Tmed6 (transmembrane p24 trafficking protein 6)

Advanced Search (OLGA)

Gene: Tmed6 (transmembrane p24 trafficking protein 6) Rattus norvegicus

Analyze

Symbol:

Tmed6

Name:

transmembrane p24 trafficking protein 6

RGD ID:

1305260

Description:

Predicted to be involved in Golgi organization; endoplasmic reticulum to Golgi vesicle-mediated transport; and intracellular protein transport. Predicted to be located in endoplasmic reticulum membrane. Predicted to be active in several cellular components, including COPII-coated ER to Golgi transport vesicle; Golgi apparatus; and endoplasmic reticulum-Golgi intermediate compartment. Orthologous to human TMED6 (transmembrane p24 trafficking protein 6); INTERACTS WITH amitrole; bisphenol A; dibutyl phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291991; RGD1305260; similar to RIKEN cDNA 1810015P03; transmembrane emp24 domain-containing protein 6; transmembrane emp24 protein transport domain containing 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	51,876,561 - 51,882,648 (-)	NCBI		GRCr8
mRatBN7.2	19	34,966,813 - 34,972,900 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	34,966,813 - 34,972,900 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	41,782,291 - 41,788,378 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	42,435,638 - 42,441,725 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	44,734,666 - 44,740,770 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	39,261,841 - 39,267,928 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	39,261,841 - 39,267,928 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	50,125,752 - 50,132,047 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	36,919,407 - 36,925,919 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	36,924,402 - 36,930,795 (-)	NCBI
Celera	19	34,390,446 - 34,396,533 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 6 (ISO)

Chromosome 16q12 Duplication Syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

aflatoxin B1 (ISO)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

dimethylarsinic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

GW 4064 (ISO)

hydrogen peroxide (ISO)

lead(0) (ISO)

leflunomide (ISO)

methimazole (EXP)

methylarsonic acid (ISO)

N-nitrosodiethylamine (ISO)

pirinixic acid (ISO)

quercetin (ISO)

resveratrol (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

trimellitic anhydride (ISO)

urethane (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

endoplasmic reticulum to Golgi vesicle-mediated transport (IBA)

Golgi organization (IBA)

intracellular protein transport (IBA)

Cellular Component

COPII-coated ER to Golgi transport vesicle (IBA)

endoplasmic reticulum (IBA)

endoplasmic reticulum membrane (IEA)

endoplasmic reticulum-Golgi intermediate compartment (IBA)

Golgi apparatus (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:22129529

Genomics

Comparative Map Data

Tmed6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	51,876,561 - 51,882,648 (-)	NCBI		GRCr8
mRatBN7.2	19	34,966,813 - 34,972,900 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	34,966,813 - 34,972,900 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	41,782,291 - 41,788,378 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	42,435,638 - 42,441,725 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	44,734,666 - 44,740,770 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	39,261,841 - 39,267,928 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	39,261,841 - 39,267,928 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	50,125,752 - 50,132,047 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	36,919,407 - 36,925,919 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	36,924,402 - 36,930,795 (-)	NCBI
Celera	19	34,390,446 - 34,396,533 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

TMED6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	69,343,250 - 69,351,786 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	16	69,343,250 - 69,351,786 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	69,377,153 - 69,385,689 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	67,934,661 - 67,943,190 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	67,934,660 - 67,943,190	NCBI
Celera	16	53,891,689 - 53,900,252 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	55,254,923 - 55,263,485 (-)	NCBI		HuRef
CHM1_1	16	70,785,165 - 70,793,728 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	75,144,944 - 75,153,477 (-)	NCBI		T2T-CHM13v2.0

Tmed6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	107,788,116 - 107,792,276 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	107,788,108 - 107,792,276 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	107,061,484 - 107,065,644 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	107,061,476 - 107,065,644 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	109,585,384 - 109,589,544 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	109,950,613 - 109,954,773 (-)	NCBI		MGSCv36	mm8
Celera	8	111,288,213 - 111,292,349 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI
cM Map	8	53.58	NCBI

Tmed6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	7,346,942 - 7,354,695 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	7,346,942 - 7,354,695 (+)	NCBI	ChiLan1.0	ChiLan1.0

TMED6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	18	78,887,717 - 78,896,377 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	16	84,799,336 - 84,811,529 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	16	49,717,583 - 49,726,836 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	16	69,103,720 - 69,112,535 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	69,103,720 - 69,112,535 (-)	Ensembl	panpan1.1		panPan2

TMED6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	80,305,804 - 80,313,307 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	80,296,746 - 80,303,634 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	80,740,345 - 80,747,244 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	80,741,125 - 80,747,027 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	80,567,491 - 80,574,373 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	80,250,325 - 80,257,215 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	80,889,920 - 80,896,810 (+)	NCBI		UU_Cfam_GSD_1.0

Tmed6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	40,119,751 - 40,129,270 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	19,459,883 - 19,467,368 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936475	19,459,873 - 19,468,747 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TMED6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	17,634,366 - 17,641,903 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	17,633,653 - 17,641,915 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	16,580,399 - 16,588,628 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TMED6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	58,054,903 - 58,063,685 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	58,055,595 - 58,062,917 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	20,784,894 - 20,793,480 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tmed6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	17,023,955 - 17,031,619 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	17,024,204 - 17,031,358 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tmed6
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	20
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000027686
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	33838214	55283146	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat

Markers in Region

RH131423

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	34,966,815 - 34,966,967 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	39,261,844 - 39,261,995	NCBI	Rnor6.0
Rnor_5.0	19	50,125,755 - 50,125,906	UniSTS	Rnor5.0
RGSC_v3.4	19	36,919,410 - 36,919,561	UniSTS	RGSC3.4
Celera	19	34,390,449 - 34,390,600	UniSTS
RH 3.4 Map	19	314.6	UniSTS
Cytogenetic Map	19	q12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	9	35	65	66	37	24	37	3	142	46	21	45	54	29

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC124839	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027686 ⟹ ENSRNOP00000027686

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	34,966,813 - 34,972,900 (-)	Ensembl
Rnor_6.0 Ensembl	19	39,261,841 - 39,267,928 (-)	Ensembl

RefSeq Acc Id:

NM_001106183 ⟹ NP_001099653

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	51,876,561 - 51,882,648 (-)	NCBI
mRatBN7.2	19	34,966,813 - 34,972,900 (-)	NCBI
Rnor_6.0	19	39,261,841 - 39,267,928 (-)	NCBI
Rnor_5.0	19	50,125,752 - 50,132,047 (-)	NCBI
RGSC_v3.4	19	36,919,407 - 36,925,919 (-)	RGD
Celera	19	34,390,446 - 34,396,533 (-)	RGD

Sequence:

show sequence

GTAACTCACCTGCAGAAGAATCCACAGAAGGCAGCATGTTCGCTTTGCTTCTTGAGGCTGGGCT
GGTGGTTCTGAGCCTAGTGACTTCTGCTAAGAGCCAGAGGACAGATCCCCTACATGGCTCCAAG
GACCAGCCCCTCCTCCGTGGAGCTGACCGACATGACTTTGCCATCGTGGTCCATCCGGGAAACA
CAGAATGTTTCTGGCAATTTGCTGACCAGATGGGATACCTGTACTTCAGCTATGAGGTTCAGCG
CACTCTTGGAATGTCACATGACCGCCACATTGTTGCCACGGCACATACCCCACAGGGTTTCCTT
ATTGACACCTCCCAGGATGTTCGGGGCCAGATTAACTTTGCTACACAAGAGACAGGTTTCTATC
AGCTTTGTCTAAAAAATGAGCAGAATCGCTTCAGTTCTATACAAGTGTATCTCAACTTCGGAGT
CTTCTATGAGGGGCCCGAGATGGATCATAAACAGAGTCAAAGAAAACAGCTGAACGATACTCTG
GACGCCATAGAGGACAGTACCCGGAGGGTGCAGAACCACGTTTTCCACATGTGGCGCTTCTACA
ACTCTGCCAGGATGAGGAAGGTGGCTGACTTTTTCCTCCTGCAGTCTAACTACAGCTATGTGAA
CTGGTGGTCCACAGCTCAGAGCCTTGCTATTGTTCTTTCCGGGGTCCTCCAGCTCTATTTCCTG
AAACGGCTTTTCACCATCTCAACTGACACAAAGAAGCCAAGATGCTAACATAGAGCATTATATG
TCAAAGATTTGATCAAATCAGCTTTGTTAAGTTATTGGGGTGGAAAAAGTCAATTTAAATCCCG
TCTCTGAGTCCATCAATAAAGGCAATGGCAGTAAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001099653	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL92469	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027686.4

RefSeq Acc Id:	NP_001099653 ⟸ NM_001106183
- Peptide Label:	precursor
- UniProtKB:	D3ZJV9 (UniProtKB/TrEMBL), A6IYZ1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFALLLEAGLVVLSLVTSAKSQRTDPLHGSKDQPLLRGADRHDFAIVVHPGNTECFWQFADQMG YLYFSYEVQRTLGMSHDRHIVATAHTPQGFLIDTSQDVRGQINFATQETGFYQLCLKNEQNRFS SIQVYLNFGVFYEGPEMDHKQSQRKQLNDTLDAIEDSTRRVQNHVFHMWRFYNSARMRKVADFF LLQSNYSYVNWWSTAQSLAIVLSGVLQLYFLKRLFTISTDTKKPRC hide sequence

Ensembl Acc Id:

ENSRNOP00000027686 ⟸ ENSRNOT00000027686

Protein Domains

GOLD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZJV9-F1-model_v2	AlphaFold	D3ZJV9	1-238	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701121

Promoter ID:

EPDNEW_R11645

Type:

multiple initiation site

Name:

Tmed6_1

Description:

transmembrane p24 trafficking protein 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	39,267,921 - 39,267,981	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1305260	AgrOrtholog
BioCyc Gene	G2FUF-5764	BioCyc
Ensembl Genes	ENSRNOG00000020406	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027686.6	UniProtKB/TrEMBL
InterPro	GOLD	UniProtKB/TrEMBL
	TMP21-related	UniProtKB/TrEMBL
KEGG Report	rno:291991	UniProtKB/TrEMBL
NCBI Gene	291991	ENTREZGENE
PANTHER	PTHR22811	UniProtKB/TrEMBL
	TRANSMEMBRANE EMP24 DOMAIN-CONTAINING PROTEIN 6	UniProtKB/TrEMBL
Pfam	EMP24_GP25L	UniProtKB/TrEMBL
PhenoGen	Tmed6	PhenoGen
PROSITE	GOLD	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000020406	RatGTEx
SMART	EMP24_GP25L	UniProtKB/TrEMBL
UniProt	A6IYZ1	ENTREZGENE, UniProtKB/TrEMBL
	D3ZJV9	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Tmed6	transmembrane p24 trafficking protein 6	Tmed6	transmembrane emp24 protein transport domain containing 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Tmed6	transmembrane emp24 protein transport domain containing 6	Tmed6_predicted	transmembrane emp24 protein transport domain containing 6 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-30	Tmed6_predicted	transmembrane emp24 protein transport domain containing 6 (predicted)	RGD1305260_predicted	similar to RIKEN cDNA 1810015P03 (predicted)	Symbol and Name updated	1299863	APPROVED
2005-01-20	RGD1305260_predicted	similar to RIKEN cDNA 1810015P03 (predicted)	LOC291991_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291991_predicted	similar to RIKEN cDNA 1810015P03 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar