Advanced Search (OLGA)

Gene: Dennd10 (DENN domain containing 10) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Dennd10

Name:

DENN domain containing 10

RGD ID:

1308326

Description:

Predicted to enable guanyl-nucleotide exchange factor activity and small GTPase binding activity. Predicted to be involved in endosome transport via multivesicular body sorting pathway; protein transport; and regulation of early endosome to late endosome transport. Predicted to be active in late endosome. Orthologous to several human genes including DENND10 (DENN domain containing 10); INTERACTS WITH bisphenol A; clozapine; flutamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DENN domain-containing protein 10; Fam45a; family with sequence similarity 45, member A; hypothetical protein LOC308009; LOC308009; RGD1308326; similar to RIKEN cDNA 1810055E12; uncharacterized protein LOC308009

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DENND10 (DENN domain containing 10)	HGNC	Ensembl, NCBI, OMA, OrthoDB, OrthoMCL, Treefam
Mus musculus (house mouse):	Dennd10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dennd10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DENND10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DENND10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Dennd10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DENND10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DENND10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dennd10 (DENN domain containing 10)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	DENND10P1 (DENND10 pseudogene 1)	HGNC	Panther
Alliance orthologs ³
Mus musculus (house mouse):	Dennd10 (DENN domain containing 10)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DENND10 (DENN domain containing 10)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DENND10P1 (DENND10 pseudogene 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fam45a (family with sequence similarity 45 member A)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	269,937,023 - 269,960,506 (+)	NCBI		GRCr8
mRatBN7.2	1	259,950,955 - 259,974,459 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	259,950,866 - 259,974,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	268,157,895 - 268,181,155 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	274,863,921 - 274,887,181 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	267,518,241 - 267,541,489 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	282,188,080 - 282,211,588 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	282,188,110 - 282,210,580 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	289,526,625 - 289,550,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	267,417,683 - 267,441,183 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	267,628,755 - 267,652,267 (+)	NCBI
Celera	1	255,592,048 - 255,615,542 (+)	NCBI		Celera
Cytogenetic Map	1	q55	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd10	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Dennd10 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of FAM45A mRNA	CTD	PMID:22206623
Dennd10	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Dennd10 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DENND10 mRNA	CTD	PMID:22206623
Dennd10	Rat	17beta-estradiol	increases expression	ISO	Dennd10 (Mus musculus)	6480464	Estradiol results in increased expression of DENND10 mRNA	CTD	PMID:39298647
Dennd10	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DENND10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of DENND10 mRNA	CTD	PMID:28628672
Dennd10	Rat	4,4'-sulfonyldiphenol	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of DENND10 mRNA	CTD	PMID:28628672
Dennd10	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Dennd10 (Mus musculus)	6480464	bisphenol S results in increased expression of DENND10 mRNA	CTD	PMID:39298647
Dennd10	Rat	aflatoxin B1	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased expression of DENND10 mRNA	CTD	PMID:22100608
Dennd10	Rat	antirheumatic drug	increases expression	ISO	DENND10 (Homo sapiens)	6480464	Antirheumatic Agents results in increased expression of DENND10 mRNA	CTD	PMID:24449571
Dennd10	Rat	aristolochic acid A	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of FAM45A mRNA	CTD	PMID:33212167
Dennd10	Rat	benzo[a]pyrene	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased expression of DENND10 mRNA	CTD	PMID:32234424
Dennd10	Rat	bisphenol A	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DENND10 mRNA	CTD	PMID:28628672
Dennd10	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DENND10 mRNA	CTD	PMID:25181051 and PMID:33296240
Dennd10	Rat	bisphenol A	increases expression	ISO	Dennd10 (Mus musculus)	6480464	bisphenol A results in increased expression of DENND10 mRNA	CTD	PMID:21932408
Dennd10	Rat	bisphenol A	increases expression	ISO	DENND10 (Homo sapiens)	6480464	bisphenol A results in increased expression of DENND10 mRNA	CTD	PMID:29275510
Dennd10	Rat	clozapine	increases expression	EXP		6480464	Clozapine results in increased expression of DENND10 mRNA	CTD	PMID:16715494
Dennd10	Rat	copper(II) sulfate	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of DENND10 mRNA	CTD	PMID:19549813
Dennd10	Rat	dexamethasone	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DENND10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of DENND10 mRNA	CTD	PMID:28628672
Dennd10	Rat	dioxygen	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Oxygen deficiency results in decreased expression of DENND10 mRNA	CTD	PMID:24236059
Dennd10	Rat	doxorubicin	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of DENND10 mRNA	CTD	PMID:29803840
Dennd10	Rat	ethanol	affects splicing	ISO	Dennd10 (Mus musculus)	6480464	Ethanol affects the splicing of DENND10 mRNA	CTD	PMID:30319688
Dennd10	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of DENND10 mRNA	CTD	PMID:24136188
Dennd10	Rat	folic acid	multiple interactions	ISO	Dennd10 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DENND10 mRNA	CTD	PMID:22206623
Dennd10	Rat	haloperidol	increases expression	EXP		6480464	Haloperidol results in increased expression of DENND10 mRNA	CTD	PMID:16715494
Dennd10	Rat	indometacin	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DENND10 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of DENND10 mRNA	CTD	PMID:28628672
Dennd10	Rat	ivermectin	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Ivermectin results in decreased expression of DENND10 protein	CTD	PMID:32959892
Dennd10	Rat	nickel atom	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Nickel results in decreased expression of DENND10 mRNA	CTD	PMID:23195993
Dennd10	Rat	nitrates	multiple interactions	ISO	Dennd10 (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of DENND10 mRNA	CTD	PMID:35964746
Dennd10	Rat	pirinixic acid	increases expression	ISO	Dennd10 (Mus musculus)	6480464	pirinixic acid results in increased expression of DENND10 mRNA	CTD	PMID:23811191
Dennd10	Rat	resveratrol	multiple interactions	ISO	DENND10 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of DENND10 mRNA	CTD	PMID:23557933
Dennd10	Rat	sunitinib	increases expression	ISO	DENND10 (Homo sapiens)	6480464	Sunitinib results in increased expression of DENND10 mRNA	CTD	PMID:31533062
Dennd10	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DENND10 mRNA	CTD	PMID:34492290
Dennd10	Rat	thiram	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Thiram results in decreased expression of DENND10 mRNA	CTD	PMID:38568856
Dennd10	Rat	titanium dioxide	decreases methylation	ISO	Dennd10 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of FAM45A gene	CTD	PMID:35295148
Dennd10	Rat	tributylstannane	increases expression	EXP		6480464	tributyltin results in increased expression of DENND10 mRNA	CTD	PMID:31129395
Dennd10	Rat	trichostatin A	affects expression	ISO	DENND10 (Homo sapiens)	6480464	trichostatin A affects the expression of DENND10 mRNA	CTD	PMID:28542535
Dennd10	Rat	triphenyl phosphate	affects expression	ISO	DENND10 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of FAM45A mRNA	CTD	PMID:37042841
Dennd10	Rat	triptonide	affects expression	ISO	Dennd10 (Mus musculus)	6480464	triptonide affects the expression of DENND10 mRNA	CTD	PMID:33045310
Dennd10	Rat	valproic acid	decreases expression	ISO	DENND10 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of DENND10 mRNA	CTD	PMID:23179753

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd10	Rat	endosome transport via multivesicular body sorting pathway	involved_in	ISO	DENND10 (Homo sapiens)	1624291	PMID:30771381	RGD	PMID:30771381
Dennd10	Rat	protein transport	involved_in	ISO	DENND10 (Homo sapiens)	1624291	PMID:30771381	RGD	PMID:30771381
Dennd10	Rat	protein transport	involved_in	IBA	PANTHER:PTN002004115 and UniProtKB:Q8TCE6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dennd10	Rat	regulation of early endosome to late endosome transport	involved_in	ISO	DENND10 (Homo sapiens)	1624291	PMID:30771381	RGD	PMID:30771381
Dennd10	Rat	regulation of early endosome to late endosome transport	involved_in	IBA	PANTHER:PTN002004115 and UniProtKB:Q8TCE6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd10	Rat	endosome	located_in	IEA	UniProtKB-KW:KW-0967	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dennd10	Rat	late endosome	located_in	ISO	DENND10 (Homo sapiens)	1624291	PMID:30771381	RGD	PMID:30771381
Dennd10	Rat	late endosome	is_active_in	IBA	PANTHER:PTN002004115 and UniProtKB:Q8TCE6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dennd10	Rat	late endosome	located_in	IEA	UniProtKB-SubCell:SL-0152	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dennd10	Rat	guanyl-nucleotide exchange factor activity	enables	ISO	DENND10 (Homo sapiens)	1624291	PMID:30771381	RGD	PMID:30771381
Dennd10	Rat	guanyl-nucleotide exchange factor activity	enables	IBA	PANTHER:PTN002004115 and UniProtKB:Q8TCE6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dennd10	Rat	guanyl-nucleotide exchange factor activity	enables	IEA	UniProtKB-KW:KW-0344	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dennd10	Rat	protein binding	enables	ISO	DENND10 (Homo sapiens)	1624291	UniProtKB:Q567U6 more ...	RGD	PMID:33961781 more ...
Dennd10	Rat	small GTPase binding	enables	ISO	DENND10 (Homo sapiens)	1624291	UniProtKB:O00194 more ...	RGD	PMID:30771381
Dennd10	Rat	small GTPase binding	enables	IBA	PANTHER:PTN002004115 and UniProtKB:Q8TCE6	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:30771381

Dennd10
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	269,937,023 - 269,960,506 (+)	NCBI		GRCr8
mRatBN7.2	1	259,950,955 - 259,974,459 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	259,950,866 - 259,974,455 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	268,157,895 - 268,181,155 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	274,863,921 - 274,887,181 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	267,518,241 - 267,541,489 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	282,188,080 - 282,211,588 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	282,188,110 - 282,210,580 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	289,526,625 - 289,550,139 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	267,417,683 - 267,441,183 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	267,628,755 - 267,652,267 (+)	NCBI
Celera	1	255,592,048 - 255,615,542 (+)	NCBI		Celera
Cytogenetic Map	1	q55	NCBI

DENND10
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	119,104,113 - 119,137,984 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	119,104,086 - 119,137,984 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	120,863,625 - 120,897,496 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	120,853,601 - 120,887,213 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	120,853,600 - 120,887,212	NCBI
Celera	10	114,594,076 - 114,626,795 (+)	NCBI		Celera
Cytogenetic Map	10	q26.11	NCBI
HuRef	10	114,500,242 - 114,526,453 (+)	NCBI		HuRef
CHM1_1	10	121,148,027 - 121,181,603 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	119,999,563 - 120,033,391 (+)	NCBI		T2T-CHM13v2.0

Dennd10
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	60,800,029 - 60,824,673 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	60,800,023 - 60,824,665 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	60,811,555 - 60,836,235 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	60,811,585 - 60,836,227 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	60,887,473 - 60,912,135 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	60,866,274 - 60,890,890 (+)	NCBI		MGSCv36	mm8
Celera	19	63,021,151 - 63,045,424 (+)	NCBI		Celera
Cytogenetic Map	19	D3	NCBI
cM Map	19	56.52	NCBI

Dennd10
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	23,600,589 - 23,624,292 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955431	23,601,338 - 23,623,852 (+)	NCBI	ChiLan1.0	ChiLan1.0

DENND10
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	130,965,817 - 130,996,749 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	130,971,182 - 131,002,103 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	115,677,737 - 115,708,548 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	119,112,394 - 119,132,778 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	119,101,448 - 119,131,446 (+)	Ensembl	panpan1.1		panPan2

DENND10
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	29,325,721 - 29,369,218 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	29,326,014 - 29,367,916 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	29,469,452 - 29,511,222 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	29,858,116 - 29,899,872 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	29,858,080 - 29,900,284 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	29,412,004 - 29,454,285 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	29,431,880 - 29,473,803 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	29,626,164 - 29,668,069 (+)	NCBI		UU_Cfam_GSD_1.0

Dennd10
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	16,985,646 - 17,004,348 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936486	8,557,017 - 8,578,856 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936486	8,556,954 - 8,575,113 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DENND10
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	129,007,239 - 129,056,763 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	129,007,209 - 129,048,111 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	140,538,041 - 140,572,707 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DENND10
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	111,900,679 - 111,929,890 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	73,168,280 - 73,199,750 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dennd10
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	27,647,121 - 27,668,858 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624737	27,634,338 - 27,668,829 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Dennd10
37 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	752
Count of miRNA genes:	281
Interacting mature miRNAs:	353
Transcripts:	ENSRNOT00000013845
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
631690	Scl5	Serum cholesterol level QTL 5	2.1		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	236125214	260522016	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
71112	Bw115	Body weight QTL 115	6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	259647732	260522016	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	237147813	260522016	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	233948574	260522016	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
737975	Bw122	Body weight QTL 122	9.11	0.005	body mass (VT:0001259)	body weight (CMO:0000012)	1	258843780	260122809	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat

BE109682

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	259,973,238 - 259,973,434 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	282,210,369 - 282,210,564	NCBI	Rnor6.0
Rnor_5.0	1	289,548,920 - 289,549,115	UniSTS	Rnor5.0
RGSC_v3.4	1	267,439,966 - 267,440,161	UniSTS	RGSC3.4
Celera	1	255,614,325 - 255,614,520	UniSTS
RH 3.4 Map	1	1704.6	UniSTS
Cytogenetic Map	1	q55	UniSTS

RH138686

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	259,974,256 - 259,974,392 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	282,211,387 - 282,211,522	NCBI	Rnor6.0
Rnor_5.0	1	289,549,938 - 289,550,073	UniSTS	Rnor5.0
RGSC_v3.4	1	267,440,984 - 267,441,119	UniSTS	RGSC3.4
Celera	1	255,615,343 - 255,615,478	UniSTS
RH 3.4 Map	1	1711.1	UniSTS
Cytogenetic Map	1	q55	UniSTS

RH138824

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	259,969,638 - 259,970,922 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	282,206,769 - 282,208,052	NCBI	Rnor6.0
Rnor_5.0	1	289,545,320 - 289,546,603	UniSTS	Rnor5.0
RGSC_v3.4	1	267,436,366 - 267,437,649	UniSTS	RGSC3.4
Celera	1	255,610,725 - 255,612,008	UniSTS
RH 3.4 Map	1	1706.8	UniSTS
Cytogenetic Map	1	q55	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001127681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001398802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063288305	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC167081	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013845 ⟹ ENSRNOP00000013845

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	259,950,866 - 259,974,455 (+)	Ensembl
Rnor_6.0 Ensembl	1	282,188,110 - 282,210,580 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108463 ⟹ ENSRNOP00000094983

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	259,952,993 - 259,974,455 (+)	Ensembl

RefSeq Acc Id:

NM_001127681 ⟹ NP_001121153

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	269,937,023 - 269,960,506 (+)	NCBI
mRatBN7.2	1	259,950,976 - 259,974,459 (+)	NCBI
Rnor_6.0	1	282,188,086 - 282,211,586 (+)	NCBI
Rnor_5.0	1	289,526,625 - 289,550,139 (+)	NCBI
RGSC_v3.4	1	267,417,683 - 267,441,183 (+)	RGD
Celera	1	255,592,048 - 255,615,542 (+)	RGD

Sequence:

show sequence

AAGAGCTGGGGCGGGACCTGCAGTGCGGAGCCGGGGAAGCGGCGGAAGATGGCTGCAGTTGTAGCAATGGACACCCAGCTGATGCTCGGAGTCGGGCTGATCGTGACCATCTTTCCACCATAGAAAAG
GACACTAATGGAGAAGTTCTGTGGGTGTGGTGTTATCCTTCCACGACAGCCTCACTAAGGAATCTGCTGCTCCGAAAATGCTGCCTAACTGATGAAAACAAACTTCTCCACCCTTTTGTCTTTGGTCA
GTACAGAAGAACATGGTTTTATGTCACTACAGTTGAAGTTCCAGATTCTTCAGTTTTGAAAAAGGTGACTCATTTTTCTATTGTTCTGACCGCCAAAGATTTTAACCCAGAGAAATATGCCGCCTTCA
CTAGGATATTGTGTAGAATATATTTGAAATATGGAAGTCCAGTTAAAATGATGGAAAGTTACATTGCAGTTCTCACCAAGGGGATCTGCCAGAGTGAAGAAAATGGCTCCTTCCTTAGCAGAGACTTT
GATGGTCGAAAGGCGTACCTCGCCGGCTCCATCAAAGACATTGTATCTCAATTTGGAATGGAAACTATTATCTTACACACAGCGTTGATGCTGAAAAAACGAATTGTTGTCTATCACCCCAAAATAGA
AGCTGTTCAGGAGTTCACCAGGACTCTGCCTGCCCTGGTGTGGCATCGACAGGATTGGTCCATCCTGCATTCTTACATGCACCTTCATGCTGAGGAACTGGAAGGCCTACAGATGTGCACAGGCTACA
TTGCTGGCTTTGTAGATTTGGAGGTGAGCAACAGACCAGACCTCTACGACGTGTTTGTGAATCTGGCAGACAGTGAGATCATCATCGCTCCACTTGCAAAAGAGGCCATGACAATGGGCAAACTGCAT
AAAGAGATTGGTCAACTAATTGTGCAGTCTGCAGAAGACCCAGAGAAGTCAGACAGCCAGGTTATACAGGACATTGCCCTAAAAACAAAAGAAATCTTCACCCACCTGGCACCATTCTCAGAAGCGTC
AGATGCGGGGAAGGTCTTCCTCAATGTTGAGGCACTGAAGCAGAAGCGATTTCCACCCGCCACAGAAAACTTCCTGTATCATCTAGCGGCCGCTGAACAGATGCTGAAGGTCTGATGGTTCACAACAT
TTTGCTGTGGCCCCTACAGAACTTCCCTTTTATTCCTAGTACCTATCGACATGTACAGTATTGGAATTATAGGAATGCTCTATTTTTAATGATTTATTTCCAAATAGTGAGAGCTTAGGTGAGAGCAC
ATAAAAACGATTGTGATTTTCTCCCTGTCAATTTGATCCAGTACAGTGTTTTAATTTTAATTGCTGTCTTAATGGTAGGAGCCACATAGATCAGCACATGCAAACCTTCATTGTTCATTCCTATTTAG
TCTCACTGTAACCATAAACATAAGCTCGTTTTCAGAAAGCCGTCTCAAAGTTTGCTTTTTTATTCTTCTAGAAAAAAAACTTGAATTCCTCATGAGAGAGTTTGCTTTTTGAGCCTAACTGCTATGTT
TTCTTCAGAATTTTCTAGAAGGTCATTCAAGGGATACTACAGTTGCACTTTCTTGTAAAAGAAAATATTTTGGGGCCTTTGAAATTTTTGCCTATTTTATGAGGGTTTTTCATACTTGAGCAGACAAC
TCCAACAACCCTTACACTGCCCTAGACATAAGCACTCAACAAACATCAGTCATTAGTGCTCTTGGACTCACTCCTGCTACAGTGTCTTTGGAAAAGAGGCCAGTCCCCAACAAAGAAACCCCTTTTAA
GTGTAAGCATGTCTAAGAAAAAGTACCTTGGTTGTTTTTGTTTACAATGCTGGAGCTAGAACCTGGGGCCTTGATGTGCCAGGCATTGCTTTCCCACCAAATTAAACCCCCAGCCCAATAATGCTTTC
AGATATTGGTAAAGGAACATGAGAACCAATTGCAGAGGCCAAAACTAGACAGTGTCTTCAAGTGACTGCAGTAAAGGGATTTGGCCACATCATCAAGGACACTGTTACTACTCTCTCTTAATTTGAGA
TGTTAAAATTGCCAAATAAGCACGAATGTATCAATTATGCATTCCTTATGTCTACTTACATTATTTATGAAAGGCCACCTTTCTTAGTATAGTTGCAGAGCATTCAAACCTTACCAGGAAACATGTTT
GCAAAAACTTTATGTTGGGTATTTTTTTTAACCTTATTCTTAGACATTTAAGTAAAAATAAAAAAATAGCCTTTCCTTCTTGTCTTTGAGTGGAAACAGGGAGGACTTGACATACGTTGTTTACTGGA
GCTAACAACTGAAGATTAAATTTGCACTTTATAAAAAG

hide sequence

RefSeq Acc Id:

NM_001398802 ⟹ NP_001385731

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	269,937,023 - 269,960,506 (+)	NCBI
mRatBN7.2	1	259,950,976 - 259,974,459 (+)	NCBI

RefSeq Acc Id:

XM_063288305 ⟹ XP_063144375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	269,939,785 - 269,960,502 (+)	NCBI


Protein RefSeqs	NP_001121153	(Get FASTA)	NCBI Sequence Viewer
	NP_001385731	(Get FASTA)	NCBI Sequence Viewer
	XP_063144375	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67081	(Get FASTA)	NCBI Sequence Viewer
	EDL94580	(Get FASTA)	NCBI Sequence Viewer
	EDL94581	(Get FASTA)	NCBI Sequence Viewer
	EDL94582	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013845
	ENSRNOP00000013845.8
	ENSRNOP00000094983.1
	ENSRNOP00000101312

RefSeq Acc Id:	NP_001121153 ⟸ NM_001127681
- Peptide Label:	isoform 2
- UniProtKB:	A6JIA9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMESYIAVLTKGICQSEENGSFLSRDFDGRKAYLAGSIKDIVSQFGMETIILHTALMLKKRIVVYHPKIEAVQEFTRTLPALVWHRQDWSILHSYMHLHAEELEGLQMCTGYIAGFVDLEVSNRPDLY DVFVNLADSEIIIAPLAKEAMTMGKLHKEIGQLIVQSAEDPEKSDSQVIQDIALKTKEIFTHLAPFSEASDAGKVFLNVEALKQKRFPPATENFLYHLAAAEQMLKV hide sequence

Ensembl Acc Id:

ENSRNOP00000013845 ⟸ ENSRNOT00000013845

Ensembl Acc Id:

ENSRNOP00000094983 ⟸ ENSRNOT00000108463

RefSeq Acc Id:	NP_001385731 ⟸ NM_001398802
- Peptide Label:	isoform 1
- UniProtKB:	A6JIA6 (UniProtKB/TrEMBL), F1LNS2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063144375 ⟸ XM_063288305
- Peptide Label:	isoform X1
- UniProtKB:	A6JIA9 (UniProtKB/TrEMBL)

Protein Domains

uDENN

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LNS2-F1-model_v2	AlphaFold	F1LNS2	1-356	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691022

Promoter ID:

EPDNEW_R1547

Type:

initiation region

Name:

Fam45a_1

Description:

family with sequence similarity 45, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	282,188,107 - 282,188,167	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-55222	BioCyc
Ensembl Genes	ENSRNOG00000010230	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013845	ENTREZGENE
	ENSRNOT00000013845.8	UniProtKB/TrEMBL
	ENSRNOT00000108463.1	UniProtKB/TrEMBL
	ENSRNOT00000148269	ENTREZGENE
IMAGE_CLONE	IMAGE:7388963	IMAGE-MGC_LOAD
InterPro	FAM45	UniProtKB/TrEMBL
	Tripartite_DENN	UniProtKB/TrEMBL
KEGG Report	rno:308009	UniProtKB/TrEMBL
MGC_CLONE	MGC:189440	IMAGE-MGC_LOAD
NCBI Gene	308009	ENTREZGENE
PANTHER	DENN DOMAIN-CONTAINING PROTEIN 10-RELATED	UniProtKB/TrEMBL
	PTHR28544	UniProtKB/TrEMBL
Pfam	SPA	UniProtKB/TrEMBL
PhenoGen	Dennd10	PhenoGen
PROSITE	DENN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010230	RatGTEx
UniProt	A0A8I6AM52_RAT	UniProtKB/TrEMBL
	A6JIA6	ENTREZGENE, UniProtKB/TrEMBL
	A6JIA9	ENTREZGENE, UniProtKB/TrEMBL
	F1LNS2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-07-02	Dennd10	DENN domain containing 10	Fam45a	family with sequence similarity 45, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-07	Fam45a	family with sequence similarity 45, member A	RGD1308326_predicted	similar to RIKEN cDNA 1810055E12 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-20	RGD1308326_predicted	similar to RIKEN cDNA 1810055E12 (predicted)	LOC308009_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC308009_predicted	similar to RIKEN cDNA 1810055E12 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message