Tapbpl (TAP binding protein-like)

Gene: Tapbpl (TAP binding protein-like) Rattus norvegicus

Analyze

Symbol:

Tapbpl

Name:

TAP binding protein-like

RGD ID:

1307893

Description:

Predicted to enable MHC class I protein complex binding activity and TAP complex binding activity. Predicted to be involved in negative regulation of antigen processing and presentation of peptide antigen via MHC class I and peptide antigen assembly with MHC class I protein complex. Predicted to be located in endoplasmic reticulum. Predicted to be part of MHC class I peptide loading complex. Orthologous to human TAPBPL (TAP binding protein like); INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC297602; tapasin-related protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TAPBPL (TAP binding protein like)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Tapbpl (TAP binding protein-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tapbpl (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TAPBPL (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TAPBPL (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tapbpl (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TAPBPL (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TAPBPL (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tapbpl (TAP binding protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TAPBPL (TAP binding protein like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Tapbpl (TAP binding protein-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tapbpl (TAP binding protein (tapasin)-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,707,686 - 159,715,137 (-)	NCBI		GRCr8
mRatBN7.2	4	158,021,454 - 158,028,905 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,250,681 - 164,258,126 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	160,033,597 - 160,041,042 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,669,627 - 158,677,062 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,735,748 - 157,743,199 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,735,748 - 157,743,199 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	224,752,544 - 224,759,995 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	161,342,551 - 161,350,002 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	161,587,486 - 161,594,659 (-)	NCBI
Celera	4	146,758,550 - 146,765,999 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

congenital myasthenic syndrome (ISO)

Congenital Myasthenic Syndrome 25 (ISO)

genetic disease (ISO)

Hyperphosphatemic Familial Tumoral Calcinosis 1 (ISO)

lymphoproliferative syndrome 2 (ISO)

Marfanoid Mental Retardation Syndrome, Autosomal (ISO)

paraplegia (ISO)

peroxisome biogenesis disorder 2B (ISO)

spastic ataxia 1 (ISO)

Temtamy syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (ISO)

2,4-dinitrobenzenesulfonic acid (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

amiodarone (ISO)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

doxorubicin (ISO)

entinostat (ISO)

fenthion (ISO)

folic acid (ISO)

fulvestrant (ISO)

indometacin (ISO)

Licochalcone B (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

propanal (ISO)

silicon dioxide (ISO)

sotorasib (ISO)

sunitinib (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

titanium dioxide (ISO)

trametinib (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of antigen processing and presentation of peptide antigen via MHC class I (ISO)

peptide antigen assembly with MHC class I protein complex (ISO)

Cellular Component

endoplasmic reticulum (ISO)

Molecular Function

MHC class I protein complex binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:23401559	PMID:26869717

Genomics

Comparative Map Data

Tapbpl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	159,707,686 - 159,715,137 (-)	NCBI		GRCr8
mRatBN7.2	4	158,021,454 - 158,028,905 (-)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	4	164,250,681 - 164,258,126 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	160,033,597 - 160,041,042 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	158,669,627 - 158,677,062 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	157,735,748 - 157,743,199 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	157,735,748 - 157,743,199 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	224,752,544 - 224,759,995 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	161,342,551 - 161,350,002 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	161,587,486 - 161,594,659 (-)	NCBI
Celera	4	146,758,550 - 146,765,999 (-)	NCBI		Celera
Cytogenetic Map	4	q42	NCBI

TAPBPL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	6,451,649 - 6,472,006 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	6,451,690 - 6,466,517 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	6,560,815 - 6,571,482 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	6,431,438 - 6,441,749 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	6,431,510 - 6,441,721	NCBI
Celera	12	8,178,068 - 8,188,377 (+)	NCBI		Celera
Cytogenetic Map	12	p13.31	NCBI
HuRef	12	6,415,366 - 6,425,677 (+)	NCBI		HuRef
CHM1_1	12	6,560,055 - 6,570,362 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	6,462,036 - 6,482,343 (+)	NCBI		T2T-CHM13v2.0

Tapbpl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	125,200,890 - 125,208,823 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	125,200,896 - 125,208,823 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	125,223,927 - 125,231,860 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	125,223,933 - 125,231,860 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	125,174,223 - 125,181,878 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	125,189,824 - 125,197,479 (-)	NCBI		MGSCv36	mm8
Celera	6	126,894,009 - 126,901,659 (-)	NCBI		Celera
Cytogenetic Map	6	F3	NCBI
cM Map	6	59.32	NCBI

Tapbpl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955413	4,108,052 - 4,115,760 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955413	4,108,044 - 4,116,413 (+)	NCBI	ChiLan1.0	ChiLan1.0

TAPBPL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	12,013,232 - 12,023,725 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	12,009,983 - 12,020,499 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	6,582,266 - 6,592,762 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	6,499,353 - 6,509,844 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	6,499,429 - 6,509,844 (+)	Ensembl	panpan1.1		panPan2

TAPBPL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	38,526,968 - 38,534,585 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	27	38,526,528 - 38,535,937 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	8,081,961 - 8,090,370 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	38,880,017 - 38,888,441 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	38,880,015 - 38,888,935 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	38,752,794 - 38,761,215 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	38,794,215 - 38,802,639 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	7,560,857 - 7,569,264 (+)	NCBI		UU_Cfam_GSD_1.0

Tapbpl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	102,637,913 - 102,645,679 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936709	1,304,971 - 1,313,770 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936709	1,304,843 - 1,313,191 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TAPBPL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	64,188,179 - 64,197,264 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	64,188,184 - 64,197,033 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	66,649,711 - 66,658,562 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TAPBPL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	6,500,157 - 6,510,777 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	6,499,614 - 6,515,027 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	1,721,253 - 1,732,270 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tapbpl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624860	3,205,093 - 3,211,584 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624860	3,203,683 - 3,211,901 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tapbpl
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	45
Count of miRNA genes:	40
Interacting mature miRNAs:	42
Transcripts:	ENSRNOT00000038178
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	109866907	167139601	Rat
1331759	Hrtrt13	Heart rate QTL 13	3.54628		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	110275411	168266883	Rat
12798519	Anxrr54	Anxiety related response QTL 54	2.54	0.05	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	114627026	159627026	Rat
724535	Cm18	Cardiac mass QTL 18	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	4	118856416	163856416	Rat
634347	Hcar8	Hepatocarcinoma resistance QTL 8	5.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	123143783	168143783	Rat
631683	Bp116	Blood pressure QTL 116		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	124303370	169303370	Rat
6478778	Anxrr51	Anxiety related response QTL 51		0.25384	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	124778595	169778595	Rat
7411558	Bw133	Body weight QTL 133	13.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	125590636	170590636	Rat
61451	Ciaa4	CIA Autoantibody QTL 4	3.1		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	4	126395976	167139601	Rat
737978	Pia23	Pristane induced arthritis QTL 23	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
631511	Pia7	Pristane induced arthritis QTL 7	4.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	131730738	167139601	Rat
1549827	Scl46	Serum cholesterol level QTL 46	3.5		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	132396220	177396220	Rat
724558	Plsm2	Polydactyly-luxate syndrome (PLS) morphotypes QTL 2		0.0003	hindlimb integrity trait (VT:0010563)	hind foot phalanges count (CMO:0001949)	4	132422778	177422778	Rat
61422	Cia13	Collagen induced arthritis QTL 13	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	132642577	167139601	Rat
2303623	Vencon2	Ventilatory control QTL 2	3.8		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	4	135204660	180204660	Rat
1578674	Bmd12	Bone mineral density QTL 12	3.8		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	4	135699135	180699135	Rat
2293659	Bmd35	Bone mineral density QTL 35	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	4	137755016	181392681	Rat
61362	Oia2	Oil induced arthritis QTL 2		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1298524	Oia8	Oil induced arthritis QTL 8			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	138503169	173369699	Rat
1331738	Bp209	Blood pressure QTL 209	2.979		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	138503169	179293946	Rat
6478718	Anxrr34	Anxiety related response QTL 34		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478748	Anxrr42	Anxiety related response QTL 42		0.28008	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
6478754	Anxrr43	Anxiety related response QTL 43		0.14035	locomotor behavior trait (VT:0001392)	distance moved per unit of time into, out of or within a discrete space in an experimental apparatus (CMO:0001493)	4	144639524	182687754	Rat
6478693	Anxrr32	Anxiety related response QTL 32		0.00092	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	4	144639524	182687754	Rat
6478700	Anxrr33	Anxiety related response QTL 33		0.00896	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	144639524	182687754	Rat
10401796	Kidm48	Kidney mass QTL 48			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	145568712	182687754	Rat
634342	Cia24	Collagen induced arthritis QTL 24	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	146565735	175236377	Rat
12798525	Anxrr57	Anxiety related response QTL 57	3.21	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	147278504	167139601	Rat
1582237	Kidm34	Kidney mass QTL 34	4	0.0001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	4	148090542	168069246	Rat
1581574	Eae20	Experimental allergic encephalomyelitis QTL 20	7.8		nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	153031106	158841762	Rat
10053718	Scort25	Serum corticosterone level QTL 25	2.15	0.0097	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	155561574	182687754	Rat
1581566	Eae21	Experimental allergic encephalomyelitis QTL 21	6.2		body mass (VT:0001259)	maximum body weight loss to initial body weight ratio (CMO:0001400)	4	157680158	158841762	Rat
1300109	Rf13	Renal function QTL 13	3.91		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	4	157710145	182687754	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	6	49	33	19	33			6	13	29	11
Low		37	8	8		8	8	11	68	22	12		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000038178 ⟹ ENSRNOP00000038874

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	4	157,735,748 - 157,743,199 (-)	Ensembl

RefSeq Acc Id:

NM_001106622 ⟹ NP_001100092

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	159,707,686 - 159,715,137 (-)	NCBI
mRatBN7.2	4	158,021,454 - 158,028,905 (-)	NCBI
Rnor_6.0	4	157,735,748 - 157,743,199 (-)	NCBI
Rnor_5.0	4	224,752,544 - 224,759,995 (-)	NCBI
RGSC_v3.4	4	161,342,551 - 161,350,002 (-)	RGD
Celera	4	146,758,550 - 146,765,999 (-)	RGD

Sequence:

show sequence

AATCTATCTTCTGGCTCCACCCTCTCTCCAGCCTTCTCATAGTTGGGGCTGATGGGAAACCTGA
TGTGGTGATACCAGCTTTTGAAACCTTCTGGGGATTTCTTGGGTGCAGGGTGGACAAAAGGGAG
TACCGGGAGCAGAGTTCTGGCTACTGCTGTTTCTGGCCTCGGGTCACAGAGGCAGTTGAAGTGA
AAGCGAAAGAGAAACCAGTAAGAACAGAGAACACAGGTACTAAGTGAGGCTGCTCAAAGAACCC
CCTCTTCAGCCAGAGATCTCTAGCAGGGGAACTGTGGAGAAGGCAGCCAGCGAGGAATCGCCCG
AGAGCAGCCTCCATGGGCTGGGAGCCCAGCTGGTGTCTGCTGCTCTGTTTGGCTGTCTCTGGGG
CGGCAGGGACTGACCCCCCGACAGAAGAAAGACGGTGGCAGGCCGTGGACATCGTCTTAGACTG
CTTCTTGGTGACAGAAGACAAGCATCGCGGGGCTTTTGGCAGCAGTGAGGACAGGGAGAAGGCC
CTGCTTGTACTGAAGCAGGTGCCGGTGCTGGATGATGGTTCCCTGGAGGGCTTCACAGATTTCC
AAGGGAGCGCAGAGGCCAGACAAGATTCACCGATTATCTTTGAGGCGTCCGTGGACTTGGTACA
GATTCCCCAGGCAGAGGCTTTGCTCCACGCTGACTGCAGCGGGAAGGCGGTGACCTGTGAGATC
GCCCAGTATTTCCTCCAGGCCAGACAAGAGGCCACTTTTGAGAAAGCAGATTGGTTCATCAGCA
ACATGCAGGTTTCTAGAGGGGGGCCCAGTGTCTCCATAGTGATGAAGACTCTAAGAGATGATGA
AGCTGGAGCTGTCCGGCACCCTTCGCTGAACATACCCCTGAGCCCCCAGGGCACAGTGAAGACT
AAAGTGGAGTTCCAGGTGACAGCAGAGACCCAAACCCTGAATCAGCTGCTGGGGTCCTCTGTGT
CCCTGCCCTGCAGGTTCTCCATGGCACCAGGCCTGGACCTCACCGGCGTGGAATGGAGGCTACA
GCATAAAGGCAGTGGCCAGCTGGTGTACAGCTGGAAGACAGGGCAGGGGCAGGCTAAGCGCAAG
GGCGCTACGCTGAAGCCTGAGAAGCTCCTCAGGGCGGGAGATGCCTCTCTCACCTTACCCAACC
TCACTCTGAAGGATGAGGGGAACTATATCTGCCAGATCTCTACCTCTCTGTACCAAGCCCAGCA
GATCGTGCCGCTTAACATCCTAGCTTCCCCCAAAGTACAGCTGATCTTGGCAAACAAGGATCCA
CTGCCCTCCCTCATCTGCAGCATTGCTGGCTACTACCCTCTGGATGTGGTGGTGACGTGGATTC
GAGAAGAGCTGGGTGGAATTCCAGCCCAAGTCTCTGGTGCCTCCTTCTCCAGCCTCAGACAGAA
CATGATGGGAACCTACAGCATTTCTTCCACGGTGACAGCCGAGCCAGGCCCCACAGGTGCCACT
TACACCTGCCAAGTTGCCCACGTCTCCCTGGAGGAGCCCCTGACAGTCAGCATGAGGGTTTTGC
CAAACACAGAGCAAAGAGGAGCCTTGGGAGTCATCGTTGCCAGCATCCTCTTCCTTTTTGCGCT
CTTGCTCCTGGGACTTCATAGACAGCAAGCTTCATCATCAAAGTCCACCAAGTCTGTGAGGCAC
TCTGAGTAGCCGCTTTCCTGCCTCCGAGTACAAAGAAAAGCTCTCGTGTTCTAGCTACCTAAGA
ACCCTGTGTTGAGGTGTGGGACTGAGACGGGCCTGAAGGAGGCAGCACATTGGGAGTGAGGTAC
TGACCCTGGTCTGTACTAGTCTCTGCCTTCCTGTATTATAGAGAAGAGAACCCTGGGCTGATGA
AAGGAACGGGACAAGAGATGTTTAGAAATG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100092	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01857	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001100092 ⟸ NM_001106622
- Peptide Label:	precursor
- UniProtKB:	A6ILT2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGWEPSWCLLLCLAVSGAAGTDPPTEERRWQAVDIVLDCFLVTEDKHRGAFGSSEDREKALLVL KQVPVLDDGSLEGFTDFQGSAEARQDSPIIFEASVDLVQIPQAEALLHADCSGKAVTCEIAQYF LQARQEATFEKADWFISNMQVSRGGPSVSIVMKTLRDDEAGAVRHPSLNIPLSPQGTVKTKVEF QVTAETQTLNQLLGSSVSLPCRFSMAPGLDLTGVEWRLQHKGSGQLVYSWKTGQGQAKRKGATL KPEKLLRAGDASLTLPNLTLKDEGNYICQISTSLYQAQQIVPLNILASPKVQLILANKDPLPSL ICSIAGYYPLDVVVTWIREELGGIPAQVSGASFSSLRQNMMGTYSISSTVTAEPGPTGATYTCQ VAHVSLEEPLTVSMRVLPNTEQRGALGVIVASILFLFALLLLGLHRQQASSSKSTKSVRHSE hide sequence

RefSeq Acc Id:

ENSRNOP00000038874 ⟸ ENSRNOT00000038178

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A6L1-F1-model_v2	AlphaFold	D4A6L1	1-446	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693407

Promoter ID:

EPDNEW_R3932

Type:

multiple initiation site

Name:

Tapbpl_2

Description:

TAP binding protein-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R3933

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	157,742,988 - 157,743,048	EPDNEW

RGD ID:

13693408

Promoter ID:

EPDNEW_R3933

Type:

initiation region

Name:

Tapbpl_1

Description:

TAP binding protein-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R3932

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	4	157,743,134 - 157,743,194	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1307893	AgrOrtholog
BioCyc Gene	G2FUF-43003	BioCyc
Ensembl Genes	ENSRNOG00000027552	Ensembl
Gene3D-CATH	Immunoglobulins	UniProtKB/TrEMBL
InterPro	Ig-like_dom	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig/MHC_CS	UniProtKB/TrEMBL
	Ig_C1-set	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
KEGG Report	rno:297602	UniProtKB/TrEMBL
NCBI Gene	297602	ENTREZGENE
PANTHER	TAPASIN	UniProtKB/TrEMBL
	TAPASIN-RELATED PROTEIN	UniProtKB/TrEMBL
Pfam	C1-set	UniProtKB/TrEMBL
	V-set	UniProtKB/TrEMBL
PhenoGen	Tapbpl	PhenoGen
PROSITE	IG_LIKE	UniProtKB/TrEMBL
	IG_MHC	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027552	RatGTEx
SMART	IGc1	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
Superfamily-SCOP	Immunoglobulin	UniProtKB/TrEMBL
UniProt	A6ILT2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Tapbpl	TAP binding protein-like	Tapbpl_predicted	TAP binding protein-like (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Tapbpl_predicted	TAP binding protein-like (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar