Symbol:
U2surp
Name:
U2 snRNP-associated SURP domain containing
RGD ID:
1307882
Description:
Predicted to enable RNA binding activity. Predicted to be involved in RNA processing. Predicted to be located in nucleoplasm. Predicted to be part of U2 snRNP. Predicted to be active in nucleus. Orthologous to human U2SURP (U2 snRNP associated SURP domain containing); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC315903; RGD1307882; similar to CG9346-PA
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
U2surp-ps1
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 104,898,580 - 104,963,642 (-) NCBI GRCr8 mRatBN7.2 8 96,018,932 - 96,075,795 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 96,022,957 - 96,075,691 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 8 103,242,095 - 103,299,082 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 103,246,558 - 103,298,927 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 102,700,388 - 102,757,363 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 100,558,095 - 100,611,422 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 100,578,138 - 100,630,883 (-) NCBI Celera 8 95,468,620 - 95,526,050 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
U2surp Rat (-)-demecolcine decreases expression ISO RGD:4892414 6480464 Demecolcine results in decreased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat (-)-demecolcine increases expression ISO RGD:4892414 6480464 Demecolcine results in increased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat (S)-nicotine increases expression ISO RGD:4892414 6480464 Nicotine results in increased expression of U2SURP mRNA CTD PMID:16949557 U2surp Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:4892414 6480464 Tetrachlorodibenzodioxin results in decreased expression of SR140 mRNA; Tetrachlorodibenzodioxin results in decreased expression of U2SURP more ... CTD PMID:20106945|PMID:21632981 U2surp Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of U2SURP mRNA CTD PMID:34747641 U2surp Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1332539 6480464 Tetrachlorodibenzodioxin affects the expression of U2SURP mRNA CTD PMID:24680724 U2surp Rat 2-methylcholine affects expression ISO RGD:4892414 6480464 beta-methylcholine affects the expression of SR140 mRNA CTD PMID:21179406 U2surp Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of U2SURP protein CTD PMID:34915118 U2surp Rat 5-fluorouracil decreases expression ISO RGD:4892414 6480464 Fluorouracil results in decreased expression of U2SURP mRNA CTD PMID:16510598 U2surp Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of U2SURP mRNA CTD PMID:30047161 U2surp Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of U2SURP mRNA CTD PMID:28959563 U2surp Rat aflatoxin B1 decreases expression ISO RGD:4892414 6480464 Aflatoxin B1 results in decreased expression of U2SURP mRNA CTD PMID:21641981 U2surp Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of U2SURP mRNA CTD PMID:30047161 U2surp Rat antirheumatic drug increases expression ISO RGD:4892414 6480464 Antirheumatic Agents results in increased expression of SR140 mRNA CTD PMID:24449571 U2surp Rat aristolochic acid A decreases expression ISO RGD:4892414 6480464 aristolochic acid I results in decreased expression of U2SURP mRNA CTD PMID:33212167 U2surp Rat benzo[a]pyrene increases methylation ISO RGD:4892414 6480464 Benzo(a)pyrene results in increased methylation of SR140 3' UTR CTD PMID:27901495 U2surp Rat benzo[a]pyrene decreases methylation ISO RGD:1332539 6480464 Benzo(a)pyrene results in decreased methylation of U2SURP intron CTD PMID:27901495 U2surp Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:4892414 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of U2SURP mRNA CTD PMID:19150397|PMID:26238291 U2surp Rat beta-lapachone decreases expression ISO RGD:4892414 6480464 beta-lapachone results in decreased expression of U2SURP mRNA CTD PMID:38218311 U2surp Rat bis(2-ethylhexyl) phthalate decreases expression ISO RGD:1332539 6480464 Diethylhexyl Phthalate results in decreased expression of U2SURP mRNA CTD PMID:33754040 U2surp Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of U2SURP mRNA CTD PMID:25181051 U2surp Rat bisphenol A decreases expression ISO RGD:4892414 6480464 bisphenol A results in decreased expression of U2SURP protein CTD PMID:37567409 U2surp Rat bisphenol A decreases methylation ISO RGD:4892414 6480464 bisphenol A results in decreased methylation of U2SURP gene CTD PMID:31601247 U2surp Rat bisphenol A increases expression ISO RGD:4892414 6480464 bisphenol A results in increased expression of U2SURP mRNA CTD PMID:33670352 U2surp Rat bisphenol A decreases expression ISO RGD:1332539 6480464 bisphenol A results in decreased expression of U2SURP mRNA CTD PMID:33221593 U2surp Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of U2SURP mRNA CTD PMID:30816183|PMID:34947998 U2surp Rat bisphenol AF increases expression ISO RGD:4892414 6480464 bisphenol AF results in increased expression of U2SURP protein CTD PMID:34186270 U2surp Rat Bisphenol B increases expression ISO RGD:4892414 6480464 bisphenol B results in increased expression of U2SURP protein CTD PMID:34186270 U2surp Rat bisphenol F increases expression ISO RGD:4892414 6480464 bisphenol F results in increased expression of U2SURP protein CTD PMID:34186270 U2surp Rat butanal decreases expression ISO RGD:4892414 6480464 butyraldehyde results in decreased expression of SR140 mRNA CTD PMID:26079696 U2surp Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of U2SURP mRNA CTD PMID:19167457 U2surp Rat caffeine affects phosphorylation ISO RGD:4892414 6480464 Caffeine affects the phosphorylation of U2SURP protein CTD PMID:35688186 U2surp Rat carbon nanotube decreases expression ISO RGD:1332539 6480464 Nanotubes, Carbon results in decreased expression of U2SURP mRNA CTD PMID:25620056 U2surp Rat chlorpyrifos decreases expression ISO RGD:1332539 6480464 Chlorpyrifos results in decreased expression of U2SURP mRNA CTD PMID:37019170 U2surp Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of U2SURP mRNA CTD PMID:30047161 U2surp Rat crocidolite asbestos decreases expression ISO RGD:4892414 6480464 Asbestos, Crocidolite results in decreased expression of U2SURP mRNA CTD PMID:29523930 U2surp Rat DDE increases expression ISO RGD:4892414 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of U2SURP mRNA CTD PMID:38568856 U2surp Rat Dibutyl phosphate affects expression ISO RGD:4892414 6480464 di-n-butylphosphoric acid affects the expression of U2SURP mRNA CTD PMID:37042841 U2surp Rat enzyme inhibitor multiple interactions ISO RGD:4892414 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 U2surp Rat ethyl methanesulfonate decreases expression ISO RGD:4892414 6480464 Ethyl Methanesulfonate results in decreased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of U2SURP mRNA CTD PMID:24136188 U2surp Rat formaldehyde decreases expression ISO RGD:4892414 6480464 Formaldehyde results in decreased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat FR900359 affects phosphorylation ISO RGD:4892414 6480464 FR900359 affects the phosphorylation of U2SURP protein CTD PMID:37730182 U2surp Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of U2SURP mRNA CTD PMID:33387578 U2surp Rat hinokiflavone increases sumoylation ISO RGD:4892414 6480464 hinokiflavone results in increased sumoylation of U2SURP protein CTD PMID:28884683 U2surp Rat indometacin decreases expression ISO RGD:4892414 6480464 Indomethacin results in decreased expression of U2SURP mRNA CTD PMID:16984733 U2surp Rat ivermectin decreases expression ISO RGD:4892414 6480464 Ivermectin results in decreased expression of U2SURP protein CTD PMID:32959892 U2surp Rat ketamine decreases expression EXP 6480464 Ketamine results in decreased expression of U2SURP mRNA CTD PMID:20080153 U2surp Rat mercury dichloride decreases expression ISO RGD:4892414 6480464 Mercuric Chloride results in decreased expression of U2SURP mRNA CTD PMID:27188386 U2surp Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of U2SURP mRNA CTD PMID:30467583 U2surp Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of U2SURP mRNA CTD PMID:30047161 U2surp Rat methyl methanesulfonate decreases expression ISO RGD:4892414 6480464 Methyl Methanesulfonate results in decreased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat methylmercury chloride decreases expression ISO RGD:4892414 6480464 methylmercuric chloride results in decreased expression of U2SURP mRNA CTD PMID:28001369 U2surp Rat methylparaben decreases expression ISO RGD:4892414 6480464 methylparaben results in decreased expression of U2SURP mRNA CTD PMID:31745603 U2surp Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:4892414 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of U2SURP mRNA CTD PMID:38685446 U2surp Rat nickel dichloride decreases expression ISO RGD:4892414 6480464 nickel chloride results in decreased expression of SR140 mRNA CTD PMID:17312168 U2surp Rat nicotine increases expression ISO RGD:4892414 6480464 Nicotine results in increased expression of U2SURP mRNA CTD PMID:16949557 U2surp Rat paracetamol decreases expression ISO RGD:4892414 6480464 Acetaminophen results in decreased expression of U2SURP mRNA CTD PMID:21420995 U2surp Rat pentanal decreases expression ISO RGD:4892414 6480464 pentanal results in decreased expression of SR140 mRNA CTD PMID:26079696 U2surp Rat perfluorooctane-1-sulfonic acid multiple interactions ISO RGD:1332539 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of U2SURP mRNA CTD PMID:36331819 U2surp Rat phenobarbital decreases expression ISO RGD:1332539 6480464 Phenobarbital results in decreased expression of U2SURP mRNA CTD PMID:23091169 U2surp Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of U2SURP mRNA CTD PMID:30047161 U2surp Rat sunitinib increases expression ISO RGD:4892414 6480464 Sunitinib results in increased expression of U2SURP mRNA CTD PMID:31533062 U2surp Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of U2SURP mRNA CTD PMID:33387578 U2surp Rat trichostatin A increases expression ISO RGD:4892414 6480464 trichostatin A results in increased expression of SR140 mRNA CTD PMID:24935251 U2surp Rat triphenyl phosphate affects expression ISO RGD:4892414 6480464 triphenyl phosphate affects the expression of U2SURP mRNA CTD PMID:37042841 U2surp Rat troglitazone decreases expression ISO RGD:1332539 6480464 troglitazone results in decreased expression of U2SURP mRNA CTD PMID:28973697 U2surp Rat tungsten decreases expression ISO RGD:1332539 6480464 Tungsten results in decreased expression of U2SURP mRNA CTD PMID:30912803 U2surp Rat valproic acid affects expression ISO RGD:4892414 6480464 Valproic Acid affects the expression of U2SURP mRNA CTD PMID:25979313 U2surp Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of U2SURP mRNA CTD PMID:29427782 U2surp Rat valproic acid decreases expression ISO RGD:4892414 6480464 Valproic Acid results in decreased expression of U2SURP mRNA CTD PMID:23179753|PMID:27188386|PMID:28001369 U2surp Rat vincristine increases expression ISO RGD:4892414 6480464 Vincristine results in increased expression of U2SURP mRNA CTD PMID:23649840 U2surp Rat vorinostat decreases expression ISO RGD:4892414 6480464 vorinostat results in decreased expression of U2SURP mRNA CTD PMID:27188386 U2surp Rat Yessotoxin decreases expression ISO RGD:4892414 6480464 yessotoxin analog results in decreased expression of U2SURP mRNA CTD PMID:30679557
Imported Annotations - KEGG (archival)
U2surp Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 104,898,580 - 104,963,642 (-) NCBI GRCr8 mRatBN7.2 8 96,018,932 - 96,075,795 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 96,022,957 - 96,075,691 (-) Ensembl mRatBN7.2 Ensembl Rnor_6.0 8 103,242,095 - 103,299,082 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 103,246,558 - 103,298,927 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 102,700,388 - 102,757,363 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 100,558,095 - 100,611,422 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 100,578,138 - 100,630,883 (-) NCBI Celera 8 95,468,620 - 95,526,050 (-) NCBI Celera Cytogenetic Map 8 q31 NCBI
U2SURP Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 143,001,570 - 143,060,725 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 142,964,497 - 143,060,725 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 142,720,412 - 142,779,567 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 144,203,062 - 144,262,257 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 141,143,870 - 141,202,968 (+) NCBI Celera Cytogenetic Map 3 q23 NCBI HuRef 3 140,093,023 - 140,151,897 (+) NCBI HuRef CHM1_1 3 142,683,499 - 142,742,425 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 145,748,812 - 145,808,123 (+) NCBI T2T-CHM13v2.0
U2surp Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 95,338,947 - 95,394,049 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 95,338,951 - 95,394,049 (-) Ensembl GRCm39 Ensembl GRCm38 9 95,456,894 - 95,511,996 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 95,456,898 - 95,511,996 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 95,357,313 - 95,412,415 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 95,270,329 - 95,321,348 (-) NCBI MGSCv36 mm8 Celera 9 95,019,827 - 95,074,865 (-) NCBI Celera Cytogenetic Map 9 E3.3 NCBI cM Map 9 50.11 NCBI
U2surp Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955508 2,880,638 - 2,931,146 (-) NCBI ChiLan1.0 ChiLan1.0
U2SURP Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 140,910,006 - 140,970,204 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 140,914,754 - 140,974,574 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 140,035,004 - 140,092,852 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 147,626,911 - 147,683,958 (+) NCBI panpan1.1 PanPan1.1 panPan2
U2SURP Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 38,596,544 - 38,646,784 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 38,596,643 - 38,646,401 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 38,522,273 - 38,576,356 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 39,128,392 - 39,179,063 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 39,128,490 - 39,179,495 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 38,811,868 - 38,862,506 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 38,892,825 - 38,946,901 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 39,130,982 - 39,185,239 (+) NCBI UU_Cfam_GSD_1.0
U2surp Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 77,856,173 - 77,913,938 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936540 4,595,385 - 4,645,088 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936540 4,595,316 - 4,645,490 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
U2SURP Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 83,704,587 - 83,759,971 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 83,704,501 - 83,759,800 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 91,478,493 - 91,531,522 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
U2SURP Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 47,573,425 - 47,630,634 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 47,572,403 - 47,630,611 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 20,505,636 - 20,563,228 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
U2surp
.
Predicted Target Of
Count of predictions: 69 Count of miRNA genes: 56 Interacting mature miRNAs: 57 Transcripts: ENSRNOT00000011609, ENSRNOT00000046873 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 738011 Anxrr9 Anxiety related response QTL 9 6.1 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 8 93535351 123900184 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 738014 Anxrr15 Anxiety related response QTL 15 3.6 0.005 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 95718998 123900184 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358903 Bp252 Blood pressure QTL 252 7 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300182 Bmd56 Bone mineral density QTL 56 5.4 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 95718998 123900184 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 1358893 Bp263 Blood pressure QTL 263 5.01 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 93965141 123900184 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
BF386191
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 96,076,084 - 96,076,247 (+) MAPPER mRatBN7.2 Rnor_6.0 8 103,299,342 - 103,299,504 NCBI Rnor6.0 Rnor_5.0 8 102,757,635 - 102,757,797 UniSTS Rnor5.0 RGSC_v3.4 8 100,611,709 - 100,611,871 UniSTS RGSC3.4 Celera 8 95,526,360 - 95,526,522 UniSTS RH 3.4 Map 8 1055.5 UniSTS Cytogenetic Map 8 q31 UniSTS
D15S984
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 96,075,309 - 96,076,004 (+) MAPPER mRatBN7.2 Rnor_6.0 8 103,298,567 - 103,299,261 NCBI Rnor6.0 Rnor_5.0 8 102,756,860 - 102,757,554 UniSTS Rnor5.0 RGSC_v3.4 8 100,610,934 - 100,611,628 UniSTS RGSC3.4 Celera 8 95,525,585 - 95,526,279 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000011609 ⟹ ENSRNOP00000011609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 96,022,957 - 96,075,691 (-) Ensembl Rnor_6.0 Ensembl 8 103,246,558 - 103,298,927 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000046873 ⟹ ENSRNOP00000048365
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 96,023,288 - 96,075,678 (-) Ensembl Rnor_6.0 Ensembl 8 103,246,558 - 103,298,927 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000116411 ⟹ ENSRNOP00000083935
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 96,022,957 - 96,075,691 (-) Ensembl
RefSeq Acc Id:
XM_002729954 ⟹ XP_002730000
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,955,436 (-) NCBI mRatBN7.2 8 96,022,955 - 96,075,789 (-) NCBI Rnor_6.0 8 103,242,095 - 103,299,028 (-) NCBI Rnor_5.0 8 102,700,388 - 102,757,363 (-) NCBI RGSC_v3.4 8 100,558,095 - 100,611,422 (-) RGD
Sequence:
CTGGGCCTGGCAGGCTTCTGGCGCGCTCCGCTGATATCTGTTCTTTCGGTGCTCGACTCACCCGCGCTGCTGCCTCCGCTGAAGGAGGAGCAAAGCTCAAGATGGCCGACAAAACGCCAGGCGGATCT
hide sequence
RefSeq Acc Id:
XM_006243554 ⟹ XP_006243616
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,963,642 (-) NCBI mRatBN7.2 8 96,022,955 - 96,075,786 (-) NCBI Rnor_6.0 8 103,242,095 - 103,299,032 (-) NCBI Rnor_5.0 8 102,700,388 - 102,757,363 (-) NCBI
Sequence:
GCTACTGGGCCTGGCAGGCTTCTGGCGCGCTCCGCTGATATCTGTTCTTTCGGTGCTCGACTCACCCGCGCTGCTGCCTCCGCTGAAGGAGGAGCAAAGCTCAAGATGGCCGACAAAACGCCAGGCGG
hide sequence
RefSeq Acc Id:
XM_017596120 ⟹ XP_017451609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,935,092 (-) NCBI mRatBN7.2 8 96,022,955 - 96,055,445 (-) NCBI Rnor_6.0 8 103,242,095 - 103,278,559 (-) NCBI
Sequence:
CCGCCTTCTATGATGGAACACACACTTCCCCCACCTCCATCCGGACTGCCTTTTAATGCGCAGCCTAGAGAGCGATTAAAAAACCCCAATGCTCCCATGTTACCACCACCTAAAAACAAGGAGGATTT
hide sequence
RefSeq Acc Id:
XM_039082559 ⟹ XP_038938487
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,955,437 (-) NCBI mRatBN7.2 8 96,022,955 - 96,075,788 (-) NCBI
RefSeq Acc Id:
XM_039082560 ⟹ XP_038938488
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,963,642 (-) NCBI mRatBN7.2 8 96,018,932 - 96,075,795 (-) NCBI
RefSeq Acc Id:
XM_236501 ⟹ XP_236501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 104,898,580 - 104,955,434 (-) NCBI mRatBN7.2 8 96,018,932 - 96,075,787 (-) NCBI Rnor_6.0 8 103,242,095 - 103,299,082 (-) NCBI Rnor_5.0 8 102,700,388 - 102,757,363 (-) NCBI RGSC_v3.4 8 100,558,095 - 100,611,422 (-) RGD
Sequence:
CGCGGAAGTCACGCGGCCCGGCGCCTCTGAGTTCTCTATTTCGGCATTCGGCTACTGGGCCTGG
hide sequence
RefSeq Acc Id:
XP_002730000 ⟸ XM_002729954
- Peptide Label:
isoform X3
- Sequence:
MADKTPGGSQKASSKSRSSDVHSSGSSDAHPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEFLAAFEGSDGNKVKTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQKNPPN
hide sequence
RefSeq Acc Id:
XP_236501 ⟸ XM_236501
- Peptide Label:
isoform X1
- Sequence:
MADKTPGGSQKASSKSRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESGRESLCDSPHQNLSRPLLENKLKAFSIGKMSTAKRTLSKKEQEELKKKEDEKAAAEIYEEFLAAFEGSD
hide sequence
RefSeq Acc Id:
XP_006243616 ⟸ XM_006243554
- Peptide Label:
isoform X2
- Sequence:
MADKTPGGSQKASSKSRSSDVHSSGSSDAHMDASGPSDSDMPSRTRPKSPRKHNYRNESGRESL
hide sequence
RefSeq Acc Id:
XP_017451609 ⟸ XM_017596120
- Peptide Label:
isoform X6
- Sequence:
MLPCYHHLKTRRILRRNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEEQETEAFVEEPSKKGALKEE
hide sequence
Ensembl Acc Id:
ENSRNOP00000011609 ⟸ ENSRNOT00000011609
Ensembl Acc Id:
ENSRNOP00000048365 ⟸ ENSRNOT00000046873
RefSeq Acc Id:
XP_038938488 ⟸ XM_039082560
- Peptide Label:
isoform X5
- UniProtKB:
A0A8I5ZXP5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038938487 ⟸ XM_039082559
- Peptide Label:
isoform X4
Ensembl Acc Id:
ENSRNOP00000083935 ⟸ ENSRNOT00000116411
RGD ID: 13696191 Promoter ID: EPDNEW_R6710 Type: initiation region Name: U2surp_1 Description: U2 snRNP-associated SURP domain containing SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 103,298,951 - 103,299,011 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-02-24
U2surp
U2 snRNP-associated SURP domain containing
RGD1307882
similar to CG9346-PA
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
RGD1307882
similar to CG9346-PA
RGD1307882_predicted
similar to CG9346-PA (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-20
RGD1307882_predicted
similar to CG9346-PA (predicted)
LOC315903_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC315903_predicted
similar to CG9346-PA (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
