Mrps18c (mitochondrial ribosomal protein S18C)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Mrps18c (mitochondrial ribosomal protein S18C) Rattus norvegicus

Analyze

Symbol:

Mrps18c

Name:

mitochondrial ribosomal protein S18C

RGD ID:

1307997

Description:

Predicted to enable small ribosomal subunit rRNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in translation. Predicted to be part of mitochondrial small ribosomal subunit. Orthologous to human MRPS18C (mitochondrial ribosomal protein S18C); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

28S ribosomal protein S18c, mitochondrial; LOC289469

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MRPS18C (mitochondrial ribosomal protein S18C)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Mrps18c (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mrps18c (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MRPS18C (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MRPS18C (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mrps18c (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MRPS18C (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MRPS18C (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mrps18c (mitochondrial ribosomal protein S18C)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RGS1 (regulator of G protein signaling 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	MRPS18C (mitochondrial ribosomal protein S18C)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Mrps18c (mitochondrial ribosomal protein S18C)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mrps18c (mitochondrial ribosomal protein S18C)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mrps-18.C	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RSM18	Alliance	DIOPT (OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	mRpS18C	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mrps18c	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	8,812,301 - 8,818,538 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	8,791,330 - 8,818,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	8,780,210 - 8,786,437 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	10,080,058 - 10,086,285 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	8,776,671 - 8,782,898 (-)	NCBI	Rnor_WKY
Rnor_6.0	14	10,440,691 - 10,446,909 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	10,440,691 - 10,446,909 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	10,388,657 - 10,394,875 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	10,096,209 - 10,102,427 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	10,096,518 - 10,102,420 (-)	NCBI
Celera	14	8,921,339 - 8,927,557 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chromosome 4q21 deletion syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

4-phenylbutyric acid (ISO)

acetamide (EXP)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

crocidolite asbestos (ISO)

cylindrospermopsin (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

epoxiconazole (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

glafenine (EXP)

isobutanol (ISO)

lead(0) (ISO)

lead(2+) (ISO)

leflunomide (EXP,ISO)

lipopolysaccharide (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nefazodone (EXP)

nimesulide (EXP)

oxaliplatin (EXP)

paracetamol (ISO)

phenytoin (EXP)

rac-lactic acid (ISO)

resveratrol (EXP,ISO)

T-2 toxin (ISO)

testosterone (EXP)

tolcapone (EXP)

topotecan (EXP)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

translation (IBA)

Cellular Component

mitochondrial small ribosomal subunit (IBA,ISO)

Molecular Function

small ribosomal subunit rRNA binding (IBA)

structural constituent of ribosome (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11279123	PMID:18614015	PMID:25838379

Genomics

Comparative Map Data

Mrps18c
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	8,812,301 - 8,818,538 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	8,791,330 - 8,818,516 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	8,780,210 - 8,786,437 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	14	10,080,058 - 10,086,285 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	14	8,776,671 - 8,782,898 (-)	NCBI	Rnor_WKY
Rnor_6.0	14	10,440,691 - 10,446,909 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	10,440,691 - 10,446,909 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	10,388,657 - 10,394,875 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	10,096,209 - 10,102,427 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	10,096,518 - 10,102,420 (-)	NCBI
Celera	14	8,921,339 - 8,927,557 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

MRPS18C
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	83,456,058 - 83,462,298 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	4	83,455,932 - 83,469,735 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	84,377,211 - 84,383,451 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	84,596,196 - 84,601,900 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	84,734,350 - 84,740,055	NCBI
Celera	4	81,667,571 - 81,673,381 (+)	NCBI		Celera
Cytogenetic Map	4	q21.23	NCBI
HuRef	4	80,119,893 - 80,125,705 (+)	NCBI		HuRef
CHM1_1	4	84,353,692 - 84,359,503 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	86,786,125 - 86,792,364 (+)	NCBI		T2T-CHM13v2.0

Mrps18c
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	100,946,625 - 100,952,333 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	100,946,493 - 100,952,337 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	100,798,759 - 100,804,467 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	100,798,627 - 100,804,471 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	101,227,778 - 101,233,486 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	101,039,061 - 101,044,769 (+)	NCBI		MGSCv36	mm8
Celera	5	98,126,835 - 98,132,542 (+)	NCBI		Celera
Cytogenetic Map	5	E4	NCBI

Mrps18c
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955474	6,274,545 - 6,280,871 (-)	NCBI	ChiLan1.0	ChiLan1.0

MRPS18C
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	46,777,156 - 46,796,992 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	40,734,852 - 40,740,333 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	46,580,220 - 46,586,823 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	46,580,225 - 46,586,823 (-)	Ensembl	panpan1.1		panPan2

MRPS18C
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	7,290,554 - 7,295,342 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	7,290,584 - 7,298,989 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	34,590,214 - 34,595,093 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	7,312,132 - 7,316,849 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	7,312,119 - 7,316,849 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	7,382,322 - 7,387,107 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	7,251,787 - 7,256,576 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	32,705,130 - 32,710,013 (-)	NCBI		UU_Cfam_GSD_1.0

Mrps18c
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	5,033,401 - 5,062,174 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936738	1,216,237 - 1,224,009 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936738	1,219,210 - 1,223,991 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MRPS18C
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	135,015,413 - 135,026,064 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	135,019,702 - 135,026,719 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	144,316,519 - 144,322,536 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MRPS18C
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	31,847,043 - 31,852,309 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666037	10,442,566 - 10,448,041 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mrps18c
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624900	419,835 - 426,886 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mrps18c
24 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	128
Interacting mature miRNAs:	135
Transcripts:	ENSRNOT00000002962
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
71115	Niddm15	Non-insulin dependent diabetes mellitus QTL 15	4.8		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1217606	11030812	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1217606	16960180	Rat
724541	Niddm53	Non-insulin dependent diabetes mellitus QTL 53		0.001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	3813074	9088978	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	3813074	18274691	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3813074	18274691	Rat
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat

Markers in Region

RH131554

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	8,812,606 - 8,812,870 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	10,440,997 - 10,441,260	NCBI	Rnor6.0
Rnor_5.0	14	10,388,963 - 10,389,226	UniSTS	Rnor5.0
RGSC_v3.4	14	10,096,515 - 10,096,778	UniSTS	RGSC3.4
Celera	14	8,921,645 - 8,921,908	UniSTS
RH 3.4 Map	14	152.28	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001105996	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091667	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ224447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000002962 ⟹ ENSRNOP00000002962

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	8,812,113 - 8,818,516 (-)	Ensembl
Rnor_6.0 Ensembl	14	10,440,691 - 10,446,909 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102099 ⟹ ENSRNOP00000082782

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	8,791,330 - 8,818,516 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110810 ⟹ ENSRNOP00000087564

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	8,792,989 - 8,818,516 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000113506 ⟹ ENSRNOP00000081962

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	8,812,079 - 8,818,516 (-)	Ensembl

RefSeq Acc Id:

NM_001105996 ⟹ NP_001099466

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	8,812,301 - 8,818,520 (-)	NCBI
Rnor_6.0	14	10,440,691 - 10,446,909 (-)	NCBI
Rnor_5.0	14	10,388,657 - 10,394,875 (-)	NCBI
RGSC_v3.4	14	10,096,209 - 10,102,427 (-)	RGD
Celera	14	8,921,339 - 8,927,557 (-)	RGD

Sequence:

show sequence

AACGGAAAGGAAGAGGAAGGGCAGAGAACCATGGCAGGTCTGCTTGCTCTGCGCAGCTGTATAG
GGAGGAAGAACTTGACAACCGCGACTGGCTGCTTCACGGATCGCGCAACTCACGCGGTTTCTGT
GCCATGGAGAAGATGTTTTTCACAGTATGAACAGGTAACCAGCAATGAAGACCTGCCAATCCCA
ATGGAAAACCCCTATAAAGAGCCTCTTAAGAAGTGCGTCTTGTGTGAGAAACGTGTAGATTACA
AGAATGTACAGCTTTTGTCCCAGTTTATTTCTCCATTTACCGGATGCATTTACGGAAGGCACAT
AACAGGTCTTTGTGGGAAGAAGCAGAAGGAAGTGACTAAAGCCATTAAGCGAGCTCAGAAAATG
GGGTTTATGCCAGTTACATACAAGGATCCGGCATATCTCAAAGACCCTAAAGTTTGCAACATCA
GATACCGAGAATAAATTTTGTAAAGTTCCTGCCAATAAGCCTGGGAGTGCTCTTGTCAGCAGAC
TCGGCTCATCTGAGTAGACGTGTCTTTCTGTGGGTTAGGATGAATTAGTCCACCCCAATGAATG
CGCTAGGCAGTGCTTCTGATGGTAATGGATACTGTACACTTTGGTAAAGTGATTCCTCAGGGTT
GTCACAACTTATAGTACAGATTATGGAAGGAGAGGGCTTCTATTAGAATCCCAACCCAGAGCAG
ATTCTGTTCTTATGATGGGATGGTTTTAGGGGAATGGTTCTAGAAAGTCAGAGTGTTTGTTTGA
ATCCCACGTTAACGGCTGTGGCATTAAATTTGCTTGGAGTC

hide sequence

RefSeq Acc Id:

XM_039091667 ⟹ XP_038947595

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	8,812,624 - 8,818,538 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001099466	(Get FASTA)	NCBI Sequence Viewer
	XP_038947595	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL99549	(Get FASTA)	NCBI Sequence Viewer
	EDL99550	(Get FASTA)	NCBI Sequence Viewer
	EDL99551	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001099466 ⟸ NM_001105996
- UniProtKB:	D4A4V1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGLLALRSCIGRKNLTTATGCFTDRATHAVSVPWRRCFSQYEQVTSNEDLPIPMENPYKEPLK KCVLCEKRVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEVTKAIKRAQKMGFMPVTYKDP AYLKDPKVCNIRYRE hide sequence

RefSeq Acc Id:

ENSRNOP00000002962 ⟸ ENSRNOT00000002962

RefSeq Acc Id:	XP_038947595 ⟸ XM_039091667
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000082782 ⟸ ENSRNOT00000102099

RefSeq Acc Id:

ENSRNOP00000081962 ⟸ ENSRNOT00000113506

RefSeq Acc Id:

ENSRNOP00000087564 ⟸ ENSRNOT00000110810

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4V1-F1-model_v2	AlphaFold	D4A4V1	1-143	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699191

Promoter ID:

EPDNEW_R9714

Type:

multiple initiation site

Name:

Mrps18c_1

Description:

mitochondrial ribosomal protein S18C

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	10,446,887 - 10,446,947	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307997	AgrOrtholog
BioCyc Gene	G2FUF-16418	BioCyc
Ensembl Genes	ENSRNOG00000002178	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000002962	ENTREZGENE
	ENSRNOP00000002962.5	UniProtKB/TrEMBL
	ENSRNOP00000081962.1	UniProtKB/TrEMBL
	ENSRNOP00000082782.1	UniProtKB/TrEMBL
	ENSRNOP00000087564.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000002962	ENTREZGENE
	ENSRNOT00000002962.6	UniProtKB/TrEMBL
	ENSRNOT00000102099.1	UniProtKB/TrEMBL
	ENSRNOT00000110810.1	UniProtKB/TrEMBL
	ENSRNOT00000113506.1	UniProtKB/TrEMBL
Gene3D-CATH	4.10.640.10	UniProtKB/TrEMBL
InterPro	Ribosomal_S18	UniProtKB/TrEMBL
	Ribosomal_S18_CS	UniProtKB/TrEMBL
	Ribosomal_S18_sf	UniProtKB/TrEMBL
KEGG Report	rno:289469	UniProtKB/TrEMBL
NCBI Gene	289469	ENTREZGENE
PANTHER	28S RIBOSOMAL PROTEIN S18C, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR13479	UniProtKB/TrEMBL
Pfam	Ribosomal_S18	UniProtKB/TrEMBL
PhenoGen	Mrps18c	PhenoGen
PRINTS	RIBOSOMALS18	UniProtKB/TrEMBL
PROSITE	RIBOSOMAL_S18	UniProtKB/TrEMBL
Superfamily-SCOP	Ribosomal_S18	UniProtKB/TrEMBL
TIGRFAMs	S18	UniProtKB/TrEMBL
UniProt	A0A8I5ZU14_RAT	UniProtKB/TrEMBL
	A0A8I5ZUR8_RAT	UniProtKB/TrEMBL
	A0A8I6A4E4_RAT	UniProtKB/TrEMBL
	D4A4V1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Mrps18c	mitochondrial ribosomal protein S18C	Mrps18c_predicted	mitochondrial ribosomal protein S18C (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Mrps18c_predicted	mitochondrial ribosomal protein S18C (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar