Symbol:
Wdr91
Name:
WD repeat domain 91
RGD ID:
1306697
Description:
Predicted to enable phosphatidylinositol 3-kinase inhibitor activity. Predicted to be involved in early endosome to late endosome transport and regulation of protein catabolic process. Predicted to be located in cytosol and endosome membrane. Predicted to be active in early endosome membrane and late endosome membrane. Orthologous to human WDR91 (WD repeat domain 91); INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC312225; RGD1306697; similar to HSPC049 protein; WD repeat-containing protein 91
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WDR91 (WD repeat domain 91) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Wdr91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wdr91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WDR91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WDR91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wdr91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WDR91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WDR91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wdr91 (WD repeat domain 91) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
VPS9D1 (VPS9 domain containing 1) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Wdr91 (WD repeat domain 91)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
WDR91 (WD repeat domain 91)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wdr91 (WD repeat domain 91)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG6005
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
sorf-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
wdr91
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 64,521,504 - 64,558,873 (-) NCBI GRCr8 mRatBN7.2 4 63,554,364 - 63,591,733 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 63,554,364 - 63,591,733 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 68,512,415 - 68,549,772 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 64,428,148 - 64,465,504 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 62,830,541 - 62,867,899 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 62,398,073 - 62,438,958 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 62,398,797 - 62,438,958 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 62,130,769 - 62,166,447 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 62,266,685 - 62,304,007 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 62,543,137 - 62,580,127 (-) NCBI Celera 4 58,605,800 - 58,642,741 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wdr91 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of WDR91 mRNA] CTD PMID:31150632 Wdr91 Rat (1->4)-beta-D-glucan multiple interactions ISO Wdr91 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR91 mRNA CTD PMID:36331819 Wdr91 Rat 1,2-dichloroethane decreases expression ISO Wdr91 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of WDR91 mRNA CTD PMID:28960355 Wdr91 Rat 17beta-estradiol decreases expression ISO Wdr91 (Mus musculus) 6480464 Estradiol results in decreased expression of WDR91 mRNA CTD PMID:19484750 Wdr91 Rat 17beta-estradiol increases expression ISO Wdr91 (Mus musculus) 6480464 Estradiol results in increased expression of WDR91 mRNA CTD PMID:39298647 Wdr91 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of WDR91 mRNA CTD PMID:32145629 Wdr91 Rat 17beta-estradiol multiple interactions ISO WDR91 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of WDR91 mRNA CTD PMID:30165855 Wdr91 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO WDR91 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wdr91 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Wdr91 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of WDR91 mRNA CTD PMID:19770486 Wdr91 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of WDR91 mRNA CTD PMID:33387578 Wdr91 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of WDR91 mRNA CTD PMID:34747641 Wdr91 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Wdr91 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of WDR91 mRNA CTD PMID:26377647 Wdr91 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Wdr91 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of WDR91 mRNA CTD PMID:25975270 Wdr91 Rat 2,4,6-tribromophenol increases expression ISO WDR91 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Wdr91 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO WDR91 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of WDR91 protein CTD PMID:31675489 Wdr91 Rat 4,4'-sulfonyldiphenol increases expression ISO Wdr91 (Mus musculus) 6480464 bisphenol S results in increased expression of WDR91 mRNA CTD PMID:33297965 Wdr91 Rat 4,4'-sulfonyldiphenol affects methylation ISO Wdr91 (Mus musculus) 6480464 bisphenol S affects the methylation of WDR91 gene CTD PMID:31683443 Wdr91 Rat 4,4'-sulfonyldiphenol decreases expression ISO Wdr91 (Mus musculus) 6480464 bisphenol S results in decreased expression of WDR91 mRNA CTD PMID:39298647 Wdr91 Rat arsenite(3-) decreases expression ISO Wdr91 (Mus musculus) 6480464 arsenite results in decreased expression of WDR91 protein CTD PMID:37955338 Wdr91 Rat benzene increases expression ISO WDR91 (Homo sapiens) 6480464 Benzene results in increased expression of WDR91 mRNA CTD PMID:19162166 Wdr91 Rat bisphenol A decreases expression ISO WDR91 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WDR91 mRNA and bisphenol A results in decreased expression of WDR91 protein CTD PMID:17989879 and PMID:31675489 Wdr91 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of WDR91 mRNA CTD PMID:30816183 and PMID:32528016 Wdr91 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of WDR91 mRNA CTD PMID:25181051 Wdr91 Rat bisphenol F decreases expression ISO Wdr91 (Mus musculus) 6480464 bisphenol F results in decreased expression of WDR91 mRNA CTD PMID:38685157 Wdr91 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of WDR91 mRNA CTD PMID:32479839 Wdr91 Rat cadmium atom multiple interactions ISO Wdr91 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WDR91 mRNA CTD PMID:37325564 Wdr91 Rat cadmium dichloride decreases expression ISO WDR91 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of WDR91 mRNA CTD PMID:38568856 Wdr91 Rat cadmium dichloride multiple interactions ISO Wdr91 (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WDR91 mRNA CTD PMID:37325564 Wdr91 Rat carbon nanotube decreases expression ISO Wdr91 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Wdr91 Rat cisplatin increases expression ISO WDR91 (Homo sapiens) 6480464 Cisplatin results in increased expression of WDR91 mRNA CTD PMID:27594783 Wdr91 Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of WDR91 mRNA CTD PMID:24386269 Wdr91 Rat decabromodiphenyl ether increases expression ISO WDR91 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of WDR91 protein CTD PMID:31675489 Wdr91 Rat Dibutyl phosphate affects expression ISO WDR91 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of WDR91 mRNA CTD PMID:37042841 Wdr91 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of WDR91 mRNA CTD PMID:29391264 Wdr91 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of WDR91 mRNA CTD PMID:24136188 Wdr91 Rat FR900359 increases phosphorylation ISO WDR91 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of WDR91 protein CTD PMID:37730182 Wdr91 Rat ivermectin decreases expression ISO WDR91 (Homo sapiens) 6480464 Ivermectin results in decreased expression of WDR91 protein CTD PMID:32959892 Wdr91 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of WDR91 gene CTD PMID:35440735 Wdr91 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of WDR91 mRNA CTD PMID:33387578 Wdr91 Rat parathion decreases expression ISO Wdr91 (Mus musculus) 6480464 Parathion results in decreased expression of WDR91 mRNA CTD PMID:34813904 Wdr91 Rat perfluorohexanesulfonic acid decreases expression ISO Wdr91 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of WDR91 mRNA CTD PMID:37995155 Wdr91 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Wdr91 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of WDR91 mRNA CTD PMID:36331819 Wdr91 Rat progesterone affects response to substance ISO WDR91 (Homo sapiens) 6480464 WDR91 gene SNP affects the susceptibility to Progesterone CTD PMID:25622337 Wdr91 Rat propiconazole decreases expression ISO Wdr91 (Mus musculus) 6480464 propiconazole results in decreased expression of WDR91 mRNA CTD PMID:21278054 Wdr91 Rat tetrachloroethene increases expression ISO Wdr91 (Mus musculus) 6480464 Tetrachloroethylene results in increased expression of WDR91 mRNA CTD PMID:28973375 Wdr91 Rat tetrachloroethene decreases expression ISO Wdr91 (Mus musculus) 6480464 Tetrachloroethylene results in decreased expression of WDR91 mRNA CTD PMID:28973375 Wdr91 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of WDR91 mRNA] CTD PMID:31150632 Wdr91 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of WDR91 mRNA CTD PMID:31150632 Wdr91 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of WDR91 mRNA CTD PMID:34492290 Wdr91 Rat thiram decreases expression ISO WDR91 (Homo sapiens) 6480464 Thiram results in decreased expression of WDR91 mRNA CTD PMID:38568856 Wdr91 Rat titanium dioxide increases methylation ISO Wdr91 (Mus musculus) 6480464 titanium dioxide results in increased methylation of WDR91 promoter CTD PMID:35295148 Wdr91 Rat tributylstannane increases expression EXP 6480464 tributyltin results in increased expression of WDR91 mRNA CTD PMID:31129395 Wdr91 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of WDR91 mRNA CTD PMID:33387578 Wdr91 Rat triphenyl phosphate affects expression ISO WDR91 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of WDR91 mRNA CTD PMID:37042841 Wdr91 Rat triptonide increases expression ISO Wdr91 (Mus musculus) 6480464 triptonide results in increased expression of WDR91 mRNA CTD PMID:33045310 Wdr91 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of WDR91 mRNA CTD PMID:23034163
(+)-schisandrin B (EXP) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) arsenite(3-) (ISO) benzene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) cisplatin (ISO) cobalt dichloride (EXP) decabromodiphenyl ether (ISO) Dibutyl phosphate (ISO) endosulfan (EXP) flutamide (EXP) FR900359 (ISO) ivermectin (ISO) methoxychlor (EXP) paracetamol (EXP) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) progesterone (ISO) propiconazole (ISO) tetrachloroethene (ISO) tetrachloromethane (EXP) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tributylstannane (EXP) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) vinclozolin (EXP)
Cellular Component
cytosol (IEA,ISO,ISS) early endosome membrane (IBA,IEA,ISO,ISS) endosome (IEA) endosome membrane (IEA,ISO,ISS) late endosome membrane (IBA,IEA,ISO,ISS) membrane (IEA)
Wdr91 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 64,521,504 - 64,558,873 (-) NCBI GRCr8 mRatBN7.2 4 63,554,364 - 63,591,733 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 63,554,364 - 63,591,733 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 68,512,415 - 68,549,772 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 64,428,148 - 64,465,504 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 62,830,541 - 62,867,899 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 62,398,073 - 62,438,958 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 62,398,797 - 62,438,958 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 62,130,769 - 62,166,447 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 62,266,685 - 62,304,007 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 62,543,137 - 62,580,127 (-) NCBI Celera 4 58,605,800 - 58,642,741 (-) NCBI Celera Cytogenetic Map 4 q22 NCBI
WDR91 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 135,183,839 - 135,211,526 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 135,183,839 - 135,211,555 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 134,868,591 - 134,896,278 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 134,520,525 - 134,546,811 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 129,606,070 - 129,633,795 (-) NCBI Celera Cytogenetic Map 7 q33 NCBI HuRef 7 129,171,252 - 129,198,944 (-) NCBI HuRef CHM1_1 7 134,802,527 - 134,830,249 (-) NCBI CHM1_1 T2T-CHM13v2.0 7 136,491,701 - 136,519,383 (-) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 134,212,952 - 134,240,677 (-) NCBI
Wdr91 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 34,857,361 - 34,887,766 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 34,857,361 - 34,887,811 (-) Ensembl GRCm39 Ensembl GRCm38 6 34,880,426 - 34,910,831 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 34,880,426 - 34,910,876 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 34,830,426 - 34,860,831 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 34,810,578 - 34,840,983 (-) NCBI MGSCv36 mm8 Celera 6 34,880,559 - 34,910,996 (-) NCBI Celera Cytogenetic Map 6 B1 NCBI cM Map 6 15.19 NCBI
Wdr91 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955494 7,441,918 - 7,468,615 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955494 7,441,880 - 7,470,174 (+) NCBI ChiLan1.0 ChiLan1.0
WDR91 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 171,986,626 - 172,032,427 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 24,016,868 - 24,042,680 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 127,150,041 - 127,176,376 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 139,652,473 - 139,680,199 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 139,653,864 - 139,680,199 (-) Ensembl panpan1.1 panPan2
WDR91 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 16 12,964,967 - 12,991,851 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 16 12,965,140 - 12,995,345 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 16 13,976,583 - 14,004,081 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 16 12,945,013 - 12,972,530 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 16 12,945,045 - 12,974,027 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 16 13,387,029 - 13,414,532 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 16 12,486,349 - 12,513,824 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 16 12,625,387 - 12,652,919 (+) NCBI UU_Cfam_GSD_1.0
Wdr91
WDR91 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 14,092,322 - 14,126,475 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 14,092,265 - 14,124,127 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 14,899,268 - 14,931,415 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WDR91 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 103,854,521 - 103,885,041 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 103,853,944 - 103,884,999 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666072 770,009 - 800,067 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wdr91
.
Predicted Target Of
Count of predictions: 188 Count of miRNA genes: 137 Interacting mature miRNAs: 151 Transcripts: ENSRNOT00000014010 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 1549843 Bw53 Body weight QTL 53 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 103194791 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1358363 Sradr3 Stress Responsive Adrenal Weight QTL 3 6.19 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 4 57486946 102486946 Rat 61336 Bp21 Blood pressure QTL 21 4.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114705 78881294 Rat 1549839 Bw52 Body weight QTL 52 0.0001 body mass (VT:0001259) body weight gain (CMO:0000420) 4 61697658 115089733 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 2300179 Bmd50 Bone mineral density QTL 50 5.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 4 60928534 105928534 Rat 1298082 Stresp4 Stress response QTL 4 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 50119848 146803430 Rat 70192 BpQTLcluster5 Blood pressure QTL cluster 5 4.183 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 4 62933508 114921294 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 70200 Alc18 Alcohol consumption QTL 18 9.2 drinking behavior trait (VT:0001422) ethanol intake volume to total fluid intake volume ratio (CMO:0001591) 4 56647873 149491524 Rat 1578657 Bss12 Bone structure and strength QTL 12 8.9 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 4 60220938 105220938 Rat 1578658 Bss13 Bone structure and strength QTL 13 8 femur strength trait (VT:0010010) femoral neck polar moment of inertia (CMO:0001670) 4 60220938 105220938 Rat 4889969 Bss96 Bone structure and strength QTL 96 4.9 tibia size trait (VT:0100001) tibia cortical bone volume (CMO:0001725) 4 56647776 78882945 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat 4889972 Bss97 Bone structure and strength QTL 97 5.6 tibia size trait (VT:0100001) tibia total bone volume (CMO:0001724) 4 56647776 78882945 Rat 6478684 Anxrr30 Anxiety related response QTL 30 0.00087 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 5685012 Bmd87 Bone mineral density QTL 87 5.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 4 56647776 78882945 Rat 5685009 Bmd86 Bone mineral density QTL 86 3.7 tibia mineral mass (VT:1000283) bone mineral density (CMO:0001226) 4 56647776 78882945 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 634311 Sach7 Saccharin preference QTL 7 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 57114432 81266970 Rat 738009 Sach4 Saccharine consumption QTL 4 4.9 0.000016 consumption behavior trait (VT:0002069) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 4 59948935 154902892 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 6478772 Anxrr49 Anxiety related response QTL 49 0.15488 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 738031 Alc14 Alcohol consumption QTL 14 7.6 0.00003 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 8552807 Vie4 Viral induced encephalitis QTL 4 7.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 62933508 82490359 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 61418 Pia5 Pristane induced arthritis QTL 5 4.5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 62277855 128289560 Rat 631651 Bp124 Blood pressure QTL 124 3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 62879517 107879517 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 738016 Alc16 Alcohol consumption QTL 16 3.6 0.00015 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 4 59948935 154902892 Rat 1558651 Swd3 Spike wave discharge measurement QTL 3 4.62 0.000024 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 4 58432133 92991462 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1641833 Alc21 Alcohol consumption QTL 21 8.6 0.0001 drinking behavior trait (VT:0001422) ethanol drink intake rate (CMO:0001407) 4 56698790 126192555 Rat 631546 Bp86 Blood pressure QTL 86 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 57114432 91360801 Rat 6478743 Anxrr40 Anxiety related response QTL 40 0.83076 defecation behavior trait (VT:0010462) defecation rate (CMO:0000998) 4 62753847 107753847 Rat 7394826 Bw126 Body weight QTL 126 0.002 body mass (VT:0001259) body weight gain (CMO:0000420) 4 62933269 87483707 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 631671 Iddm11 Insulin dependent diabetes mellitus QTL 11 3.6 0.0012 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 4 58635877 78886137 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014010 ⟹ ENSRNOP00000014010
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 63,554,364 - 63,591,733 (-) Ensembl Rnor_6.0 Ensembl 4 62,398,797 - 62,438,958 (-) Ensembl
RefSeq Acc Id:
NM_001127298 ⟹ NP_001120770
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 64,521,504 - 64,558,873 (-) NCBI mRatBN7.2 4 63,554,364 - 63,591,733 (-) NCBI Rnor_6.0 4 62,398,797 - 62,438,958 (-) NCBI Rnor_5.0 4 62,130,769 - 62,166,447 (-) NCBI RGSC_v3.4 4 62,266,685 - 62,304,007 (-) RGD Celera 4 58,605,800 - 58,642,741 (-) RGD
Sequence:
GCGCGCGCGCGCAGCGATGGCGGAGGCGGTGGAGCGCACAGACGAGCTGGTCCGGGAGTACCTGCTCTTCCGTGGCTTCACGCACACACTGCGGCAGCTGGATGCCGAGATCAAGGCGGACAAAGAGA
hide sequence
RefSeq Acc Id:
NP_001120770 ⟸ NM_001127298
- UniProtKB:
B2RYI0 (UniProtKB/Swiss-Prot)
- Sequence:
MAEAVERTDELVREYLLFRGFTHTLRQLDAEIKADKEKGFRVDKIVDQLQQLMQVYDLAALRDYWSYLERRLFSRLEDIYRPTINKLKTSLFRFYLVYTIQTNRNDKAQEFFAKQATELQNQAEWKDW
hide sequence
Ensembl Acc Id:
ENSRNOP00000014010 ⟸ ENSRNOT00000014010
RGD ID: 13692957 Promoter ID: EPDNEW_R3481 Type: multiple initiation site Name: Wdr91_1 Description: WD repeat domain 91 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 62,438,968 - 62,439,028 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-07
Wdr91
WD repeat domain 91
RGD1306697_predicted
similar to HSPC049 protein (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
RGD1306697_predicted
similar to HSPC049 protein (predicted)
LOC312225_predicted
Symbol and Name status set to approved
1331353 APPROVED
2005-01-12
LOC312225_predicted
similar to HSPC049 protein (predicted)
Symbol and Name status set to provisional
70820 PROVISIONAL
