Advanced Search (OLGA)

Gene: Copz1 (COPI coat complex subunit zeta 1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Copz1

Name:

COPI coat complex subunit zeta 1

RGD ID:

1306154

Description:

Predicted to be involved in intra-Golgi vesicle-mediated transport; intracellular protein transport; and retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum. Predicted to be located in Golgi membrane. Predicted to be part of COPI vesicle coat. Orthologous to human COPZ1 (COPI coat complex subunit zeta 1); INTERACTS WITH 2,4-dinitrotoluene; 2,6-dinitrotoluene; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

coatomer protein complex, subunit zeta 1; coatomer subunit zeta-1; LOC315345

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	COPZ1 (COPI coat complex subunit zeta 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Mus musculus (house mouse):	Copz1 (coatomer protein complex, subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Copz1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	COPZ1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	COPZ1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Copz1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	COPZ1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	COPZ1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Copz1 (COPI coat complex subunit zeta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	COPZ2 (COPI coat complex subunit zeta 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	COPZ1 (COPI coat complex subunit zeta 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Copz1 (coatomer protein complex, subunit zeta 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	copz1 (coatomer protein complex, subunit zeta 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RET3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	copz-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	zetaCOP	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	copz1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI		GRCr8
mRatBN7.2	7	134,409,523 - 134,435,661 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	134,409,799 - 134,435,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	136,164,951 - 136,190,861 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	138,394,318 - 138,420,227 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	138,380,360 - 138,406,447 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	144,900,050 - 144,926,299 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	144,899,534 - 144,926,350 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	142,680,779 - 142,706,987 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	142,184,081 - 142,209,955 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	142,264,119 - 142,289,000 (+)	NCBI
Celera	7	130,835,003 - 130,860,877 (+)	NCBI		Celera
Cytogenetic Map	7	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Copz1	Rat	Neurodevelopmental Disorders		ISO	RGD:1314607	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Copz1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1314608	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPZ1 mRNA	CTD	PMID:22206623
Copz1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:1314608	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPZ1 mRNA	CTD	PMID:17942748
Copz1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1314608	6480464	Ethinyl Estradiol results in increased expression of COPZ1 mRNA	CTD	PMID:17942748
Copz1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	RGD:1314607	6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of COPZ1 protein	CTD	PMID:31675489
Copz1	Rat	2,3',4,4',5-Pentachlorobiphenyl	increases expression	ISO	RGD:1314608	6480464	2,3',4,4',5-pentachlorobiphenyl results in increased expression of COPZ1 mRNA	CTD	PMID:31388691
Copz1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1314608	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of COPZ1 mRNA	CTD	PMID:17942748
Copz1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1314608	6480464	Tetrachlorodibenzodioxin affects the expression of COPZ1 mRNA	CTD	PMID:21570461
Copz1	Rat	2,4,6-tribromophenol	decreases expression	ISO	RGD:1314607	6480464	2,4,6-tribromophenol results in decreased expression of COPZ1 mRNA	CTD	PMID:31675489
Copz1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of COPZ1 mRNA	CTD	PMID:21346803
Copz1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of COPZ1 mRNA	CTD	PMID:21346803
Copz1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:1314607	6480464	tetrabromobisphenol A results in decreased expression of COPZ1 protein	CTD	PMID:31675489
Copz1	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:1314608	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of COPZ1 mRNA	CTD	PMID:20188158
Copz1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1314607	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Copz1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Copz1	Rat	acrolein	multiple interactions	ISO	RGD:1314607	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Copz1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of COPZ1 mRNA	CTD	PMID:28959563
Copz1	Rat	alpha-pinene	multiple interactions	ISO	RGD:1314607	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268
Copz1	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1314607	6480464	arsenite promotes the reaction [G3BP1 protein binds to COPZ1 mRNA]	CTD	PMID:32406909
Copz1	Rat	atrazine	increases expression	ISO	RGD:1314607	6480464	Atrazine results in increased expression of COPZ1 mRNA	CTD	PMID:22378314
Copz1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:1314607	6480464	Benzo(a)pyrene results in decreased expression of COPZ1 mRNA	CTD	PMID:26238291
Copz1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1314608	6480464	Diethylhexyl Phthalate results in increased expression of COPZ1 mRNA	CTD	PMID:33754040
Copz1	Rat	bisphenol A	increases expression	ISO	RGD:1314607	6480464	bisphenol A results in increased expression of COPZ1 mRNA; bisphenol A results in increased expression more ...	CTD	PMID:25047013\|PMID:34186270\|PMID:37567409
Copz1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Copz1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of COPZ1 gene	CTD	PMID:28505145
Copz1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of COPZ1 mRNA	CTD	PMID:25181051
Copz1	Rat	bisphenol AF	increases expression	ISO	RGD:1314607	6480464	bisphenol AF results in increased expression of COPZ1 protein	CTD	PMID:34186270
Copz1	Rat	bisphenol F	multiple interactions	ISO	RGD:1314607	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Copz1	Rat	bisphenol F	increases expression	ISO	RGD:1314607	6480464	bisphenol F results in increased expression of COPZ1 protein	CTD	PMID:34186270
Copz1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Copz1	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of COPZ1 mRNA	CTD	PMID:19167457
Copz1	Rat	carbon nanotube	decreases expression	ISO	RGD:1314608	6480464	Nanotubes, Carbon results in decreased expression of COPZ1 mRNA	CTD	PMID:25620056
Copz1	Rat	chlorpyrifos	increases expression	ISO	RGD:1314608	6480464	Chlorpyrifos results in increased expression of COPZ1 mRNA	CTD	PMID:37019170
Copz1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1314607	6480464	Copper Sulfate results in decreased expression of COPZ1 mRNA	CTD	PMID:19549813
Copz1	Rat	crocidolite asbestos	decreases expression	ISO	RGD:1314608	6480464	Asbestos, Crocidolite results in decreased expression of COPZ1 mRNA	CTD	PMID:29279043
Copz1	Rat	crocidolite asbestos	increases expression	ISO	RGD:1314607	6480464	Asbestos, Crocidolite results in increased expression of COPZ1 mRNA	CTD	PMID:29523930
Copz1	Rat	cyclosporin A	increases expression	ISO	RGD:1314607	6480464	Cyclosporine results in increased expression of COPZ1 mRNA	CTD	PMID:20106945
Copz1	Rat	dexamethasone	multiple interactions	ISO	RGD:1314607	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Copz1	Rat	dextran sulfate	multiple interactions	ISO	RGD:1314608	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of COPZ1 protein]	CTD	PMID:35362542
Copz1	Rat	dextran sulfate	decreases expression	ISO	RGD:1314608	6480464	Dextran Sulfate results in decreased expression of COPZ1 protein	CTD	PMID:35362542
Copz1	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1314607	6480464	di-n-butylphosphoric acid affects the expression of COPZ1 mRNA	CTD	PMID:37042841
Copz1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of COPZ1 mRNA	CTD	PMID:21266533
Copz1	Rat	disodium selenite	increases expression	ISO	RGD:1314607	6480464	Sodium Selenite results in increased expression of COPZ1 mRNA	CTD	PMID:18175754
Copz1	Rat	ethanol	affects splicing	ISO	RGD:1314608	6480464	Ethanol affects the splicing of COPZ1 mRNA	CTD	PMID:30319688
Copz1	Rat	Evodiamine	multiple interactions	ISO	RGD:1314608	6480464	evodiamine inhibits the reaction [Dextran Sulfate results in decreased expression of COPZ1 protein]	CTD	PMID:35362542
Copz1	Rat	fenthion	increases expression	ISO	RGD:1314608	6480464	Fenthion results in increased expression of COPZ1 mRNA	CTD	PMID:34813904
Copz1	Rat	folic acid	multiple interactions	ISO	RGD:1314608	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of COPZ1 mRNA	CTD	PMID:22206623
Copz1	Rat	genistein	decreases expression	ISO	RGD:1314608	6480464	Genistein results in decreased expression of COPZ1 mRNA	CTD	PMID:32186404
Copz1	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of COPZ1 mRNA	CTD	PMID:24136188
Copz1	Rat	hydrazine	increases expression	ISO	RGD:1314608	6480464	hydrazine results in increased expression of COPZ1 mRNA	CTD	PMID:15282401
Copz1	Rat	indometacin	multiple interactions	ISO	RGD:1314607	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Copz1	Rat	ivermectin	decreases expression	ISO	RGD:1314607	6480464	Ivermectin results in decreased expression of COPZ1 protein	CTD	PMID:32959892
Copz1	Rat	ketoconazole	decreases expression	ISO	RGD:1314607	6480464	Ketoconazole results in decreased expression of COPZ1 mRNA	CTD	PMID:36621641
Copz1	Rat	methidathion	increases expression	ISO	RGD:1314608	6480464	methidathion results in increased expression of COPZ1 mRNA	CTD	PMID:34813904
Copz1	Rat	ozone	multiple interactions	ISO	RGD:1314607	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ...	CTD	PMID:32699268\|PMID:35430440
Copz1	Rat	p-toluidine	increases expression	EXP		6480464	4-toluidine results in increased expression of COPZ1 mRNA	CTD	PMID:27638505
Copz1	Rat	paracetamol	multiple interactions	ISO	RGD:1314608	6480464	PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of COPZ1 mRNA]	CTD	PMID:29246445
Copz1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of COPZ1 mRNA	CTD	PMID:33387578
Copz1	Rat	paracetamol	increases expression	ISO	RGD:1314608	6480464	Acetaminophen results in increased expression of COPZ1 mRNA	CTD	PMID:29246445
Copz1	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:1314608	6480464	perfluorooctanoic acid results in increased expression of COPZ1 protein	CTD	PMID:37422089
Copz1	Rat	rotenone	increases expression	ISO	RGD:1314607	6480464	Rotenone results in increased expression of COPZ1 mRNA	CTD	PMID:33512557
Copz1	Rat	sodium arsenite	decreases expression	ISO	RGD:1314607	6480464	sodium arsenite results in decreased expression of COPZ1 protein	CTD	PMID:30528433
Copz1	Rat	T-2 toxin	increases expression	ISO	RGD:1314607	6480464	T-2 Toxin results in increased expression of COPZ1 mRNA	CTD	PMID:31863870
Copz1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of COPZ1 mRNA	CTD	PMID:34492290
Copz1	Rat	urethane	decreases expression	ISO	RGD:1314607	6480464	Urethane results in decreased expression of COPZ1 mRNA	CTD	PMID:28818685
Copz1	Rat	valproic acid	affects expression	ISO	RGD:1314607	6480464	Valproic Acid affects the expression of COPZ1 mRNA	CTD	PMID:25979313
Copz1	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of COPZ1 mRNA	CTD	PMID:19015723
Copz1	Rat	vinclozolin	decreases expression	EXP		6480464	vinclozolin results in decreased expression of COPZ1 mRNA	CTD	PMID:23034163

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Copz1	Rat	intra-Golgi vesicle-mediated transport	involved_in	ISO	RGD:1314607	1624291	PMID:11056392	RGD	PMID:11056392
Copz1	Rat	intra-Golgi vesicle-mediated transport	involved_in	IEA	UniProtKB:P61923\|ensembl:ENSP00000262061	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Copz1	Rat	intra-Golgi vesicle-mediated transport	involved_in	IBA	PANTHER:PTN000868165\|UniProtKB:P35604\|UniProtKB:P61923	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Copz1	Rat	intracellular protein transport	involved_in	IEA	InterPro:IPR000804	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Copz1	Rat	intracellular protein transport	involved_in	IBA	PANTHER:PTN000868165\|WB:WBGene00010333	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Copz1	Rat	protein transport	involved_in	IEA	UniProtKB-KW:KW-0653	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Copz1	Rat	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	involved_in	IEA	UniRule:UR001184786	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Copz1	Rat	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	involved_in	IEA	InterPro:IPR039652	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Copz1	Rat	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	involved_in	IBA	PANTHER:PTN000868165\|SGD:S000005931	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Copz1	Rat	vesicle-mediated transport	involved_in	IEA	InterPro:IPR000804	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Copz1	Rat	vesicle-mediated transport	involved_in	IEA	UniProtKB-KW:KW-0931	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Copz1	Rat	COPI vesicle coat	part_of	ISO	RGD:1314607	1624291	PMID:11056392, PMID:14729954	RGD	PMID:11056392\|PMID:14729954
Copz1	Rat	COPI vesicle coat	part_of	IEA	UniProtKB:P61923\|ensembl:ENSP00000262061	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Copz1	Rat	COPI vesicle coat	part_of	IBA	PANTHER:PTN000868165\|SGD:S000005931\|UniProtKB:P35604\|UniProtKB:P61923\|UniProtKB:Q9P299	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Copz1	Rat	COPI vesicle coat	part_of	IEA	UniRule:UR001184786	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Copz1	Rat	COPI vesicle coat	part_of	IEA	InterPro:IPR039652	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Copz1	Rat	COPI-coated vesicle membrane	located_in	IEA	UniProtKB-SubCell:SL-0076	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Copz1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Copz1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Copz1	Rat	cytoplasmic vesicle	located_in	IEA	UniProtKB-KW:KW-0968	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Copz1	Rat	Golgi apparatus	located_in	IEA	UniProtKB-KW:KW-0333	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Copz1	Rat	Golgi membrane	located_in	IEA	UniProtKB-SubCell:SL-0134	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Copz1	Rat	Golgi membrane	located_in	IEA	UniRule:UR001184786	1600115	GO_REF:0000104	UniProt	GO_REF:0000104
Copz1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Copz1	Rat	membrane coat	part_of	IEA	InterPro:IPR000804	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:11056392	PMID:12477932	PMID:14729954	PMID:17360540	PMID:23716698

Copz1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI		GRCr8
mRatBN7.2	7	134,409,523 - 134,435,661 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	134,409,799 - 134,435,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	136,164,951 - 136,190,861 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	138,394,318 - 138,420,227 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	138,380,360 - 138,406,447 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	144,900,050 - 144,926,299 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	144,899,534 - 144,926,350 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	142,680,779 - 142,706,987 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	142,184,081 - 142,209,955 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	142,264,119 - 142,289,000 (+)	NCBI
Celera	7	130,835,003 - 130,860,877 (+)	NCBI		Celera
Cytogenetic Map	7	q36	NCBI

COPZ1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	12	54,325,131 - 54,351,846 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	12	54,301,202 - 54,351,846 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	12	54,718,915 - 54,745,630 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	12	53,005,178 - 53,031,900 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	12	53,005,177 - 53,031,900	NCBI
Celera	12	54,370,906 - 54,397,483 (+)	NCBI		Celera
Cytogenetic Map	12	q13.13	NCBI
HuRef	12	51,758,072 - 51,784,766 (+)	NCBI		HuRef
CHM1_1	12	54,685,611 - 54,712,337 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	12	54,291,719 - 54,318,429 (+)	NCBI		T2T-CHM13v2.0

Copz1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	103,181,261 - 103,208,295 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	103,181,141 - 103,208,295 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	103,272,888 - 103,299,865 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	103,272,714 - 103,299,868 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	103,103,349 - 103,130,296 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	103,100,952 - 103,127,899 (+)	NCBI		MGSCv36	mm8
Celera	15	105,435,330 - 105,462,717 (+)	NCBI		Celera
Cytogenetic Map	15	F3	NCBI
cM Map	15	58.74	NCBI

Copz1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955458	1,568,968 - 1,595,026 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955458	1,569,077 - 1,592,851 (+)	NCBI	ChiLan1.0	ChiLan1.0

COPZ1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	10	39,819,646 - 39,846,382 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	12	39,816,412 - 39,843,147 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	12	34,392,373 - 34,419,119 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	12	35,117,991 - 35,145,050 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	12	35,117,991 - 35,145,050 (-)	Ensembl	panpan1.1		panPan2

COPZ1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	27	963,047 - 983,102 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	27	45,272,316 - 45,292,137 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	27	960,458 - 979,850 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	27	960,663 - 979,776 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	27	978,807 - 998,914 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	27	960,817 - 980,538 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	27	45,676,211 - 45,695,959 (+)	NCBI		UU_Cfam_GSD_1.0

Copz1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	61,620,109 - 61,644,778 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936512	11,520,095 - 11,544,720 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936512	11,520,085 - 11,544,722 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

COPZ1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	19,522,613 - 19,542,372 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	19,522,567 - 19,542,373 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	20,379,779 - 20,399,559 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

COPZ1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	11	50,440,961 - 50,468,457 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	11	50,441,026 - 50,467,199 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	195,572,494 - 195,599,605 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Copz1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624904	2,350,989 - 2,372,824 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624904	2,351,010 - 2,374,284 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Copz1
152 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	138
Count of miRNA genes:	103
Interacting mature miRNAs:	116
Transcripts:	ENSRNOT00000065270
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	43747012	135012528	Rat
1354582	Stl11	Serum triglyceride level QTL 11	3.42		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	7	119513385	135012528	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	96670164	135012528	Rat
1300112	Bp183	Blood pressure QTL 183	3.51		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	7	111182207	135012528	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat
2306821	Bp335	Blood pressure QTL 335		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	106571501	135012528	Rat
631663	Bw6	Body weight QTL 6	3.4		body mass (VT:0001259)	body weight (CMO:0000012)	7	111075573	134976056	Rat
2299163	Iddm34	Insulin dependent diabetes mellitus QTL 34	2.71		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	7	91281130	135012528	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	64002457	135012528	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	90482196	135012528	Rat
731174	Uae23	Urinary albumin excretion QTL 23	2.4	0.0042	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	7	104603555	135012528	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	83591953	134666232	Rat

BF403379

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	134,415,462 - 134,415,698 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	144,905,769 - 144,906,004	NCBI	Rnor6.0
Rnor_5.0	7	142,686,457 - 142,686,692	UniSTS	Rnor5.0
RGSC_v3.4	7	142,189,759 - 142,189,994	UniSTS	RGSC3.4
Celera	7	130,840,681 - 130,840,916	UniSTS
RH 3.4 Map	7	1065.7	UniSTS
Cytogenetic Map	7	q36	UniSTS

BF406339

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	134,434,587 - 134,434,795 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	144,925,226 - 144,925,433	NCBI	Rnor6.0
Rnor_5.0	7	142,705,914 - 142,706,121	UniSTS	Rnor5.0
RGSC_v3.4	7	142,208,882 - 142,209,089	UniSTS	RGSC3.4
Celera	7	130,859,804 - 130,860,011	UniSTS
RH 3.4 Map	7	1120.2	UniSTS
Cytogenetic Map	7	q36	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001108117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017594903	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079350	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_010052988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226451	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234671	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000065270 ⟹ ENSRNOP00000059082

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,823 - 134,435,661 (+)	Ensembl
Rnor_6.0 Ensembl	7	144,899,534 - 144,926,350 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000100400 ⟹ ENSRNOP00000092493

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,809 - 134,435,653 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102900 ⟹ ENSRNOP00000078441

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,799 - 134,435,662 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105195 ⟹ ENSRNOP00000089098

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,799 - 134,435,661 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113362 ⟹ ENSRNOP00000086292

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,803 - 134,435,446 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118492 ⟹ ENSRNOP00000094720

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	134,409,809 - 134,435,653 (+)	Ensembl

RefSeq Acc Id:

NM_001108117 ⟹ NP_001101587

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	136,288,257 - 136,314,131 (+)	NCBI
mRatBN7.2	7	134,409,784 - 134,435,661 (+)	NCBI
Rnor_6.0	7	144,900,091 - 144,926,299 (+)	NCBI
Rnor_5.0	7	142,680,779 - 142,706,987 (+)	NCBI
RGSC_v3.4	7	142,184,081 - 142,209,955 (+)	RGD
Celera	7	130,835,003 - 130,860,877 (+)	RGD

Sequence:

show sequence

GCGGCGACGTCGCTTGTGCGACTCCACGTCGGCAGCAGCTACGGGCAAGATGGAGGCGCTGATTTTGGAGCCCTCCCTGTACACTGTCAAGGCCATCCTGATTCTGGACAATGACGGAGACCGACTCT
TCGCCAAGTACTATGACGACACCTACCCCAGTGTCAAGGAGCAAAAAGCCTTTGAGAAGAACATTTTCAACAAGACCCATCGGACGGATAGTGAAATCGCCCTGTTGGAAGGGCTGACAGTGGTCTAT
AAAAGCAGCATTGATCTCTATTTCTATGTGATCGGCAGCTCCTATGAAAACGAGCTGATGCTCATGGCTGTTCTGAACTGCCTCTTCGACTCCCTGAGCCAGATGCTGAGAAAAAACGTAGAAAAGCG
AGCTTTGCTGGAGAACATGGAGGGGCTCTTCTTGGCTGTGGATGAAATTGTAGATGGAGGGGTGATCCTAGAGAGCGACCCCCAGCAAGTGGTGCACCGGGTAGCTTTGAGGGGTGAAGACGTCCCCC
TTACAGAGCAGACCGTGTCTCAGGTGCTGCAGTCAGCCAAAGAGCAGATCAAATGGTCCCTCCTTCGGTGAAGGTGTTCTGAGCCCAGTTCCTTGCCCCTCAAAGCCCACATCTGCTGTGACTTCTTA
TCCAGGCCCCCCAACTTACGTCCTTAGGGTCATCTTGGAGAATTGCAATGGATTCTTGTGTCTCATACTTTCTGGGGTTCTTTCCCCTCCCTCTCATGAGAGTAAAGTCCCCAGCATATTTGAGTGAG
TCAGAGAAAACACCCTCGTCCTACTTACACTGGTCTCGTCCCCCCTATCCCCCCCTCAAATCCCCCATTCTCTCCTTGGTTTCTTGGCCCTTTACTGTGGCTGTACTTTAGATCAACAAAGTAAGAGA
AAGAATGTGCTGAGTGTTTTCTTCCCTGTGCCTTAAGGGCCCTCATCCCAGCAGCCCATATATCCAGCAAAGGGAGGACTACTATCTTCAGCACAAGTGGGTTTGGAGTGGCAGAGGCCATATGTTCT
TTGCCGCAGCTTCTCTCCTTCCTGCTGCCCTATCCTCTGCCTTAGAAGAAATGGGAACACCTTATAGGGAGTGGACAGAGCTGCAGAGGAACCGTGATTTAAAGGCTCTTGGAGTTATGAAGTGCATC
CTCTACCCTGATCTGGCCTTCAGCCTCCAAGCTGCTATACCTGCACGTGGTCCTGAGAACATCTCTCTAGGTCTGTACCACACCTCTCTGCCTGTATCACCTGTGAGATCTTTGCCTGGTGTGGCCTC
TGTCACCCTGGAGCAAAACCAGACCTTGGAACTAAAACTACTTTAGTCCCTAGAAAAGTTTATGCTCAGAACTGAGGAAGGAAAGGGCCTAATGGTGTTTGCCTTGCTGTGTTCCTTCTACTCAGCGT
CACACTCACATTCCTCTGCCTTGGTTCTACAATCTGCTGTTGAGTTCCCCCTCTCTGCATCAGTCTTCCCTAGAAGCAGGGGGTCTGGTGCAGTGCCTTTCCTCTGAGGCTTGGATTCCTGTTCTTGG
GTGTAATGTTGCCCCTTGACCCCACATCCCTGTGAAAATGACTTGGAAAAAAAAAAAAAACGTTTCTGAGCAAGCATTCTGCTTCATGCATTGGCTGAAGTGGGCAGACTGAAGGCGGCCTCTGCAAG
AAATGGAGTCAGGCGAAGTCCACCTTGTACACTGCTGTGCAGCAGAGGAATAAAGAATCTCTTCCAAA

hide sequence

RefSeq Acc Id:

XM_017594903 ⟹ XP_017450392

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI
mRatBN7.2	7	134,409,694 - 134,434,427 (+)	NCBI
Rnor_6.0	7	144,900,050 - 144,925,086 (+)	NCBI

Sequence:

show sequence

CTTCTTTGGGGCGGGATCTAGCGAAGACTCAGGGCCAATCAGCGGCGACGTCGCTTGTGCGACTCCACGTCGGCAGCAGCTACGGGCAAGATGGAGGCGCTGATTTTGGAGCCCTCCCTGTACACTGT
CAAGGCCATCCTGATTCTGGACAATGACGGAGACCGACTCTTCGCCAAGTACTATGACGACACCTACCCCAGTGTCAAGGAGCAAAAAGCCTTTGAGAAGAACATTTTCAACAAGACCCATCGGACGG
ATAGTGAAATCGCCCTGTTGGAAGGGCTGACAGTGGTCTATAAAAGCAGCATTGATCTCTATTTCTATGTGATCGGCAGCTCCTATGAAAACGAGCTGATGCTCATGGCTGTTCTGAACTGCCTCTTC
GACTCCCTGAGCCAGATGCTGAGAAAAAACGTAGAAAAGCGAGCTTTGCTGGAGAACATGGAGGGGCTCTTCTTGGCTGTGGATGAAATTGTAGATGGAGGGGTGATCCTAGAGAGCGACCCCCAGCA
AGTGGTGCACCGGGTAGCTTTGAGGGGTGAAGACGTCCCCCTTACAGAGCAGACCGTGTCTCAGGTATATCTCTTCTCTCTTCATCCCCCCAGTGGATTTGAATTCGGGGGGAATTTCCCAAACTGAC
AATCCTCTAGGGCCTTAGAGAGCTTCCTCCTATTCTTCCACCCTTGGGATTTTCTATCCCCTGTTCTTCTAAGGAGAGGGAAGGCAAGTGTGGGGAAGGAGAGCCTCAGCCTGCTCACTCCCTGCGGT
TTGCAAGCCCCCCTCAGTGCT

hide sequence

RefSeq Acc Id:

XM_039079350 ⟹ XP_038935278

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI
mRatBN7.2	7	134,409,523 - 134,434,457 (+)	NCBI

RefSeq Acc Id:

XM_039079351 ⟹ XP_038935279

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI
mRatBN7.2	7	134,409,661 - 134,434,885 (+)	NCBI

RefSeq Acc Id:

XR_010052988

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	136,287,696 - 136,314,131 (+)	NCBI


Protein RefSeqs	NP_001101587	(Get FASTA)	NCBI Sequence Viewer
	XP_017450392	(Get FASTA)	NCBI Sequence Viewer
	XP_038935278	(Get FASTA)	NCBI Sequence Viewer
	XP_038935279	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL86787	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000059082
	ENSRNOP00000059082.2
	ENSRNOP00000078441
	ENSRNOP00000078441.1
	ENSRNOP00000086292
	ENSRNOP00000086292.1
	ENSRNOP00000089098.1
	ENSRNOP00000092493.1
	ENSRNOP00000094720.1

RefSeq Acc Id:	NP_001101587 ⟸ NM_001108117
- UniProtKB:	A0A8I6GK73 (UniProtKB/TrEMBL), A6KD05 (UniProtKB/TrEMBL), A0A8I5ZKX4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEI VDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSLLR hide sequence

RefSeq Acc Id:	XP_017450392 ⟸ XM_017594903
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GES6 (UniProtKB/TrEMBL), D4A8T3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEG LTVVYKSSIDLYFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVYLFSLHPPSGFEFGGNFPN hide sequence

Ensembl Acc Id:

ENSRNOP00000059082 ⟸ ENSRNOT00000065270

RefSeq Acc Id:	XP_038935278 ⟸ XM_039079350
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038935279 ⟸ XM_039079351
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AMR7 (UniProtKB/TrEMBL)

Protein Domains

AP complex mu/sigma subunit

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A8T3-F1-model_v2	AlphaFold	D4A8T3	1-177	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13695714

Promoter ID:

EPDNEW_R6239

Type:

multiple initiation site

Name:

Copz1_1

Description:

coatomer protein complex, subunit zeta 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	7	144,900,117 - 144,900,177	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-31882	BioCyc
Ensembl Genes	ENSRNOG00000036835	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000065270	ENTREZGENE
	ENSRNOT00000065270.3	UniProtKB/TrEMBL
	ENSRNOT00000100400.1	UniProtKB/TrEMBL
	ENSRNOT00000102900	ENTREZGENE
	ENSRNOT00000102900.1	UniProtKB/TrEMBL
	ENSRNOT00000105195	ENTREZGENE
	ENSRNOT00000105195.1	UniProtKB/TrEMBL
	ENSRNOT00000113362	ENTREZGENE
	ENSRNOT00000113362.1	UniProtKB/TrEMBL
	ENSRNOT00000118492.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.450.60	UniProtKB/TrEMBL
InterPro	AP_mu_sigma_su	UniProtKB/TrEMBL
	Clathrin_sm-chain_CS	UniProtKB/TrEMBL
	Coatomer_zeta	UniProtKB/TrEMBL
	Longin-like	UniProtKB/TrEMBL
KEGG Report	rno:315345	UniProtKB/TrEMBL
NCBI Gene	315345	ENTREZGENE
PANTHER	COATOMER SUBUNIT ZETA-1	UniProtKB/TrEMBL
	PTHR11043	UniProtKB/TrEMBL
Pfam	Clat_adaptor_s	UniProtKB/TrEMBL
PhenoGen	Copz1	PhenoGen
PROSITE	CLAT_ADAPTOR_S	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000036835	RatGTEx
Superfamily-SCOP	Longin_like	UniProtKB/TrEMBL
UniProt	A0A8I5ZKX4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A7F9_RAT	UniProtKB/TrEMBL
	A0A8I6AMR7	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GES6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6GK73	ENTREZGENE, UniProtKB/TrEMBL
	A6KD05	ENTREZGENE, UniProtKB/TrEMBL
	D4A8T3	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-11-11	Copz1	COPI coat complex subunit zeta 1	Copz1	coatomer protein complex, subunit zeta 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Copz1	coatomer protein complex, subunit zeta 1	Copz1_predicted	coatomer protein complex, subunit zeta 1 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Copz1_predicted	coatomer protein complex, subunit zeta 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar