Advanced Search (OLGA)

Gene: Rbm18 (RNA binding motif protein 18) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Rbm18

Name:

RNA binding motif protein 18

RGD ID:

1307411

Description:

Predicted to enable RNA binding activity. Predicted to be located in cytosol; intercellular bridge; and nucleoplasm. Orthologous to human RBM18 (RNA binding motif protein 18); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC311902; probable RNA-binding protein 18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RBM18 (RNA binding motif protein 18)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rbm18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rbm18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RBM18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RBM18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rbm18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RBM18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RBM18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rbm18 (RNA binding motif protein 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KIF27 (kinesin family member 27)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RBM18 (RNA binding motif protein 18)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rbm18 (RNA binding motif protein 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rbm18 (RNA binding motif protein 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14414	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rbm18	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	39,864,739 - 39,884,577 (-)	NCBI		GRCr8
mRatBN7.2	3	19,467,333 - 19,487,171 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	19,467,335 - 19,487,178 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	22,545,823 - 22,565,630 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	31,130,753 - 31,150,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	29,377,908 - 29,397,708 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	15,444,043 - 15,463,881 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	15,444,043 - 15,463,881 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	20,753,255 - 20,773,093 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	15,227,144 - 15,246,982 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	15,123,517 - 15,143,361 (-)	NCBI
Celera	3	14,179,164 - 14,198,986 (-)	NCBI		Celera
Cytogenetic Map	3	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm18	Rat	(-)-demecolcine	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Demecolcine results in increased expression of RBM18 mRNA	CTD	PMID:23649840
Rbm18	Rat	1,2-dichloroethane	decreases expression	ISO	Rbm18 (Mus musculus)	6480464	ethylene dichloride results in decreased expression of RBM18 mRNA	CTD	PMID:28960355
Rbm18	Rat	1,2-dimethylhydrazine	affects expression	ISO	Rbm18 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine affects the expression of RBM18 mRNA	CTD	PMID:22206623
Rbm18	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Rbm18 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBM18 mRNA	CTD	PMID:22206623
Rbm18	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Rbm18 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of RBM18 mRNA	CTD	PMID:21570461
Rbm18	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of RBM18 mRNA	CTD	PMID:33387578
Rbm18	Rat	2-methylcholine	affects expression	ISO	RBM18 (Homo sapiens)	6480464	beta-methylcholine affects the expression of RBM18 mRNA	CTD	PMID:21179406
Rbm18	Rat	4,4'-diaminodiphenylmethane	increases expression	ISO	Rbm18 (Mus musculus)	6480464	4 and 4'-diaminodiphenylmethane results in increased expression of RBM18 mRNA	CTD	PMID:18648102
Rbm18	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of RBM18 mRNA	CTD	PMID:28959563
Rbm18	Rat	acrylamide	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Acrylamide results in increased expression of RBM18 mRNA	CTD	PMID:30807115
Rbm18	Rat	aflatoxin B1	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Aflatoxin B1 results in increased expression of RBM18 mRNA	CTD	PMID:19770486
Rbm18	Rat	aflatoxin B1	increases methylation	ISO	RBM18 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of RBM18 gene	CTD	PMID:27153756
Rbm18	Rat	arsane	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	arsenic atom	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	atrazine	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Atrazine results in increased expression of RBM18 mRNA	CTD	PMID:22378314
Rbm18	Rat	benzo[a]pyrene	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Benzo(a)pyrene results in increased expression of RBM18 mRNA	CTD	PMID:22228805
Rbm18	Rat	benzo[a]pyrene	decreases methylation	ISO	RBM18 (Homo sapiens)	6480464	Benzo(a)pyrene results in decreased methylation of RBM18 promoter	CTD	PMID:27901495
Rbm18	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RBM18 mRNA	CTD	PMID:25181051
Rbm18	Rat	bisphenol A	increases expression	ISO	Rbm18 (Mus musculus)	6480464	bisphenol A results in increased expression of RBM18 mRNA	CTD	PMID:33221593
Rbm18	Rat	cadmium dichloride	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of RBM18 mRNA	CTD	PMID:38568856
Rbm18	Rat	CGP 52608	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to RBM18 gene]	CTD	PMID:28238834
Rbm18	Rat	chlorpyrifos	decreases expression	ISO	Rbm18 (Mus musculus)	6480464	Chlorpyrifos results in decreased expression of RBM18 mRNA	CTD	PMID:32715474
Rbm18	Rat	cisplatin	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Cisplatin results in increased expression of RBM18 mRNA	CTD	PMID:19561079
Rbm18	Rat	copper atom	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of RBM18 mRNA	CTD	PMID:24690739
Rbm18	Rat	copper(0)	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of RBM18 mRNA	CTD	PMID:24690739
Rbm18	Rat	copper(II) sulfate	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Copper Sulfate results in increased expression of RBM18 mRNA	CTD	PMID:19549813
Rbm18	Rat	cyclosporin A	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Cyclosporine results in increased expression of RBM18 mRNA	CTD	PMID:25562108
Rbm18	Rat	cylindrospermopsin	increases expression	ISO	RBM18 (Homo sapiens)	6480464	cylindrospermopsin results in increased expression of RBM18 mRNA	CTD	PMID:24921660
Rbm18	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of RBM18 mRNA	CTD	PMID:21266533
Rbm18	Rat	dibutyl phthalate	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Dibutyl Phthalate results in increased expression of RBM18 mRNA	CTD	PMID:21266533
Rbm18	Rat	dicrotophos	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	dicrotophos results in decreased expression of RBM18 mRNA	CTD	PMID:28302478
Rbm18	Rat	disulfiram	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[Disulfiram binds to Copper] which results in decreased expression of RBM18 mRNA	CTD	PMID:24690739
Rbm18	Rat	doxorubicin	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	Doxorubicin results in decreased expression of RBM18 mRNA	CTD	PMID:29803840
Rbm18	Rat	epoxiconazole	affects expression	ISO	Rbm18 (Mus musculus)	6480464	epoxiconazole affects the expression of RBM18 mRNA	CTD	PMID:35436446
Rbm18	Rat	ethanol	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Ethanol results in increased expression of RBM18 mRNA	CTD	PMID:30319688
Rbm18	Rat	ethyl methanesulfonate	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Ethyl Methanesulfonate results in increased expression of RBM18 mRNA	CTD	PMID:23649840
Rbm18	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of RBM18 mRNA	CTD	PMID:30307764
Rbm18	Rat	folic acid	multiple interactions	ISO	Rbm18 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBM18 mRNA	CTD	PMID:22206623
Rbm18	Rat	formaldehyde	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Formaldehyde results in increased expression of RBM18 mRNA	CTD	PMID:23649840
Rbm18	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of RBM18 mRNA	CTD	PMID:33387578
Rbm18	Rat	hydrogen peroxide	affects expression	ISO	RBM18 (Homo sapiens)	6480464	Hydrogen Peroxide affects the expression of RBM18 mRNA	CTD	PMID:20044591
Rbm18	Rat	hypochlorous acid	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Hypochlorous Acid results in increased expression of RBM18 mRNA	CTD	PMID:19376150
Rbm18	Rat	manganese atom	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	manganese(0)	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	manganese(II) chloride	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [manganese chloride results in increased abundance of Manganese] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	methyl methanesulfonate	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Methyl Methanesulfonate results in increased expression of RBM18 mRNA	CTD	PMID:23649840
Rbm18	Rat	methylmercury chloride	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	methylmercuric chloride results in decreased expression of RBM18 mRNA	CTD	PMID:28001369
Rbm18	Rat	ozone	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[Air Pollutants results in increased abundance of Ozone] which affects the expression of RBM18 mRNA	CTD	PMID:35430440
Rbm18	Rat	paracetamol	affects expression	ISO	Rbm18 (Mus musculus)	6480464	Acetaminophen affects the expression of RBM18 mRNA	CTD	PMID:17562736
Rbm18	Rat	phenobarbital	affects expression	ISO	RBM18 (Homo sapiens)	6480464	Phenobarbital affects the expression of RBM18 mRNA	CTD	PMID:19159669
Rbm18	Rat	sodium arsenite	multiple interactions	ISO	RBM18 (Homo sapiens)	6480464	[[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of RBM18 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of RBM18 mRNA	CTD	PMID:39836092
Rbm18	Rat	tetrachloromethane	increases expression	ISO	Rbm18 (Mus musculus)	6480464	Carbon Tetrachloride results in increased expression of RBM18 mRNA	CTD	PMID:31919559
Rbm18	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of RBM18 mRNA	CTD	PMID:34492290
Rbm18	Rat	thiram	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Thiram results in increased expression of RBM18 mRNA	CTD	PMID:38568856
Rbm18	Rat	titanium dioxide	decreases methylation	ISO	Rbm18 (Mus musculus)	6480464	titanium dioxide results in decreased methylation of RBM18 gene	CTD	PMID:35295148
Rbm18	Rat	trichostatin A	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	trichostatin A results in decreased expression of RBM18 mRNA	CTD	PMID:26272509
Rbm18	Rat	triphenyl phosphate	affects expression	ISO	RBM18 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of RBM18 mRNA	CTD	PMID:37042841
Rbm18	Rat	triptonide	increases expression	ISO	Rbm18 (Mus musculus)	6480464	triptonide results in increased expression of RBM18 mRNA	CTD	PMID:33045310
Rbm18	Rat	trovafloxacin	increases expression	ISO	Rbm18 (Mus musculus)	6480464	trovafloxacin results in increased expression of RBM18 mRNA	CTD	PMID:35537566
Rbm18	Rat	valproic acid	decreases methylation	ISO	RBM18 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of RBM18 gene	CTD	PMID:29154799
Rbm18	Rat	valproic acid	decreases expression	ISO	RBM18 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of RBM18 mRNA	CTD	PMID:28001369
Rbm18	Rat	valproic acid	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Valproic Acid results in increased expression of RBM18 mRNA	CTD	PMID:29154799
Rbm18	Rat	vincristine	increases expression	ISO	RBM18 (Homo sapiens)	6480464	Vincristine results in increased expression of RBM18 mRNA	CTD	PMID:23649840

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm18	Rat	cytosol	located_in	ISO	RBM18 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Rbm18	Rat	cytosol	located_in	IEA	UniProtKB:Q96H35 and ensembl:ENSP00000409315	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbm18	Rat	intercellular bridge	located_in	ISO	RBM18 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Rbm18	Rat	intercellular bridge	located_in	IEA	UniProtKB:Q96H35 and ensembl:ENSP00000409315	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rbm18	Rat	nucleoplasm	located_in	ISO	RBM18 (Homo sapiens)	1624291		RGD	GO_REF:0000052
Rbm18	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q96H35 and ensembl:ENSP00000409315	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rbm18	Rat	nucleic acid binding	enables	IEA	InterPro:IPR035979	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rbm18	Rat	RNA binding	enables	IEA	UniProtKB-KW:KW-0694	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rbm18	Rat	RNA binding	enables	IEA	UniRule:UR000414619	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Rbm18	Rat	RNA binding	enables	IEA	InterPro:IPR000504	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rbm18	Rat	RNA binding	enables	IBA	FB:FBgn0038826 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932

Rbm18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	39,864,739 - 39,884,577 (-)	NCBI		GRCr8
mRatBN7.2	3	19,467,333 - 19,487,171 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	19,467,335 - 19,487,178 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	22,545,823 - 22,565,630 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	31,130,753 - 31,150,560 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	29,377,908 - 29,397,708 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	15,444,043 - 15,463,881 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	15,444,043 - 15,463,881 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	20,753,255 - 20,773,093 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	15,227,144 - 15,246,982 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	15,123,517 - 15,143,361 (-)	NCBI
Celera	3	14,179,164 - 14,198,986 (-)	NCBI		Celera
Cytogenetic Map	3	p11	NCBI

RBM18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	122,237,622 - 122,264,840 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	122,237,622 - 122,264,840 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	124,999,901 - 125,027,119 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	124,043,604 - 124,066,911 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	122,083,337 - 122,106,644	NCBI
Celera	9	95,650,145 - 95,675,469 (-)	NCBI		Celera
Cytogenetic Map	9	q33.2	NCBI
HuRef	9	94,616,513 - 94,641,838 (-)	NCBI		HuRef
CHM1_1	9	125,149,891 - 125,175,212 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	134,435,123 - 134,462,358 (-)	NCBI		T2T-CHM13v2.0

Rbm18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	36,006,091 - 36,026,716 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	36,006,091 - 36,026,785 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	36,116,079 - 36,136,704 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	36,116,079 - 36,136,773 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	35,971,599 - 35,992,224 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	35,938,090 - 35,958,620 (-)	NCBI		MGSCv36	mm8
Celera	2	35,819,723 - 35,840,373 (-)	NCBI		Celera
Cytogenetic Map	2	B	NCBI
cM Map	2	24.19	NCBI

Rbm18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	5,800,074 - 5,822,378 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	5,800,761 - 5,822,378 (+)	NCBI	ChiLan1.0	ChiLan1.0

RBM18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	17,081,506 - 17,106,431 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	17,083,855 - 17,108,780 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	93,364,947 - 93,389,862 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	121,705,478 - 121,730,801 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	121,705,478 - 121,730,801 (-)	Ensembl	panpan1.1		panPan2

RBM18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	60,314,598 - 60,338,593 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	60,314,601 - 60,336,775 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	59,510,046 - 59,534,015 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	61,229,645 - 61,253,709 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	61,229,366 - 61,253,702 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	60,003,894 - 60,027,929 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	60,320,187 - 60,344,221 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	60,408,873 - 60,432,925 (+)	NCBI		UU_Cfam_GSD_1.0

Rbm18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	190,859,565 - 190,881,093 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936487	10,629,550 - 10,649,594 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RBM18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	262,333,533 - 262,356,222 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	262,333,529 - 262,356,280 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	294,633,294 - 294,656,005 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RBM18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	17,330,115 - 17,355,517 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666035	25,693,416 - 25,719,259 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rbm18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	13,032,021 - 13,054,919 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	13,032,036 - 13,054,919 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Rbm18
77 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	246
Count of miRNA genes:	161
Interacting mature miRNAs:	198
Transcripts:	ENSRNOT00000009706
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358357	Srcrtb1	Stress Responsive Cort Basal QTL 1	6.36	0.002	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	8658162	27494778	Rat
6893355	Bw101	Body weight QTL 101	0.4	0.38	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
634306	Bp140	Blood pressure QTL 140	3.3	0.0013	arterial blood pressure trait (VT:2000000)	body weight (CMO:0000012)	3	17374703	35528639	Rat
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	8227194	47233430	Rat
1298526	Arunc3	Aerobic running capacity QTL 3	2.2		exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	8227194	33703538	Rat
8693641	Alc30	Alcohol consumption QTL 30	2	0.739	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	3	10434306	24512004	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	15005422	76927699	Rat
1558657	Cm43	Cardiac mass QTL 43	6.6	3e-08	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
631568	Bp92	Blood pressure QTL 92	2.2	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	39874793	Rat
6893363	Bw105	Body weight QTL 105	2.6	0.0036	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
61468	Bp15	Blood pressure QTL 15	4.4		blood pressure trait (VT:0000183)	pulse pressure (CMO:0000292)	3	1	33278763	Rat
631831	Alc8	Alcohol consumption QTL 8	2.7		consumption behavior trait (VT:0002069)	calculated ethanol drink intake rate (CMO:0001615)	3	1	33230976	Rat
1558647	Cm46	Cardiac mass QTL 46	5.4	0.0000055	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	10778823	30356773	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	1	36847613	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	18311454	47233430	Rat
1558654	Bw56	Body weight QTL 56	4.5	0.0000171	body mass (VT:0001259)	body weight (CMO:0000012)	3	10778704	30357018	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	18311454	47233430	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	18311454	47233430	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	10778823	30356773	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	18311454	47233430	Rat
70191	BpQTLcluster4	Blood pressure QTL cluster 4	3		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	3	10778704	50302886	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	18311454	47233430	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	47233430	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	18311454	47233430	Rat
631545	Bp85	Blood pressure QTL 85	3.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	1	33278763	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	18311454	28441896	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	16954708	61954708	Rat
631679	Cm10	Cardiac mass QTL 10	7.34	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	1	31158234	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
70203	Gcr2	Gastric cancer resistance QTL 2	2.6		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	3	8658162	27494778	Rat
70202	Alc19	Alcohol consumption QTL 19	2.5		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	3	1	27494778	Rat
2312664	Scl62	Serum cholesterol level QTL 62		0.05	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	1	38710544	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat

RH131090

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	19,468,938 - 19,469,118 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	15,445,649 - 15,445,828	NCBI	Rnor6.0
Rnor_5.0	3	20,754,861 - 20,755,040	UniSTS	Rnor5.0
RGSC_v3.4	3	15,228,750 - 15,228,929	UniSTS	RGSC3.4
Celera	3	14,180,770 - 14,180,949	UniSTS
RH 3.4 Map	3	176.7	UniSTS
Cytogenetic Map	3	p11	UniSTS

BE105148

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	19,476,018 - 19,476,182 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	15,452,729 - 15,452,892	NCBI	Rnor6.0
Rnor_5.0	3	20,761,941 - 20,762,104	UniSTS	Rnor5.0
RGSC_v3.4	3	15,235,830 - 15,235,993	UniSTS	RGSC3.4
Celera	3	14,187,850 - 14,188,013	UniSTS
RH 3.4 Map	3	179.4	UniSTS
Cytogenetic Map	3	p11	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009706 ⟹ ENSRNOP00000009706

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	19,467,337 - 19,487,178 (-)	Ensembl
Rnor_6.0 Ensembl	3	15,444,043 - 15,463,881 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102683 ⟹ ENSRNOP00000086000

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	19,467,335 - 19,487,178 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112570 ⟹ ENSRNOP00000088220

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	19,467,338 - 19,484,088 (-)	Ensembl

RefSeq Acc Id:

NM_001107838 ⟹ NP_001101308

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	39,864,739 - 39,884,577 (-)	NCBI
mRatBN7.2	3	19,467,333 - 19,487,171 (-)	NCBI
Rnor_6.0	3	15,444,043 - 15,463,881 (-)	NCBI
Rnor_5.0	3	20,753,255 - 20,773,093 (-)	NCBI
RGSC_v3.4	3	15,227,144 - 15,246,982 (-)	RGD
Celera	3	14,179,164 - 14,198,986 (-)	RGD

Sequence:

show sequence

GCGTAGCGCGTCACGGGCGGCCGGGCGGCGAGCGGTGTTTCGGCAGAGGTAACCTCACGTCCCTCGCTCGGACCCCAGCGTCGGAAGCTGCTTTCGGGGCATGAGCTGAGAGGGCACGGCTCCGAGGC
TAGCGGTATTTTTTAGAGATTGATGGAAGCAGAAACCAAAACTCTTCCCCTGGAGAATGCATCCATCCTTTCAGAGGGCTCTCTACAAGAAGGACACCGATTATGGATTGGCAACCTGGATCCCAAAA
TCACAGAATACCACCTCCTCAAGCTCCTCCAGAGGTTCGGCAAGGTGAAGCAATTCGATTTCCTCTTCCACAAGTCGGGTGCTTTGGAGGGCCAGCCCCGAGGGTACTGTTTTGTTAACTTTGAGACT
AAGCAGGAAGCAGAACAAGCCATCCAGTGTCTCAATGGCAAGCTGGCGCTGTCTAAGAAGCTGGTTGTGCGATGGGCCCACGCTCAGGTCAAGAGATACGATCATAACAAGAATGATAAGATCCTTCC
CATCAGCCTTGAGCCATCCTCAAGCACTGAAGCTACTCAGTCTAACCTCAGTGTCACTGCAAAGATAAAGGCCATTGAAGCAAAGCTGAAGATGATGGCAGAGAATCCTGACGCAGAGTACCCAGCAG
CGCCTGTTTATTCCTACTTTAAACCGCCTGATAAAAAAAGGACTACTCCATACTCGAGAACAGCCTGGAAGTCTCGAAGATGATGGTCAGGAGTTACAGAGCAGCAGAGGCAATGTCTGCACCCCAGA
AGTCCTTAGCCTCTGTACTTTGTAGGTGTGGATGGTAACCAACAGAGCACAGTCTTGTTAGGCCGGTGACGCAGCGCGTTTGGGTGTTCATATGGATGTGTCTTCCCTGAACTATGTGTTGAGTTGAG
CATCATCCAGAATAAATAGGAATAAGTCCAGACTGTGATTTGAACACTGAGACGCTCTAGTTGGCTGCTTTGTTTGGATTTGTAACTCTAGAAACACAGTTGCCAGAGAGAGAAACAAGCATACAAAG
TTGTTACTTAAATCAGGAAACTAAATTTATTAACATCCACCAAAAACTTTTGGCATTTTTATGTGTACACATCTCTTCAACATAAACAAAAATAAGGGGAGGGTGGGAAGTGAGAGACATTTTCAGTC
GTTTTTAGAACTGTTTGAGAGTGTTCTGCGGAAATCCTTCAGTTTGGCTAAAAAGAGAATTCTTGGCAAAAAGCAGCCGACCCCTTGAGTGAATGTTGTAGCAATCTGTTTCAGAATTATGCTTCTTA
TTTCCAAACCTCAATTAGGAAAACGTGGTGTATGTCTTAAAATTGTTTATGTCAACAAAGTGCAGAATCACATTTAGCATTTTATACCACAGCAGATACTCTATTTGAAAATCCAGCCTTTATTCTCT
GGCAATCATGGTTTTGAATATGAAGGACCTTGCCGTCTGTAATACCAATGTTATTACTCACCTGGATCTTAGTACGCGTGCATGGGATCGCTTTATAGCATGACGTTGTTCCAGTTAGAATTGTATCA
TGATCAGTCTAAGTAGAAAAGCGGAATTTCTCTGAAAACCTCAAGTTTACTGTATTGGCCGCTCTCAGCCATTGCTCTCTCACAGTTGTGTGTGGGACTGCAGGAAGCGGCTGAGTGGCCTTTTTGCA
GCTGAGAAGGGAAGTGCAGTGAGCAGCAGGAGTCAGCAGCCAGTGCTCAGGCACCAAGACCATAGCAACCACACGGGTTCTGTCCTTTCGGAAGACTGCACAGCCTAAAAGTGAGCGTTATTTTGACA
GCATGACAGTTAGATCTCCAGATATCATTGTCTCTTTGGGCACGCTGAATATGGTAGTATAGAGACATACATAAATGGGCAGCCTTGGGAATGTGTTTGTTCAGCTCAGGGCTGACTGCTTTGGTGCC
AGGCCTGACAGACTGTTTCATTAGCAGCACCATTCTTCACTGAGCAGATCACTGCTGCTCACCGCAGGTGCCACCCATGATGACTTGGGTTGCAGAGGCTCAAGTCTTCCTGGGGTTAAGACGCTTGA
CCTCTGGGGTTTCAGAATCCACAGAACTGCTTCAGAGGAATTCTTACTGCTTTTCCCAAGGCCAGTCTTTTTTAGCTATCTTTAGATACTGAATAAGTCCCAGATTTATCAGTTGTGTATATCTGTGA
TACAGGAAACTCTTCCACTTGGGAGCTCGTTCAGGGAAGTGGGAACACCGGCTCCCATTTGTCTGGTGACTTCTTAGAATATAGAATTCACCATTTCATCCTTAAGTTCTCAAAGGGTTGTAGGTGGA
GTAGAATTTGATGCCAATAGCCTTCTATTTTTAATAGGAACCTAGAGAATACTTTAGGATTATCTAGAGTTGTTTCTTTAGAATCTAGAATTATTTATTTGTATTTAAACAATGTCTATGATTTGTAC
CAATTCTTACCCCTTTATGTGAATAAATGCAAGACGGTAT

hide sequence


Protein RefSeqs	NP_001101308	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI68896	(Get FASTA)	NCBI Sequence Viewer
	EDL93128	(Get FASTA)	NCBI Sequence Viewer
	EDL93129	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009706
	ENSRNOP00000009706.5
	ENSRNOP00000086000.1
	ENSRNOP00000088220.1

RefSeq Acc Id:	NP_001101308 ⟸ NM_001107838
- UniProtKB:	A0A8I6A1C3 (UniProtKB/TrEMBL), A6JUG8 (UniProtKB/TrEMBL), B5DF23 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEAETKTLPLENASILSEGSLQEGHRLWIGNLDPKITEYHLLKLLQRFGKVKQFDFLFHKSGALEGQPRGYCFVNFETKQEAEQAIQCLNGKLALSKKLVVRWAHAQVKRYDHNKNDKILPISLEPSS STEATQSNLSVTAKIKAIEAKLKMMAENPDAEYPAAPVYSYFKPPDKKRTTPYSRTAWKSRR hide sequence

Ensembl Acc Id:

ENSRNOP00000009706 ⟸ ENSRNOT00000009706

Ensembl Acc Id:

ENSRNOP00000086000 ⟸ ENSRNOT00000102683

Ensembl Acc Id:

ENSRNOP00000088220 ⟸ ENSRNOT00000112570

Protein Domains

RRM

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V6X2-F1-model_v2	AlphaFold	G3V6X2	1-190	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13692022

Promoter ID:

EPDNEW_R2547

Type:

initiation region

Name:

Rbm18_1

Description:

RNA binding motif protein 18

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	15,463,879 - 15,463,939	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-50014	BioCyc
Ensembl Genes	ENSRNOG00000006763	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009706	ENTREZGENE
	ENSRNOT00000009706.6	UniProtKB/TrEMBL
	ENSRNOT00000102683.1	UniProtKB/TrEMBL
	ENSRNOT00000112570.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/TrEMBL
	RBM18_RRM	UniProtKB/TrEMBL
	RRM_dom	UniProtKB/TrEMBL
KEGG Report	rno:311902	UniProtKB/TrEMBL
NCBI Gene	311902	ENTREZGENE
PANTHER	HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN	UniProtKB/TrEMBL
Pfam	RRM_1	UniProtKB/TrEMBL
PhenoGen	Rbm18	PhenoGen
PROSITE	RRM	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006763	RatGTEx
SMART	RRM	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/TrEMBL
UniProt	A0A8I6A1C3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A7E6_RAT	UniProtKB/TrEMBL
	A6JUG8	ENTREZGENE, UniProtKB/TrEMBL
	B5DF23	ENTREZGENE, UniProtKB/TrEMBL
	G3V6X2_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Rbm18	RNA binding motif protein 18	Rbm18_predicted	RNA binding motif protein 18 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rbm18_predicted	RNA binding motif protein 18 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message