylation of UBAP2L protein	CTD	PMID:35688186
Ubap2l	Rat	crocidolite asbestos	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of UBAP2L mRNA	CTD	PMID:29279043
Ubap2l	Rat	Cuprizon	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Cuprizone results in decreased expression of UBAP2L protein	CTD	PMID:34122009
Ubap2l	Rat	dexamethasone	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of UBAP2L mRNA	CTD	PMID:28628672
Ubap2l	Rat	diarsenic trioxide	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Arsenic Trioxide results in decreased expression of UBAP2L protein	CTD	PMID:30093655
Ubap2l	Rat	Dibutyl phosphate	affects expression	ISO	UBAP2L (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of UBAP2L mRNA	CTD	PMID:37042841
Ubap2l	Rat	dicrotophos	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	dicrotophos results in increased expression of UBAP2L mRNA	CTD	PMID:28302478
Ubap2l	Rat	doxorubicin	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Doxorubicin results in decreased expression of UBAP2L mRNA	CTD	PMID:29803840
Ubap2l	Rat	elemental selenium	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	Selenium results in increased expression of UBAP2L mRNA	CTD	PMID:19244175
Ubap2l	Rat	enzyme inhibitor	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of UBAP2L protein	CTD	PMID:23301498
Ubap2l	Rat	ethanol	affects splicing	ISO	Ubap2l (Mus musculus)	6480464	Ethanol affects the splicing of UBAP2L mRNA	CTD	PMID:30319688
Ubap2l	Rat	ethyl methanesulfonate	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Ethyl Methanesulfonate results in decreased expression of UBAP2L mRNA	CTD	PMID:23649840
Ubap2l	Rat	fenthion	increases expression	ISO	Ubap2l (Mus musculus)	6480464	Fenthion results in increased expression of UBAP2L mRNA	CTD	PMID:34813904
Ubap2l	Rat	fipronil	increases expression	EXP		6480464	fipronil results in increased expression of UBAP2L mRNA	CTD	PMID:34044035
Ubap2l	Rat	folic acid	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of UBAP2L mRNA	CTD	PMID:22206623
Ubap2l	Rat	formaldehyde	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Formaldehyde results in decreased expression of UBAP2L mRNA	CTD	PMID:23649840
Ubap2l	Rat	FR900359	decreases phosphorylation	ISO	UBAP2L (Homo sapiens)	6480464	FR900359 results in decreased phosphorylation of UBAP2L protein	CTD	PMID:37730182
Ubap2l	Rat	genistein	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Genistein results in decreased expression of UBAP2L mRNA	CTD	PMID:16705744
Ubap2l	Rat	genistein	increases expression	ISO	Ubap2l (Mus musculus)	6480464	Genistein results in increased expression of UBAP2L mRNA	CTD	PMID:32186404
Ubap2l	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of UBAP2L mRNA	CTD	PMID:33387578
Ubap2l	Rat	indometacin	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of UBAP2L mRNA	CTD	PMID:28628672
Ubap2l	Rat	ivermectin	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Ivermectin results in decreased expression of UBAP2L protein	CTD	PMID:32959892
Ubap2l	Rat	josamycin	affects response to substance	ISO	UBAP2L (Homo sapiens)	6480464	UBAP2L protein affects the susceptibility to Josamycin	CTD	PMID:31915244
Ubap2l	Rat	methapyrilene	decreases methylation	ISO	UBAP2L (Homo sapiens)	6480464	Methapyrilene results in decreased methylation of UBAP2L exon	CTD	PMID:30157460
Ubap2l	Rat	methyl methanesulfonate	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Methyl Methanesulfonate results in decreased expression of UBAP2L mRNA	CTD	PMID:23649840
Ubap2l	Rat	methylmercury chloride	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	methylmercuric chloride results in increased expression of UBAP2L mRNA	CTD	PMID:28001369
Ubap2l	Rat	ochratoxin A	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	ochratoxin A results in increased expression of UBAP2L mRNA	CTD	PMID:30559759
Ubap2l	Rat	ozone	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with Ozone] results in increased expression of UBAP2L mRNA	CTD	PMID:32845096
Ubap2l	Rat	paracetamol	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of UBAP2L mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of UBAP2L mRNA]	CTD	PMID:17585979
Ubap2l	Rat	quercetin	decreases phosphorylation	ISO	UBAP2L (Homo sapiens)	6480464	Quercetin results in decreased phosphorylation of UBAP2L protein	CTD	PMID:35688186
Ubap2l	Rat	SB 431542	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of UBAP2L protein	CTD	PMID:37664457
Ubap2l	Rat	selenium atom	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	Selenium results in increased expression of UBAP2L mRNA	CTD	PMID:19244175
Ubap2l	Rat	sodium arsenite	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	sodium arsenite results in decreased expression of UBAP2L mRNA	CTD	PMID:38568856
Ubap2l	Rat	sodium arsenite	multiple interactions	ISO	UBAP2L (Homo sapiens)	6480464	sodium arsenite promotes the reaction [UBAP2L protein binds to CAPRIN1 protein]	CTD	PMID:33939924
Ubap2l	Rat	succimer	multiple interactions	ISO	Ubap2l (Mus musculus)	6480464	[Succimer binds to Magnetite Nanoparticles] which results in decreased expression of UBAP2L mRNA	CTD	PMID:21641980
Ubap2l	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of UBAP2L mRNA	CTD	PMID:34492290
Ubap2l	Rat	thiram	decreases expression	ISO	UBAP2L (Homo sapiens)	6480464	Thiram results in decreased expression of UBAP2L mRNA	CTD	PMID:38568856
Ubap2l	Rat	titanium dioxide	increases methylation	ISO	Ubap2l (Mus musculus)	6480464	titanium dioxide results in increased methylation of UBAP2L promoter	CTD	PMID:35295148
Ubap2l	Rat	titanium dioxide	decreases methylation	ISO	Ubap2l (Mus musculus)	6480464	titanium dioxide results in decreased methylation of UBAP2L gene	CTD	PMID:35295148
Ubap2l	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of UBAP2L mRNA	CTD	PMID:33387578
Ubap2l	Rat	trichostatin A	affects expression	ISO	UBAP2L (Homo sapiens)	6480464	trichostatin A affects the expression of UBAP2L mRNA	CTD	PMID:28542535
Ubap2l	Rat	trimellitic anhydride	increases expression	ISO	Ubap2l (Mus musculus)	6480464	trimellitic anhydride results in increased expression of UBAP2L mRNA	CTD	PMID:19042947
Ubap2l	Rat	triptonide	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	triptonide results in decreased expression of UBAP2L mRNA	CTD	PMID:33045310
Ubap2l	Rat	troglitazone	decreases expression	ISO	Ubap2l (Mus musculus)	6480464	troglitazone results in decreased expression of UBAP2L mRNA	CTD	PMID:28973697
Ubap2l	Rat	valproic acid	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	Valproic Acid results in increased expression of UBAP2L mRNA	CTD	PMID:23179753
Ubap2l	Rat	valproic acid	decreases methylation	ISO	UBAP2L (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of UBAP2L gene	CTD	PMID:29154799
Ubap2l	Rat	valproic acid	affects expression	ISO	UBAP2L (Homo sapiens)	6480464	Valproic Acid affects the expression of UBAP2L mRNA	CTD	PMID:25979313
Ubap2l	Rat	vitamin E	increases expression	ISO	UBAP2L (Homo sapiens)	6480464	Vitamin E results in increased expression of UBAP2L mRNA	CTD	PMID:19244175

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	binding of sperm to zona pellucida	involved_in	ISO	UBAP2L (Homo sapiens)	1624291	PMID:19945174	RGD	PMID:19945174
Ubap2l	Rat	binding of sperm to zona pellucida	involved_in	IEA	UniProtKB:Q14157 and ensembl:ENSP00000389445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubap2l	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	ISO	UBAP2L (Homo sapiens)	1624291	UniProtKB:P35226 and PMID:25185265	RGD	PMID:25185265
Ubap2l	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q80X50 and ensembl:ENSMUSP00000066138	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubap2l	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	ISO	Ubap2l (Mus musculus)	1624291	PMID:25185265	RGD	PMID:25185265
Ubap2l	Rat	hematopoietic stem cell homeostasis	involved_in	IBA	MGI:1921633 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ubap2l	Rat	hematopoietic stem cell homeostasis	acts_upstream_of_or_within	IEA	UniProtKB:Q14157 and ensembl:ENSP00000389445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubap2l	Rat	positive regulation of stress granule assembly	involved_in	ISO	UBAP2L (Homo sapiens)	1624291	PMID:32302570	RGD	PMID:32302570
Ubap2l	Rat	positive regulation of stress granule assembly	involved_in	IEA	UniProtKB:Q14157 and ensembl:ENSP00000389445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ubap2l	Rat	stress granule assembly	involved_in	ISO	UBAP2L (Homo sapiens)	1624291	PMID:29395067	RGD	PMID:29395067
Ubap2l	Rat	stress granule assembly	involved_in	IEA	UniProtKB:Q14157 and ensembl:ENSP00000389445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ubap2l	Rat	cytoplasm	is_active_in	IBA	FB:FBgn0020279 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ubap2l	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ubap2l	Rat	nucleus	is_active_in	IBA	PANTHER:PTN001046274 and UniProtKB:Q14157	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ubap2l	Rat	PcG protein complex	part_of	ISO	UBAP2L (Homo sapiens)	1624291	PMID:25185265	RGD	PMID:25185265
Ubap2l	Rat	PcG protein complex	part_of	IEA	UniProtKB:Q14157 and ensembl:ENSP00000389445	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ubap2l	Rat	protein binding	enables	ISO	UBAP2L (Homo sapiens)	1624291	UniProtKB:P0DTD1-PRO_0000449629 more ...	RGD	PMID:19945174 more ...

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

PMID:18838386	PMID:19945174	PMID:22658674	PMID:22681889	PMID:25002582	PMID:25185265	PMID:26240149	PMID:29395067	PMID:30361391	PMID:35352799

Ubap2l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	177,736,378 - 177,791,746 (-)	NCBI		GRCr8
mRatBN7.2	2	175,438,703 - 175,494,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	175,438,703 - 175,493,998 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	182,585,047 - 182,640,443 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	180,607,425 - 180,662,830 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	175,208,128 - 175,263,431 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	189,334,341 - 189,400,334 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,334,341 - 189,400,323 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	208,766,347 - 208,832,798 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,236,653 - 182,274,323 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,188,831 - 182,224,512 (-)	NCBI
Celera	2	169,378,164 - 169,433,055 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

UBAP2L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	154,220,172 - 154,271,510 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	154,220,179 - 154,271,510 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	154,192,648 - 154,243,986 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	152,460,067 - 152,509,953 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	151,010,630 - 151,056,401	NCBI
Celera	1	127,264,371 - 127,315,051 (+)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	125,556,311 - 125,607,005 (+)	NCBI		HuRef
CHM1_1	1	155,588,964 - 155,639,662 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	153,357,369 - 153,408,720 (+)	NCBI		T2T-CHM13v2.0

Ubap2l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	89,906,896 - 89,959,867 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	89,907,447 - 89,959,935 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	89,999,589 - 90,052,609 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	90,000,140 - 90,052,628 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	89,803,511 - 89,856,437 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	90,086,067 - 90,138,392 (-)	NCBI		MGSCv36	mm8
Celera	3	90,036,129 - 90,089,047 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.19	NCBI

Ubap2l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	768,058 - 815,632 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	767,265 - 815,632 (+)	NCBI	ChiLan1.0	ChiLan1.0

UBAP2L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	95,562,493 - 95,613,638 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	95,297,724 - 95,349,197 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	129,575,115 - 129,626,565 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	133,189,194 - 133,240,090 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	133,189,194 - 133,240,090 (+)	Ensembl	panpan1.1		panPan2

UBAP2L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	42,973,598 - 43,015,007 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	42,974,092 - 43,010,848 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	42,463,992 - 42,505,420 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	42,843,514 - 42,885,522 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	7	42,622,858 - 42,664,296 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	42,676,123 - 42,717,542 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	42,960,214 - 43,001,682 (-)	NCBI		UU_Cfam_GSD_1.0

Ubap2l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	24,883,283 - 24,929,500 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	3,914,468 - 3,959,789 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936580	3,913,460 - 3,960,026 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UBAP2L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	95,471,126 - 95,520,425 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	95,471,122 - 95,519,800 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	104,388,405 - 104,436,880 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UBAP2L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	9,546,201 - 9,591,728 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	9,545,581 - 9,591,659 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	8,904,155 - 8,961,258 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ubap2l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	3,043,328 - 3,089,664 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	3,043,328 - 3,089,657 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ubap2l
187 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	131
Count of miRNA genes:	85
Interacting mature miRNAs:	109
Transcripts:	ENSRNOT00000024364
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
61457	Niddm8	Non-insulin dependent diabetes mellitus QTL 8	4.1	0.01	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	2	174543008	175950118	Rat
152025245	Scl81	Serum cholesterol level QTL 81	3.49		blood cholesterol amount (VT:0000180)		2	122609194	206936711	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001024798	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102661	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102666	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102675	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102677	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102685	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039102686	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282129	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282132	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282135	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282136	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282137	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282138	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282140	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282141	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282144	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282145	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282146	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282152	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC097468	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KC333996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000024364 ⟹ ENSRNOP00000024364

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,438,703 - 175,493,982 (-)	Ensembl
Rnor_6.0 Ensembl	2	189,334,341 - 189,400,323 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089042 ⟹ ENSRNOP00000070602

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,439,273 - 175,493,973 (-)	Ensembl
Rnor_6.0 Ensembl	2	189,334,780 - 189,395,746 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101660 ⟹ ENSRNOP00000096813

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,440,592 - 175,493,998 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112048 ⟹ ENSRNOP00000084271

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,445,728 - 175,493,622 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000116567 ⟹ ENSRNOP00000091988

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,439,551 - 175,493,977 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000117564 ⟹ ENSRNOP00000082678

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,439,551 - 175,493,977 (-)	Ensembl

RefSeq Acc Id:

NM_001024798 ⟹ NP_001019969

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,378 - 177,791,646 (-)	NCBI
mRatBN7.2	2	175,438,703 - 175,493,982 (-)	NCBI
Rnor_6.0	2	189,334,341 - 189,400,323 (-)	NCBI
Rnor_5.0	2	208,766,347 - 208,832,798 (-)	NCBI
RGSC_v3.4	2	182,236,653 - 182,274,323 (-)	RGD
Celera	2	169,378,164 - 169,433,055 (-)	RGD

Sequence:

show sequence

CGGGGTGTCAGTGTGGAGGAGACTGAGGTAAAGTTGGCAGCGCAGCGGCGTTGGCGGCGGCGGCGGCGGCAGCGGCAACGCGGCGGGGCCGGTATTCTTCCTTGTAAATACTGTTATTTGTATATACT
GTAAATGATGACGTCGGTGGGCACTAACCGAGCCCGGGGAAACTGGGAACAACCTCAAAACCAAAACCAGACACAGCACAAGCAGCGGCCACAGGCCACTGCAGAGCAAATTCGACTTGCACAGATGA
TTTCGGACCATAATGATGCTGACTTTGAGGAGAAGGTGAAACAATTGATTGATATCACAGGCAAAAACCAGGATGAATGTGTGATTGCTTTGCATGACTGCAATGGAGATGTCAACAGAGCCATCAAT
GTTCTCCTGGAAGGAAATCCAGACACGCATTCCTGGGAGATGGTCGGGAAGAAGAAAGGAGTCTCAGGACAGAAGGATGGTGGACAAACTGAATCTAATGAAGAAGGAAAAGAAAATCGAGACCGGGA
CAGAGACTATAGTCGACGACGTGGTGGGCCACCAAGACGGGGGAGAGGTGCCAGCCGTGGACGAGAGTTTCGGGGCCAGGAAAATGGATTGGATGGCACTAAGAGTGGTGGACCTTCTGGAAGAGGCA
CAGACAGAGGGAGAAGAGGCCGTGGCCGGGGCAGAGGTAGTTCTGGTAGACGAGGAGGAAGGTTTTCTGCTCAAGGAATGGGAACCTTTAACCCTGCTGATTATGCAGAGCCAGCCAACACTGATGAT
AACTATGGCAGTAGCAGTGGCAATACATGGAACAACACTGGCCACTTTGAACCAGATGATGGAACAAGACTTGATTTCATTGGGGTTGAGGGGTCAAATTATCCCCGAAAATTTGAGACTGCTCCTGG
TGCATGGAGGACTGCAACAGAAGAGTGGGGAACTGAAGATTGGAATGAAGATCTTTCTGAGACCAAGATCTTTACTGCCTCTAATGTGTCTTCAGTGCCTCTGCCTGCGGAGAATGTGACAATCACTG
CTGGTCAGAGAATTGATCTTGCTGTTCTGTTGGGGAAGACACCGTCTTCAATGGAGAATGATTCATCTAATCTGGATCCATCTCAGGCTCCTTCCCTGGCCCAGCCTCTGGTATTCAGTAATTCGAAG
CAGAATGCCATATCACAGCCTGCTTCAGGGAATACATTTTCTCATCATAGCATGGTGAGCATGTTGGGGAAAGGATTTGGTGATGTTGGGGAAGCTAAAGGTGGCAGTACAACAGGCTCTCAGTTCTT
GGAGCAATTCAAGACTGCACAGGCCCTGGCTCAACTGGCAGCTCAACATTCTCAGTCTGGAAGCACCACCACCTCCTCTTGGGATATGGGCTCAACAACACAATCACCATCACTGGTGCAGTATGATT
TGAAGAGTGCAAATGATTCAACAGTGCACAGTCCTTTTACAAAGCGCCAGGCATTCACCCCATCATCAACCATGATGGAGGTGTTCCTTCAGGAGAAGCCACCTGCAGTGGCTACCTCGACAGCTGCA
CCTCCTCCCCCCTCTTCTCCTCTGCCAAGCAAATCCACCTCGGCTCCACAGATGTCTCCGGGGTCTTCGGACAACCAATCCTCCAGCCCTCAGCCGGCTCAACAGAAACTGAAACAGCAAAAGAAGAA
AACCTCCTTGACGTCTAAGATTCCTGCTCTGGCTGTGGAGATGCCTGGCTCAGCAGATATCTCAGGGCTAAATCTGCAGTTTGGGGCATTGCAATTTGGGTCAGAGCCTGTCCTTTCTGATTATGAGT
CCACCCCCACCACGAGCGCCTCTTCAAGCCAGGCTCCCAGTAGCCTGTATACCAGCACGGCCAGTGAGTCTTCATCTACAGTTTCATCTAATCAGAGTCAGGAGTCTGGTTATCAGAGTGGCCCAATT
CAGTCGACAACTTATACCTCCCAAAATAATGCTCAGGGCCCTCTATATGAACAGAGATCCACACAGACACGGCGGTATCCCAGCTCCATCTCTTCATCACCCCAAAAGGACCTGACTCAGGCTAAGAA
TGGTTTCAGCTCTGTGCAGGCCACGCAGTTACAGACCACGCAATCTGTTGAAGGTGCTACAGGCTCTGCAGTGAAATCTGAATCACCTTCCACTTCTAGTATACCCTCTCTCAATGAAACAGTACCTG
CAGCTTCCTTACTGACGACAGCCAGTCAGCATTCATCCTCCTTAAGTGGCTTGAGCCATAGTGAGGAGATTCCAAATACCACCACCACACAACATAGCAGTGCATTATCTACACAGCAGAATACCCTT
TCTTCATCAACATCTTCTGGGCGTACTTCAACATCTACTCTTTTGCATACAAGTGTGGAGAGTGAAGCGAATCTGCATTCTTCCTCCAGCACTTTCTCTACCACGTCCAGCACTGTCTCTGCACCTCC
CCCAGTGGTCAGTGTCTCCTCCAGTCTGAATAGTGGCAGTAGCCTGGGCCTTAGCCTGGGCAGCAACTCTACTGTCACAGCCTCAACTCGAAGCTCAGTTGCTACAACTTCAGGAAAAGCTCCTCCCA
ACCTTCCTCCTGGAGTCCCGCCATTGTTGCCTAATCCATATATTATGGCTCCAGGGCTGTTACATGCCTACCCGCCACAAGTATATGGTTATGATGATTTACAGATGCTCCAGACAAGATTTCCATTG
GATTACTACAGTATCCCGTTTCCCACACCCACCACTCCACTTACTGGGAGGGATGGTAGCCTGGCCAGCAACCCTTACTCTGGCGACCTCACCAAGTTCGGCCGCGGGGATGCCTCCTCCCCAGCCCC
AGCCACAACCTTGGCCCAACCCCAACAGAACCAGACGCAGACTCACCACACCACGCAGCAGACATTCCTGAACCCGGCGCTGCCTCCTGGCTATAGTTACACCAGCCTGCCATACTACACAGGGGTCC
CGGGCCTCCCCAGCACCTTCCAGTATGGGCCTGCTGTGTTCCCTGTGGCTCCTACCTCTTCCAAGCAGCATGGTGTGAATGTCAGTGTGAATGCCTCGGCCACCCCTTTCCAACAACCAAGTGGATAT
GGGTCTCATGGATACAACACTGGTGTGTCAGTCACCTCCAGTAACACGGGCGTGCCAGATATCTCGGGTTCTGTGTACTCCAAAACCCAGCAGTCCTTTGAGAAACAAGGTTTTCATTCCGGTACTCC
TGCTGCCTCCTTCAACTTGCCTTCAGCCCTAGGAAGTGGAGGGCCCATCAATCCAGCCACAGCTGCTGCCTACCCACCTGCCCCCTTTATGCACATTCTGACCCCACATCAGCAGCCACACTCTCAGA
TCCTTCACCATCACCTGCAGCAGGATGGCCAGCTACCATATTTGCAGATGATTCTCTGTTGCCAGCGCCAGCAGGAGGAGCAGGATATCCTCACTCTCGTCGATGACCAGCTTGGTGAATAAGTATTA
CCGTACCAACTGGGCCTCTTCTAGCAGGCTCGAAGGCTGTGGAATAAAGTGAAATCTTTGCCCTTTAAGAACTCTCACCTTAATGTGCTAATATTTTGCCCTTAAGGGGATTCCCTTTTACATCCTGT
GACTGAAAAGAACCACTGCACATCTTCATTTCTTCTAGAAACTGCCTCACCTACAGCAAGTTTCAGGAAGTGAAAGGGGAAGGAGCTAAGGACATTTAAAAGGAAAAGGACCTTGTGGGAATCTAAGC
ATGATTTAAAGGATTCTGAAATCTGAAGCCAGCATTATCTACTGTCTGGCAGAACCAAATTGTAGGGCTTTTTTCTTTTTGGAGGAGTATAGTAGTTCTTGTCTGAGTTATGTTTTTGAGACAATCTC
ACTATGTAACCCTGACTGGCTAGAAGTTGTAACCCAACTGGCTGGAAGTTGGTGTGGAGACCAGGCTGGTCTCAAATTCAGAGATCTACCTGCCTCTACCTCTTGAGTGCCAAGGTTAAAGGTTCTCA
GCACTATACCTTACCTTGCCTTTTTTATGTGACTTTGAAATGCCTAAGTTTTGGGAAAGGAGTGGATGATGGTAGAGCAAGACCTGGGGTGGGGACATGGTGCAGTAAAAGGTTTTGGAC

hide sequence

RefSeq Acc Id:

XM_039102661 ⟹ XP_038958589

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102663 ⟹ XP_038958591

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102664 ⟹ XP_038958592

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102666 ⟹ XP_038958594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102667 ⟹ XP_038958595

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,198 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102674 ⟹ XP_038958602

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102675 ⟹ XP_038958603

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,489,404 (-)	NCBI

RefSeq Acc Id:

XM_039102677 ⟹ XP_038958605

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,413 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102681 ⟹ XP_038958609

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,198 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102683 ⟹ XP_038958611

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,198 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102685 ⟹ XP_038958613

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,787,071 (-)	NCBI
mRatBN7.2	2	175,439,198 - 175,494,024 (-)	NCBI

RefSeq Acc Id:

XM_039102686 ⟹ XP_038958614

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,746 (-)	NCBI
mRatBN7.2	2	175,459,713 - 175,494,085 (-)	NCBI

RefSeq Acc Id:

XM_063282127 ⟹ XP_063138197

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI

RefSeq Acc Id:

XM_063282128 ⟹ XP_063138198

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI

RefSeq Acc Id:

XM_063282129 ⟹ XP_063138199

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,790,565 (-)	NCBI

RefSeq Acc Id:

XM_063282130 ⟹ XP_063138200

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282131 ⟹ XP_063138201

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282132 ⟹ XP_063138202

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282133 ⟹ XP_063138203

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282134 ⟹ XP_063138204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,485 (-)	NCBI

RefSeq Acc Id:

XM_063282135 ⟹ XP_063138205

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI

RefSeq Acc Id:

XM_063282136 ⟹ XP_063138206

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282137 ⟹ XP_063138207

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282138 ⟹ XP_063138208

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282139 ⟹ XP_063138209

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,787,071 (-)	NCBI

RefSeq Acc Id:

XM_063282140 ⟹ XP_063138210

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,737 (-)	NCBI

RefSeq Acc Id:

XM_063282141 ⟹ XP_063138211

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,787,071 (-)	NCBI

RefSeq Acc Id:

XM_063282142 ⟹ XP_063138212

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282144 ⟹ XP_063138214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,485 (-)	NCBI

RefSeq Acc Id:

XM_063282145 ⟹ XP_063138215

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282146 ⟹ XP_063138216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282147 ⟹ XP_063138217

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,746 (-)	NCBI

RefSeq Acc Id:

XM_063282148 ⟹ XP_063138218

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282149 ⟹ XP_063138219

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282150 ⟹ XP_063138220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282151 ⟹ XP_063138221

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,740 (-)	NCBI

RefSeq Acc Id:

XM_063282152 ⟹ XP_063138222

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,737,333 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282155 ⟹ XP_063138225

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282156 ⟹ XP_063138226

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282157 ⟹ XP_063138227

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,736,942 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282158 ⟹ XP_063138228

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282159 ⟹ XP_063138229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,737 (-)	NCBI

RefSeq Acc Id:

XM_063282160 ⟹ XP_063138230

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282161 ⟹ XP_063138231

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,647 (-)	NCBI

RefSeq Acc Id:

XM_063282162 ⟹ XP_063138232

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282163 ⟹ XP_063138233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282164 ⟹ XP_063138234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,493 (-)	NCBI

RefSeq Acc Id:

XM_063282165 ⟹ XP_063138235

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,743,399 - 177,791,682 (-)	NCBI

RefSeq Acc Id:

XM_063282166 ⟹ XP_063138236

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	177,757,849 - 177,790,565 (-)	NCBI


Protein RefSeqs	NP_001019969	(Get FASTA)	NCBI Sequence Viewer
	XP_038958589	(Get FASTA)	NCBI Sequence Viewer
	XP_038958591	(Get FASTA)	NCBI Sequence Viewer
	XP_038958592	(Get FASTA)	NCBI Sequence Viewer
	XP_038958594	(Get FASTA)	NCBI Sequence Viewer
	XP_038958595	(Get FASTA)	NCBI Sequence Viewer
	XP_038958602	(Get FASTA)	NCBI Sequence Viewer
	XP_038958603	(Get FASTA)	NCBI Sequence Viewer
	XP_038958605	(Get FASTA)	NCBI Sequence Viewer
	XP_038958609	(Get FASTA)	NCBI Sequence Viewer
	XP_038958611	(Get FASTA)	NCBI Sequence Viewer
	XP_038958613	(Get FASTA)	NCBI Sequence Viewer
	XP_038958614	(Get FASTA)	NCBI Sequence Viewer
	XP_063138197	(Get FASTA)	NCBI Sequence Viewer
	XP_063138198	(Get FASTA)	NCBI Sequence Viewer
	XP_063138199	(Get FASTA)	NCBI Sequence Viewer
	XP_063138200	(Get FASTA)	NCBI Sequence Viewer
	XP_063138201	(Get FASTA)	NCBI Sequence Viewer
	XP_063138202	(Get FASTA)	NCBI Sequence Viewer
	XP_063138203	(Get FASTA)	NCBI Sequence Viewer
	XP_063138204	(Get FASTA)	NCBI Sequence Viewer
	XP_063138205	(Get FASTA)	NCBI Sequence Viewer
	XP_063138206	(Get FASTA)	NCBI Sequence Viewer
	XP_063138207	(Get FASTA)	NCBI Sequence Viewer
	XP_063138208	(Get FASTA)	NCBI Sequence Viewer
	XP_063138209	(Get FASTA)	NCBI Sequence Viewer
	XP_063138210	(Get FASTA)	NCBI Sequence Viewer
	XP_063138211	(Get FASTA)	NCBI Sequence Viewer
	XP_063138212	(Get FASTA)	NCBI Sequence Viewer
	XP_063138214	(Get FASTA)	NCBI Sequence Viewer
	XP_063138215	(Get FASTA)	NCBI Sequence Viewer
	XP_063138216	(Get FASTA)	NCBI Sequence Viewer
	XP_063138217	(Get FASTA)	NCBI Sequence Viewer
	XP_063138218	(Get FASTA)	NCBI Sequence Viewer
	XP_063138219	(Get FASTA)	NCBI Sequence Viewer
	XP_063138220	(Get FASTA)	NCBI Sequence Viewer
	XP_063138221	(Get FASTA)	NCBI Sequence Viewer
	XP_063138222	(Get FASTA)	NCBI Sequence Viewer
	XP_063138225	(Get FASTA)	NCBI Sequence Viewer
	XP_063138226	(Get FASTA)	NCBI Sequence Viewer
	XP_063138227	(Get FASTA)	NCBI Sequence Viewer
	XP_063138228	(Get FASTA)	NCBI Sequence Viewer
	XP_063138229	(Get FASTA)	NCBI Sequence Viewer
	XP_063138230	(Get FASTA)	NCBI Sequence Viewer
	XP_063138231	(Get FASTA)	NCBI Sequence Viewer
	XP_063138232	(Get FASTA)	NCBI Sequence Viewer
	XP_063138233	(Get FASTA)	NCBI Sequence Viewer
	XP_063138234	(Get FASTA)	NCBI Sequence Viewer
	XP_063138235	(Get FASTA)	NCBI Sequence Viewer
	XP_063138236	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97468	(Get FASTA)	NCBI Sequence Viewer
	EDM00600	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000024364.6
	ENSRNOP00000070602.1
	ENSRNOP00000082678
	ENSRNOP00000082678.1
	ENSRNOP00000084271
	ENSRNOP00000084271.1
	ENSRNOP00000091988
	ENSRNOP00000091988.1
	ENSRNOP00000096813
	ENSRNOP00000096813.1

RefSeq Acc Id:

NP_001019969 ⟸ NM_001024798

- UniProtKB:

E9PTR4 (UniProtKB/TrEMBL), A6J6I9 (UniProtKB/TrEMBL), A0A8I6ARP3 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKDGGQTESNEEGKENRDRDR
DYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSGGPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGSSSGNTWNNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGA
WRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGNTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLE
QFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKT
SLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNG
FSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAASLLTTASQHSSSLSGLSHSEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPP
VVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPA
TTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPA
ASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQDILTLVDDQLGE

hide sequence

Ensembl Acc Id:

ENSRNOP00000070602 ⟸ ENSRNOT00000089042

Ensembl Acc Id:

ENSRNOP00000024364 ⟸ ENSRNOT00000024364

RefSeq Acc Id:	XP_038958613 ⟸ XM_039102685
- Peptide Label:	isoform X34
- UniProtKB:	A0A8I6ARP3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038958609 ⟸ XM_039102681
- Peptide Label:	isoform X30
- UniProtKB:	A0A8I6ARP3 (UniProtKB/TrEMBL)

Protein Domains

UBA

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-E9PTR4-F1-model_v2	AlphaFold	E9PTR4	1-1105	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691487

Promoter ID:

EPDNEW_R2012

Type:

initiation region

Name:

Ubap2l_1

Description:

ubiquitin associated protein 2-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	189,400,314 - 189,400,374	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-52375	BioCyc
Ensembl Genes	ENSRNOG00000017990	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000024364.8	UniProtKB/TrEMBL
	ENSRNOT00000089042.2	UniProtKB/TrEMBL
	ENSRNOT00000101660	ENTREZGENE
	ENSRNOT00000101660.1	UniProtKB/TrEMBL
	ENSRNOT00000112048	ENTREZGENE
	ENSRNOT00000112048.1	UniProtKB/TrEMBL
	ENSRNOT00000116567	ENTREZGENE
	ENSRNOT00000116567.1	UniProtKB/TrEMBL
	ENSRNOT00000117564	ENTREZGENE
	ENSRNOT00000117564.1	UniProtKB/TrEMBL
Gene3D-CATH	DNA helicase RuvA subunit, C-terminal domain	UniProtKB/TrEMBL
InterPro	DUF3697_Uba2	UniProtKB/TrEMBL
	TC-DDR_regulator	UniProtKB/TrEMBL
	UBA-like	UniProtKB/TrEMBL
	UBA/transl_elong_EF1B_N_euk	UniProtKB/TrEMBL
KEGG Report	rno:361984	UniProtKB/TrEMBL
NCBI Gene	361984	ENTREZGENE
PANTHER	UBIQUITIN ASSOCIATED PROTEIN 2-LIKE/LINGERER	UniProtKB/TrEMBL
	UBIQUITIN-ASSOCIATED PROTEIN 2-LIKE	UniProtKB/TrEMBL
Pfam	DUF3697	UniProtKB/TrEMBL
PhenoGen	Ubap2l	PhenoGen
PROSITE	UBA	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017990	RatGTEx
SMART	UBA	UniProtKB/TrEMBL
Superfamily-SCOP	UBA_like	UniProtKB/TrEMBL
UniProt	A0A0G2JYC6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZUK2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZWV5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ACU2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ARP3	ENTREZGENE, UniProtKB/TrEMBL
	A6J6I8	ENTREZGENE, UniProtKB/TrEMBL
	A6J6I9	ENTREZGENE, UniProtKB/TrEMBL
	E9PTR4	ENTREZGENE, UniProtKB/TrEMBL
	Q4V8A7	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-09-17	Ubap2l	ubiquitin associated protein 2-like	LOC361984	similar to ubiquitin-associated protein 2-like isoform 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-04-21	LOC361984	similar to ubiquitin-associated protein 2-like isoform 1	Atp8b2	Atpase, class I, type 8B, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Atp8b2	Atpase, class I, type 8B, member 2	Atp8b2_predicted	Atpase, class I, type 8B, member 2 (predicted)	Symbol and Name updated	1559027	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM