Advanced Search (OLGA)

Gene: Ppp1r7 (protein phosphatase 1, regulatory subunit 7) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ppp1r7 (Ensembl: AABR07068351.1)

Name:

protein phosphatase 1, regulatory subunit 7

RGD ID:

1308169

Description:

Predicted to enable protein phosphatase regulator activity. Predicted to act upstream of or within chromosome segregation. Predicted to be located in chromosome. Orthologous to human PPP1R7 (protein phosphatase 1 regulatory subunit 7); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC105784; protein phosphatase 1 regulatory subunit 22; protein phosphatase 1 regulatory subunit 7; protein phosphatase 1, regulatory (inhibitor) subunit 7; Sds22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	Ppp1r7 (protein phosphatase 1, regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ppp1r7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ppp1r7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ppp1r7 (protein phosphatase 1 regulatory subunit 7)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PPP1R7 (protein phosphatase 1 regulatory subunit 7)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ppp1r7 (protein phosphatase 1, regulatory subunit 7)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C06A8.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	SDS22	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sds22	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K10D2.8	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	sds-22	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ppp1r7	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	101,333,472 - 101,358,589 (+)	NCBI		GRCr8
mRatBN7.2	9	93,886,068 - 93,911,198 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	93,886,143 - 93,914,850 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	102,321,658 - 102,346,746 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	107,457,461 - 107,482,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	105,813,603 - 105,838,783 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	99,556,587 - 100,504,077 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	9	99,226,358 - 99,235,083 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	9	100,116,100 - 100,160,432 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	92,624,083 - 92,648,034 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	92,828,851 - 92,852,802 (+)	NCBI
Celera	9	91,421,088 - 91,444,915 (+)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r7	Rat	Bethlem Myopathy 1A		ISO	PPP1R7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bethlem myopathy 1A	ClinVar	PMID:26004199 and PMID:28492532
Ppp1r7	Rat	chromosome 2q37 deletion syndrome		ISO	PPP1R7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Chromosome 2q37 deletion syndrome	ClinVar	PMID:25741868
Ppp1r7	Rat	D-2-hydroxyglutaric aciduria 1		ISO	PPP1R7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: D-2-hydroxyglutaric aciduria 1	ClinVar	PMID:16081310 more ...
Ppp1r7	Rat	hereditary spastic paraplegia 30		ISO	PPP1R7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary spastic paraplegia 30	ClinVar	PMID:16081310 more ...
Ppp1r7	Rat	intellectual disability		ISO	PPP1R7 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r7	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Ppp1r7 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP1R7 mRNA	CTD	PMID:36331819
Ppp1r7	Rat	1,2-dichloroethane	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	ethylene dichloride results in increased expression of PPP1R7 mRNA	CTD	PMID:28960355
Ppp1r7	Rat	17beta-estradiol	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Estradiol results in increased expression of PPP1R7 mRNA	CTD	PMID:39298647
Ppp1r7	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in increased expression of PPP1R7 mRNA	CTD	PMID:19770486
Ppp1r7	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of PPP1R7 mRNA	CTD	PMID:22298810
Ppp1r7	Rat	2,4,6-tribromophenol	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Ppp1r7	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	decreases expression	EXP		6480464	2 more ...	CTD	PMID:19954255
Ppp1r7	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	2 more ...	CTD	PMID:18550172
Ppp1r7	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	decreases expression	ISO	Ppp1r7 (Mus musculus)	6480464	2 more ...	CTD	PMID:18550172
Ppp1r7	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of PPP1R7 mRNA	CTD	PMID:21346803
Ppp1r7	Rat	2-hydroxypropanoic acid	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PPP1R7 mRNA	CTD	PMID:30851411
Ppp1r7	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of PPP1R7 protein	CTD	PMID:31675489
Ppp1r7	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	bisphenol S results in increased expression of PPP1R7 mRNA	CTD	PMID:39298647
Ppp1r7	Rat	aristolochic acid A	increases expression	ISO	PPP1R7 (Homo sapiens)	6480464	aristolochic acid I results in increased expression of PPP1R7 mRNA and aristolochic acid I results in increased expression of PPP1R7 protein	CTD	PMID:33212167
Ppp1r7	Rat	Aroclor 1254	decreases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of PPP1R7 mRNA	CTD	PMID:23650126
Ppp1r7	Rat	arsenite(3-)	multiple interactions	ISO	PPP1R7 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to PPP1R7 mRNA]	CTD	PMID:32406909
Ppp1r7	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of PPP1R7 gene	CTD	PMID:35440735
Ppp1r7	Rat	benzo[a]pyrene	increases methylation	ISO	Ppp1r7 (Mus musculus)	6480464	Benzo(a)pyrene results in increased methylation of PPP1R7 3' UTR more ...	CTD	PMID:27901495
Ppp1r7	Rat	beta-lapachone	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	beta-lapachone results in decreased expression of PPP1R7 mRNA	CTD	PMID:38218311
Ppp1r7	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Diethylhexyl Phthalate results in decreased expression of PPP1R7 mRNA	CTD	PMID:33754040
Ppp1r7	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PPP1R7 mRNA	CTD	PMID:25181051
Ppp1r7	Rat	bisphenol A	increases expression	ISO	PPP1R7 (Homo sapiens)	6480464	bisphenol A results in increased expression of PPP1R7 protein	CTD	PMID:37567409
Ppp1r7	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PPP1R7 gene	CTD	PMID:28505145
Ppp1r7	Rat	caffeine	decreases phosphorylation	ISO	PPP1R7 (Homo sapiens)	6480464	Caffeine results in decreased phosphorylation of PPP1R7 protein	CTD	PMID:35688186
Ppp1r7	Rat	carbamazepine	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	Carbamazepine affects the expression of PPP1R7 mRNA	CTD	PMID:24752500
Ppp1r7	Rat	cisplatin	increases phosphorylation	ISO	Ppp1r7 (Mus musculus)	6480464	Cisplatin results in increased phosphorylation of PPP1R7 protein	CTD	PMID:22006019
Ppp1r7	Rat	cobalt dichloride	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	cobaltous chloride results in decreased expression of PPP1R7 mRNA	CTD	PMID:19376846
Ppp1r7	Rat	cocaine	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Cocaine results in increased expression of PPP1R7 mRNA	CTD	PMID:18355967
Ppp1r7	Rat	cocaine	multiple interactions	ISO	Ppp1r7 (Mus musculus)	6480464	FOS protein mutant form inhibits the reaction [Cocaine results in increased expression of PPP1R7 mRNA]	CTD	PMID:18355967
Ppp1r7	Rat	copper(II) sulfate	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of PPP1R7 mRNA	CTD	PMID:19549813
Ppp1r7	Rat	crocidolite asbestos	decreases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Asbestos and Crocidolite results in decreased expression of PPP1R7 mRNA	CTD	PMID:29279043
Ppp1r7	Rat	Di-n-octyl phthalate	increases expression	ISO	Ppp1r7 (Mus musculus)	6480464	di-n-octyl phthalate results in increased expression of PPP1R7 mRNA	CTD	PMID:37810885
Ppp1r7	Rat	Dibutyl phosphate	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PPP1R7 mRNA	CTD	PMID:37042841
Ppp1r7	Rat	dibutyl phthalate	decreases expression	ISO	Ppp1r7 (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of PPP1R7 mRNA	CTD	PMID:17361019 and PMID:21266533
Ppp1r7	Rat	diclofenac	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	Diclofenac affects the expression of PPP1R7 mRNA	CTD	PMID:24752500
Ppp1r7	Rat	diethylstilbestrol	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Diethylstilbestrol results in decreased expression of PPP1R7 mRNA	CTD	PMID:36621641
Ppp1r7	Rat	doxorubicin	affects methylation	EXP		6480464	Doxorubicin affects the methylation of PPP1R7 gene	CTD	PMID:28962528
Ppp1r7	Rat	doxorubicin	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of PPP1R7 mRNA	CTD	PMID:29803840
Ppp1r7	Rat	flutamide	increases expression	EXP		6480464	Flutamide results in increased expression of PPP1R7 mRNA	CTD	PMID:24136188
Ppp1r7	Rat	FR900359	increases phosphorylation	ISO	PPP1R7 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of PPP1R7 protein	CTD	PMID:37730182
Ppp1r7	Rat	glyphosate	affects methylation	EXP		6480464	Glyphosate affects the methylation of PPP1R7 gene	CTD	PMID:35440735
Ppp1r7	Rat	hydrogen peroxide	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of PPP1R7 mRNA	CTD	PMID:21179406
Ppp1r7	Rat	ivermectin	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Ivermectin results in decreased expression of PPP1R7 protein	CTD	PMID:32959892
Ppp1r7	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of PPP1R7 gene	CTD	PMID:35440735
Ppp1r7	Rat	paracetamol	increases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Acetaminophen results in increased expression of PPP1R7 mRNA	CTD	PMID:22230336
Ppp1r7	Rat	paracetamol	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Acetaminophen results in decreased expression of PPP1R7 mRNA	CTD	PMID:29067470
Ppp1r7	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Ppp1r7 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PPP1R7 mRNA	CTD	PMID:36331819
Ppp1r7	Rat	rac-lactic acid	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Lactic Acid results in decreased expression of PPP1R7 mRNA	CTD	PMID:30851411
Ppp1r7	Rat	SB 431542	multiple interactions	ISO	PPP1R7 (Homo sapiens)	6480464	[LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of PPP1R7 protein	CTD	PMID:37664457
Ppp1r7	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of PPP1R7 mRNA	CTD	PMID:19281266
Ppp1r7	Rat	sunitinib	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Sunitinib results in decreased expression of PPP1R7 mRNA	CTD	PMID:31533062
Ppp1r7	Rat	temozolomide	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Temozolomide results in decreased expression of PPP1R7 mRNA	CTD	PMID:31758290
Ppp1r7	Rat	tert-butyl hydroperoxide	decreases expression	ISO	PPP1R7 (Homo sapiens)	6480464	tert-Butylhydroperoxide results in decreased expression of PPP1R7 mRNA	CTD	PMID:15336504
Ppp1r7	Rat	testosterone enanthate	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	testosterone enanthate affects the expression of PPP1R7 mRNA	CTD	PMID:17440010
Ppp1r7	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PPP1R7 mRNA	CTD	PMID:23411599
Ppp1r7	Rat	trichloroethene	increases methylation	EXP		6480464	Trichloroethylene results in increased methylation of PPP1R7 gene	CTD	PMID:27618143
Ppp1r7	Rat	triphenyl phosphate	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of PPP1R7 mRNA	CTD	PMID:37042841
Ppp1r7	Rat	valproic acid	increases methylation	ISO	PPP1R7 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PPP1R7 gene	CTD	PMID:29154799
Ppp1r7	Rat	valproic acid	affects expression	ISO	Ppp1r7 (Mus musculus)	6480464	Valproic Acid affects the expression of PPP1R7 mRNA	CTD	PMID:17963808
Ppp1r7	Rat	valproic acid	increases expression	ISO	PPP1R7 (Homo sapiens)	6480464	Valproic Acid results in increased expression of PPP1R7 mRNA	CTD	PMID:23179753
Ppp1r7	Rat	valproic acid	affects expression	ISO	PPP1R7 (Homo sapiens)	6480464	Valproic Acid affects the expression of PPP1R7 mRNA	CTD	PMID:25979313
Ppp1r7	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of PPP1R7 mRNA	CTD	PMID:19015723

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r7	Rat	chromosome segregation	acts_upstream_of_or_within	ISO	Ppp1r7 (Mus musculus)	1624291	PMID:22801782	RGD	PMID:22801782

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r7	Rat	chromosome	located_in	ISO	PPP1R7 (Homo sapiens)	1624291	PMID:22801782	RGD	PMID:22801782
Ppp1r7	Rat	chromosome	located_in	IEA	UniProtKB:Q15435 and ensembl:ENSP00000234038	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r7	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ppp1r7	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ppp1r7	Rat	protein binding	enables	ISO	PPP1R7 (Homo sapiens) and UniProtKB:Q15435-3	1624291	UniProtKB:P01112 and PMID:32814053	RGD	PMID:32814053
Ppp1r7	Rat	protein binding	enables	ISO	PPP1R7 (Homo sapiens)	1624291	UniProtKB:O15480 more ...	RGD	PMID:23414517 more ...
Ppp1r7	Rat	protein binding	enables	ISO	Ppp1r7 (Mus musculus)	1624291	UniProtKB:P62137 and PMID:25593058	RGD	PMID:25593058
Ppp1r7	Rat	protein phosphatase regulator activity	enables	IEA	UniProtKB:Q15435 and ensembl:ENSP00000234038	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ppp1r7	Rat	protein phosphatase regulator activity	enables	ISO	PPP1R7 (Homo sapiens)	1624291	PMID:22801782	RGD	PMID:22801782

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7498485	PMID:12226088	PMID:12477932	PMID:12555814	PMID:15489334	PMID:16396499	PMID:19056867	PMID:21630459	PMID:22206666	PMID:22801782	PMID:23376485	PMID:23533145

Ppp1r7
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	101,333,472 - 101,358,589 (+)	NCBI		GRCr8
mRatBN7.2	9	93,886,068 - 93,911,198 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	93,886,143 - 93,914,850 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	102,321,658 - 102,346,746 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	107,457,461 - 107,482,640 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	105,813,603 - 105,838,783 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	99,556,587 - 100,504,077 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	9	99,226,358 - 99,235,083 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Rnor_5.0	9	100,116,100 - 100,160,432 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	92,624,083 - 92,648,034 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	92,828,851 - 92,852,802 (+)	NCBI
Celera	9	91,421,088 - 91,444,915 (+)	NCBI		Celera
Cytogenetic Map	9	q36	NCBI

PPP1R7
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	241,149,573 - 241,183,652 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	241,149,576 - 241,183,652 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	242,088,988 - 242,123,067 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	241,738,575 - 241,771,112 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	241,809,891 - 241,842,429	NCBI
Celera	2	235,759,626 - 235,792,623 (+)	NCBI		Celera
Cytogenetic Map	2	q37.3	NCBI
HuRef	2	233,846,344 - 233,879,486 (+)	NCBI		HuRef
CHM1_1	2	242,095,958 - 242,128,538 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	241,648,673 - 241,683,461 (+)	NCBI		T2T-CHM13v2.0

Ppp1r7
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	93,271,350 - 93,295,344 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	93,270,576 - 93,301,211 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	93,343,610 - 93,367,616 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	93,342,854 - 93,373,489 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	95,240,222 - 95,264,195 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	95,174,051 - 95,198,024 (+)	NCBI		MGSCv36	mm8
Celera	1	96,288,260 - 96,312,213 (+)	NCBI		Celera
Cytogenetic Map	1	D	NCBI
cM Map	1	47.24	NCBI

Ppp1r7
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955542	520,605 - 539,699 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPP1R7
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	143,849,616 - 143,883,834 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	143,864,512 - 143,898,730 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	128,418,212 - 128,452,417 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	247,214,953 - 247,248,761 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	247,214,882 - 247,248,761 (+)	Ensembl	panpan1.1		panPan2

PPP1R7
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	25	51,181,092 - 51,206,237 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	25	51,181,053 - 51,206,193 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	25	51,393,754 - 51,418,900 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	25	51,375,512 - 51,400,669 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	25	51,375,474 - 51,401,299 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	25	51,223,238 - 51,248,373 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	25	50,962,763 - 50,987,892 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	25	51,239,231 - 51,264,386 (+)	NCBI		UU_Cfam_GSD_1.0

Ppp1r7
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	192,555,414 - 192,584,880 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936745	639,379 - 663,926 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPP1R7
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	139,917,257 - 139,941,251 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	139,918,006 - 139,937,168 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	155,032,379 - 155,050,592 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPP1R7
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	127,206,233 - 127,243,577 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	72,137,475 - 72,176,353 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppp1r7
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624847	5,246,734 - 5,263,867 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624847	5,247,094 - 5,263,873 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ppp1r7
114 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	103
Interacting mature miRNAs:	108
Transcripts:	ENSRNOT00000022854
Prediction methods:	Miranda
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582203	Gluco19	Glucose level QTL 19	3.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	9	92491589	100929786	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
724547	Cm21	Cardiac mass QTL 21	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	9	79271511	102910209	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
4889852	Pur26	Proteinuria QTL 26	15	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	77813894	101597663	Rat
7794784	Mcs31	Mammary carcinoma susceptibility QTL 31	2.98		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	9	77813894	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat

RH130818

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	93,909,729 - 93,909,921 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	100,503,816 - 100,504,007	NCBI	Rnor6.0
Rnor_5.0	9	100,160,171 - 100,160,362	UniSTS	Rnor5.0
RGSC_v3.4	9	92,647,773 - 92,647,964	UniSTS	RGSC3.4
Celera	9	91,444,654 - 91,444,845	UniSTS
RH 3.4 Map	9	801.0	UniSTS
Cytogenetic Map	9	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001009825	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008767362	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088868	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473997	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022854 ⟹ ENSRNOP00000022854

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	93,888,313 - 93,911,195 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095497 ⟹ ENSRNOP00000081944

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	93,886,149 - 93,911,195 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103695 ⟹ ENSRNOP00000095250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	93,886,143 - 93,914,850 (+)	Ensembl

RefSeq Acc Id:

NM_001009825 ⟹ NP_001009825

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	101,333,497 - 101,358,589 (+)	NCBI
mRatBN7.2	9	93,886,104 - 93,911,198 (+)	NCBI
Rnor_6.0	9	99,557,511 - 100,504,077 (+)	NCBI
Rnor_5.0	9	99,226,358 - 99,235,083 (+)	NCBI
Rnor_5.0	9	100,116,100 - 100,160,432 (+)	NCBI
RGSC_v3.4	9	92,624,083 - 92,648,034 (+)	RGD
Celera	9	91,421,088 - 91,444,915 (+)	RGD

Sequence:

show sequence

GCAGCCAATATGGCGGCGGAGCGCGGCGCGGGGCAGCAACAGTCGCAGGAGATGATGGAGGTTGACAGGCGTGTTGAATCTGAAGAATCAGGTGATGAGGAAGGGAAGAAGCATGGCGGTGGCATCGT
GGCAGACCTCAGCCAGCAGAGCCTGAAGGATGGGGTAGAACGGGGCGCAGAAGATCCGGAAGAGGAGCATGAGCTGGCAGTGGATATGGAAACCATCAGCCTGGACCGAGATGCAGAGGATGTTGATC
TGAATCACTATAGAATTGGAAAGATTGAAGGCTTTGAGGTGCTAAAGAAAGTGAAGTCACTCTGCCTTCGTCAAAACTTAATTAAATGCATTGAGAACCTGGATGAACTTCAGAGTCTTCGAGAACTG
GATCTCTATGATAATCAGATCAAGAAGATTGAGAATCTAGAGGCACTGACGGAATTGGAGGTTCTAGACATTTCTTTTAATTTGCTGAGGAACATTGAAGGGATTGACAAACTGACACAGCTGAAAAA
ACTCTTCTTGGTCAACAATAAAATCAATAAAATTGAGAACATAAGCACCTTACAGCAACTGCAAATGTTAGAGCTGGGGTCTAACCGGATCCGGGCAATTGAAAATATCGACACGTTAACCAACCTGG
AGAGTTTGTTTCTGGGGAAAAACAAAATTACAAAGCTTCAGAACCTGGATGCACTTAGCAACCTCACAGTCCTCAGTATGCAGAGCAACCGGCTAACAAAGATCGAAGGTCTACAGAACTTGGTGAAC
CTTCGTGAACTATACCTCAGCCACAATGGCATTGAGGTTATCGAAGGCCTGGAGAACAATAACAAACTCACCATGTTGGATATTGCATCAAATAGAATAAAAAAGATTGAGAATATCAGCCATCTGAC
AGAACTGCAAGAATTCTGGATGAATGACAACCTCCTGGAGAGTTGGAGTGACCTTGATGAGCTGAAGGGTGCCAGGAGTCTGGAGACTGTGTATCTGGAGCGTAACCCCCTGCAGAAGGATCCACAGT
ACCGGCGGAAGGTCATGCTGGCCCTACCCTCTGTGCGGCAGATCGACGCCACGTTCGTCAGGTTCTGAGCCCTTCTTGCGCCTCACCTGGTCCCTCTCCTCAAAAGAACTTCCCAGCCACGGTTTTTT
AATCTACCTATTGCTCCTGACGTCGTCACTCTACCAACAGTCACAACCCAATGGCAATAATCAGGCACTGGCACTACCCGGCCTGTGATACTTCACACCATTTGGAGATGCCAACACTATTAAACCTT
GCCACGCGGTCTTCCTGGTGAATCGCTGACAGTTATTGTAGCCATGGAGAGAATGCAGGACATGTTACAGTCACTTGCCCCTCCTGTTTCTATGTCCTTAGCTTGGTGGGCACTCTGGGCCGCCCCGG
CAGACCTTCAAGTTGGTTTGCAAGGTTTAAGTAGTCATGACCTACAACAGCACACTGGATAGTCTTTCAAACCAATTTTGGAAAGAAAAAAATTTTTTCTTTGCCAATTTTGAAAAGAAAAGATTATA
CTTTTTCTTTTTTGGAGTAAAGATGGTCCAGTGTGGGAAGCTATAATCCCTGGTGCCCTTCCCACATGAGGGAGGCTGAGCACAGCACACTGGGCACCATGTGACCTTATTCCCGCTTGGTAAAAGCT
GAGATATGGAGAGCTTCATTCCGTATCACCCAGCTATGTGGACCTAAGTGATATCAGAAACGTACATGTCTGAGCTCTCGGCCACTGGGCACTAGTCACATGGCTCCTGCACTCACCCCTCATCCTCT
GGCTGTATGTAGATGAAATGTCTCTGAGCAAACTCCTAGGGTGTAAATCTGATGCTGCAAGAGCATTGTCCTCCCTCTGCGCCTCAGACTTCCTTCCATACAGTAAGCACTAACTATGGTCACCAAAG
ACCCCTGAGCTTCCAGGGTTCTATTCTGTACTGTCCCAGATGGGGCCACTAACTGCCACATGTAGCAATTACTATTCATATTTAATCCATTGGATTTATTCATCTCTTCATTTGTGCTCACACTTCAT
CTGCTCAGAGGCCGCATATCATGGAAGGCATCTATTTCTGCCATCATAGAAGGTTCTGGAAAACACTGCTCTAGACTGTTTAGTAGTAGGGGGAATGGCTTGCATTGAGCTGTGAAGCATGTGACCAG
GTGTCCAAGCTAACCAGTTAGCCAACTGCCCAGGAGTTTGTAATGTCAGAATGCTTTCATGGGATTTAACATCCGTTTCTGATTCTAATTCTCACCAAAATAAACCGTATGATCTGGAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

RefSeq Acc Id:

XM_008767362 ⟹ XP_008765584

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	101,333,472 - 101,350,755 (+)	NCBI
mRatBN7.2	9	93,886,068 - 93,902,220 (+)	NCBI
Rnor_6.0	9	99,556,587 - 100,496,306 (+)	NCBI

Sequence:

show sequence

GCTGGTGTCTCACCTGAGGCCGGCGCAACTCTCAGCCGGATTCACACCGTAAAGATCCGCGCGC
TTCTGCCCCACCGACCAATCGTAGGCAGAGTAACAAGGGGTCAAGAACCAACCAGACACCTTGATGGGCGGGCCTCAGTGAAAGCAAGCTGCTGAGCGCGCGCAAACGGTTGCTAGGGACGCGCTGGA
CGTCCACTACAGTGCCTCGGAGGAGCCAAAAGAAACTGGTTTCTCCGGCCCCCTCTCACCCCTATCACGCCAAGTGACTGCAGTTCACTCCTACAGCGGAACCGAGGACGGTGAGCGACGTGCAGCCC
TCCTTTTGGCGGCCACATTCTCAAGGCGAGGACGATGAGCAGAAGCGGACGATAAGGTGGTTCTCTGTGGGCCGGAGGCGGCGAACGCGCGCCCCCGAAACCGAGCCGTGGCCTCTCTCCCCTTCTCC
AAGCATCCGCTAAAGGCAGCACTTGGCGCCAATATATCAGCGCGCAGGCGCGGAATAAACTGTTCTCCCTCGCCTACCTGCTCACGGTGCAGACACACAGCATTGAGGCTCCGGAAGTCGGGGCATGT
CTATTCTGTTTTACCTTTGGCCTGTAGAGCTCTCCTGGCCTCAGTAACTTTACGCCTCCGAAGTCAGCACAGTGACTTGAGCGAATCTGCAAGCTTGAAGTGTCTCCCATGCTGCCTGATGACTTTCC
GGGATGTCTACGTTCGCCGTGCTCGCCTAGACTCCACTCATTCATCAAACCCCTAACTCGGGGGGGGCCGGGCCCTGGGGAACTACAATTCCCATGAAACACTGCGACCACGCAAGCGTGTCAGCTCG
CGCTTCTATACTTTGTTCCATTGGCTGGCCGACTGGACCTGGAATCCTGATTGGCCCATGGCCTGAGGCGACAGATTCCGGAAAGGGGAAGAGCAGCCAATATGGCGGCGGAGCGCGGCGCGGGGCAG
CAACAGTCGCAGGAGATGATGGAGGTTGACAGGCGTGTTGAATCTGAAGAATCAGGTGATGAGGAAGGGAAGAAGCATGGCGGTGGCATCGTGGCAGACCTCAGCCAGCAGAGCCTGAAGGATGGGGT
AGAACGGGGCGCAGAAGATCCGGAAGAGGAGCATGAGCTGGCAGTGGATATGGAAACCATCAGCCTGGACCGAGATGCAGAGGATGTTGATCTGAATCACTATAGAATTGGAAAGATTGAAGGCTTTG
AGGTGCTAAAGAAAGTGAAGTCACTCTGCCTTCGTCAAAACTTAATTAAATGCATTGAGAACCTGGATGAACTTCAGAGTCTTCGAGAACTGGATCTCTATGATAATCAGATCAAGAAGATTGAGAAT
CTAGAGGCACTGACGGAATTGGAGGTTCTAGACATTTCTTTTAATTTGCTGAGGAACATTGAAGGGATTGACAAACTGACACAGCTGAAAAAACTCTTCTTGGTCAACAATAAAATCAATAAAATTGA
GAACATAAGCACCTTACAGCAACTGCAAATGTTAGAGCTGGGGTCTAACCGGATCCGGGCAATTGAAAATATCGACACGTTAACCAACCTGGAGAGTTTGTTTCTGGGGAAAAACAAAATTACAAAGC
TTCAGAACCTGGATGCACTTAGCAACCTCACAGTCCTCAGTATGCAGAGCAACCGGCTAACAAAGATCGAAGGTCTACAGAACTTGGTGAACCTTCGTGAACTATACCTCAGCCACAATGGCATTGAG
GTTATCGAAGGCCTGGAGAACAATATGGCTAACACAGGTATCATCAGCTCTGTCCTTCCCATTCATCCTGGCCACTGAGCTTCCTGCCCTGCCTCAGCCTCCTCCCAGCCTGTGAAGGCCATAGGATG
AGCTCAGCTCTGCTGCTAAGAAGGAAGAACGTGTCTCTTCCCCTGTCTGCCTCCTGGAATCCAGAAGCCTAAAGGCTTCTTCCTCTTCCTCTTCCTCTTTTCCTCTTTTCCTCTTTTCCTCTTTTCCT
CCTCTTCTTCCTCCTCCTCTTCTTCTTCCTTCTCTTCTTCCTCCTCCTCCTCCTCCTCCTCCCACTGCCTTTCACCAACCTGTGCCACTCCTCCCACCCACCTGCAGCTTCCCTTCAGGAAGAGCCGC
ACACTTACAGTTGCCTTTGGCCTTACCTGTTTTTCCTCCAAGTATGATTCAAGACAAATAAAATATTTTTTCTTGTTCAATTTTA

hide sequence


Protein RefSeqs	NP_001009825	(Get FASTA)	NCBI Sequence Viewer
	XP_008765584	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88868	(Get FASTA)	NCBI Sequence Viewer
	EDL91950	(Get FASTA)	NCBI Sequence Viewer
	EDL91951	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000081944
	ENSRNOP00000081944.1
GenBank Protein	Q5HZV9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009825 ⟸ NM_001009825

- UniProtKB:

Q5HZV9 (UniProtKB/Swiss-Prot), A6JQY6 (UniProtKB/TrEMBL), A0A8I6AM99 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHGGGIVADLSQQSLKDGVERGAEDPEEEHELAVDMETISLDRDAEDVDLNHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLY
DNQIKKIENLEALTELEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRE
LYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF

hide sequence

RefSeq Acc Id:

XP_008765584 ⟸ XM_008767362

- Peptide Label:

isoform X1

- Sequence:

show sequence

MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHGGGIVADLSQQSLKDGVERGAEDPEEEHELAVDMETISLDRDAEDVDLNHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLY
DNQIKKIENLEALTELEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRE
LYLSHNGIEVIEGLENNMANTGIISSVLPIHPGH

hide sequence

Ensembl Acc Id:

ENSRNOP00000081944 ⟸ ENSRNOT00000095497

Ensembl Acc Id:

ENSRNOP00000095250 ⟸ ENSRNOT00000103695

Ensembl Acc Id:

ENSRNOP00000022854 ⟸ ENSRNOT00000022854

Protein Domains

LRRCT U2A'/phosphoprotein 32 family A C-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-R9PXV7-F1-model_v2	AlphaFold	R9PXV7	1-215	view protein structure
AF-Q5HZV9-F1-model_v2	AlphaFold	Q5HZV9	1-360	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-26647	BioCyc
Ensembl Genes	ENSRNOG00000016974	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000095497	ENTREZGENE
	ENSRNOT00000095497.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.80.10.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7321115	IMAGE-MGC_LOAD
InterPro	Cilia_flagella_integrity	UniProtKB/Swiss-Prot
	Leu-rich_rpt	UniProtKB/Swiss-Prot
	Leu-rich_rpt_4	UniProtKB/Swiss-Prot
	Leu-rich_rpt_typical-subtyp	UniProtKB/Swiss-Prot
	LRR_dom_sf	UniProtKB/Swiss-Prot
	U2A'_phosphoprotein32A_C	UniProtKB/Swiss-Prot
KEGG Report	rno:301618	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105784	IMAGE-MGC_LOAD
NCBI Gene	301618	ENTREZGENE
PANTHER	PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT 7	UniProtKB/Swiss-Prot
	PROTEIN PHOSPHATASE 1 REGULATORY SUBUNIT SDS22-RELATED	UniProtKB/Swiss-Prot
Pfam	LRR_4	UniProtKB/Swiss-Prot
	LRR_9	UniProtKB/Swiss-Prot
PhenoGen	Ppp1r7	PhenoGen
PROSITE	LRR	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016974	RatGTEx
SMART	LRR_SD22	UniProtKB/Swiss-Prot
	LRR_TYP	UniProtKB/Swiss-Prot
	LRRcap	UniProtKB/Swiss-Prot
Superfamily-SCOP	L domain-like	UniProtKB/Swiss-Prot
UniProt	A0A8I6AM99	ENTREZGENE, UniProtKB/TrEMBL
	A6JQY6	ENTREZGENE, UniProtKB/TrEMBL
	A6JQY7_RAT	UniProtKB/TrEMBL
	PP1R7_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	R9PXV7_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-10-18	Ppp1r7	protein phosphatase 1, regulatory subunit 7	Ppp1r7	protein phosphatase 1, regulatory (inhibitor) subunit 7	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ppp1r7	protein phosphatase 1, regulatory (inhibitor) subunit 7	Ppp1r7_predicted	protein phosphatase 1, regulatory (inhibitor) subunit 7 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ppp1r7_predicted	protein phosphatase 1, regulatory (inhibitor) subunit 7 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar