Advanced Search (OLGA)

Gene: 1700013D24Rikl (RIKEN cDNA 1700013D24 gene like) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

1700013D24Rikl (Ensembl: 1700013D24Rik)

Name:

RIKEN cDNA 1700013D24 gene like (Ensembl:RIKEN cDNA 1700013D24 gene)

RGD ID:

1307916

Description:

Type:

protein-coding

RefSeq Status:

PREDICTED

Previously known as:

1700013D24Rik; hypothetical protein LOC362433; LOC362433; RGD1307916; RIKEN cDNA 1700013D24 gene; uncharacterized protein LOC362433

RGD Orthologs

Mouse

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	158,842,940 - 158,928,106 (-)	NCBI		GRCr8
mRatBN7.2	4	157,157,264 - 157,241,805 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,157,264 - 157,232,202 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	163,407,887 - 163,448,330 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,190,794 - 159,231,237 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	157,836,193 - 157,876,636 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	156,824,273 - 156,945,126 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	156,824,273 - 156,945,126 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	223,841,837 - 223,964,250 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	160,468,966 - 160,528,002 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	160,713,901 - 160,772,938 (-)	NCBI
Celera	4	145,933,453 - 145,973,314 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

1700013D24Rikl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	158,842,940 - 158,928,106 (-)	NCBI		GRCr8
mRatBN7.2	4	157,157,264 - 157,241,805 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	157,157,264 - 157,232,202 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	163,407,887 - 163,448,330 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	159,190,794 - 159,231,237 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	157,836,193 - 157,876,636 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	156,824,273 - 156,945,126 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	156,824,273 - 156,945,126 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	223,841,837 - 223,964,250 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	160,468,966 - 160,528,002 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	160,713,901 - 160,772,938 (-)	NCBI
Celera	4	145,933,453 - 145,973,314 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

1700013D24Rik
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	124,324,546 - 124,334,003 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	124,324,546 - 124,334,069 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	124,347,587 - 124,357,044 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	124,347,598 - 124,357,069 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	124,297,611 - 124,307,104 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	124,313,212 - 124,322,641 (-)	NCBI		MGSCv36	mm8
Celera	6	126,037,084 - 126,046,577 (-)	NCBI		Celera
Cytogenetic Map	6	F2	NCBI
cM Map	6	59.14	NCBI

Variants in 1700013D24Rikl
282 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	25
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000064853
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
61446	Coreg2	Compensatory renal growth QTL 2	3.5		kidney mass (VT:0002707)	compensatory renal growth score (CMO:0001894)	4	148423102	157580971	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	26775591	168368347	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
1331802	Srn5	Serum renin concentration QTL 5	3.045		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	4	119428175	157578333	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1581574	Eae20	Experimental allergic encephalomyelitis QTL 20	7.8		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	153031106	158841762	Rat
731178	Oia7	Oil induced arthritis QTL 7		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	156050654	157232313	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat

D4Got136

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	157,232,171 - 157,232,313 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	156,945,430 - 156,945,571	NCBI	Rnor6.0
Rnor_5.0	4	223,964,554 - 223,964,695	UniSTS	Rnor5.0
RGSC_v3.4	4	160,528,306 - 160,528,447	UniSTS	RGSC3.4
RGSC_v3.4	4	160,528,306 - 160,528,447	RGD	RGSC3.4
RGSC_v3.1	4	160,773,242 - 160,773,383	RGD
Celera	4	145,973,618 - 145,973,765	UniSTS
RH 3.4 Map	4	1003.8	UniSTS
RH 3.4 Map	4	1003.8	RGD
Cytogenetic Map	4	q42	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

appendage	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
2	11	3	7	1	4	1	1	8	5	9	26	6


RefSeq Transcripts	NM_001108645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039107891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000064853 ⟹ ENSRNOP00000060617

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	157,157,264 - 157,232,202 (-)	Ensembl
Rnor_6.0 Ensembl	4	156,824,273 - 156,945,126 (-)	Ensembl

RefSeq Acc Id:

NM_001108645 ⟹ NP_001102115

RefSeq Status:

PREDICTED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	158,842,940 - 158,918,172 (-)	NCBI
mRatBN7.2	4	157,157,264 - 157,231,868 (-)	NCBI
Rnor_6.0	4	156,824,273 - 156,945,126 (-)	NCBI
Rnor_5.0	4	223,841,837 - 223,964,250 (-)	NCBI
RGSC_v3.4	4	160,468,966 - 160,528,002 (-)	RGD
Celera	4	145,933,453 - 145,973,314 (-)	RGD

Sequence:

show sequence

ATGGCAGAGATTGAACCAGGGATCAATCTGTTCCCCAATGGCGTCCCTTGGCTCTATGCAGTGTTTGCTATACTCTTTGTGTTCTTCCTTTTTGTCATGTTCTCACCTTTTTTGCTTGAGATAGACCA
GCACATCAAGAAATTCTTTCTCAGATGCCGATGTTCTCTGCGCAATGCTTCCCGTAAGGATAAAGACAGTATTAAGGTGAAGATGAACCATCTGGGAGGGGCAAGAAGTCTCCTTCAGACCCCTGGGA
GAGAAGCTCCAAGAAAAGAGACAACTGGTGGGAGAGAAGACAGCTCAATTCTGGTGGAAATTGTAGGAGAGAGGACCCGGGAAGTCTGCCCAGTGACACCAGTTTGAGGTGACCATATCTGTGAGGTG
TCTTGACATCCCTGTTACAGAAAGATGCTTCAGTGTCATTATTTGTACTTAGGAGAATGTGATAATAAAGATTTTGAGCATCTCAGAAA

hide sequence

RefSeq Acc Id:

XM_039107891 ⟹ XP_038963819

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	158,842,940 - 158,928,106 (-)	NCBI
mRatBN7.2	4	157,157,264 - 157,241,805 (-)	NCBI


Protein RefSeqs	NP_001102115	(Get FASTA)	NCBI Sequence Viewer
	XP_038963819	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01960	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000060617.1

RefSeq Acc Id:	NP_001102115 ⟸ NM_001108645
- UniProtKB:	D3ZKQ5 (UniProtKB/TrEMBL), A6ILI1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEIEPGINLFPNGVPWLYAVFAILFVFFLFVMFSPFLLEIDQHIKKFFLRCRCSLRNASRKDKDSIKVKMNHLGGARSLLQTPGREAPRKETTGGREDSSILVEIVGERTREVCPVTPV hide sequence

Ensembl Acc Id:

ENSRNOP00000060617 ⟸ ENSRNOT00000064853

RefSeq Acc Id:	XP_038963819 ⟸ XM_039107891
- Peptide Label:	isoform X1

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZKQ5-F1-model_v2	AlphaFold	D3ZKQ5	1-120	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13693377

Promoter ID:

EPDNEW_R3902

Type:

multiple initiation site

Name:

RGD1307916_1

Description:

LOC362433

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	156,945,156 - 156,945,216	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-43111	BioCyc
Ensembl Genes	ENSRNOG00000042494	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064853.2	UniProtKB/TrEMBL
KEGG Report	rno:362433	UniProtKB/TrEMBL
NCBI Gene	362433	ENTREZGENE
PhenoGen	1700013D24Rikl	PhenoGen
RatGTEx	ENSRNOG00000042494	RatGTEx
UniProt	A6ILI1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZKQ5	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2025-02-06	1700013D24Rikl	RIKEN cDNA 1700013D24 gene like	1700013D24Rik	RIKEN cDNA 1700013D24 gene	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2023-01-12	1700013D24Rik	RIKEN cDNA 1700013D24 gene	RGD1307916	LOC362433	Name and Symbol changed	629549	APPROVED
2008-04-30	RGD1307916	LOC362433	RGD1307916_predicted	LOC362433 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-20	RGD1307916_predicted	LOC362433 (predicted)	LOC362433_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC362433_predicted	LOC362433 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message