Advanced Search (OLGA)

Gene: Ndufs4 (NADH:ubiquinone oxidoreductase subunit S4) Ictidomys tridecemlineatus

Subscribe to Updates

Analyze

Symbol:

Ndufs4

Name:

NADH:ubiquinone oxidoreductase subunit S4

RGD ID:

12624650

Description:

ENCODES a protein that exhibits NADH dehydrogenase (ubiquinone) activity (ortholog); INVOLVED IN adult behavior (ortholog); adult walking behavior (ortholog); brain development (ortholog); ASSOCIATED WITH brain disease (ortholog); COVID-19 (ortholog); developmental coordination disorder (ortholog); FOUND IN mitochondrial inner membrane (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

SpeTri2.0 - Squirrel SpeTri2.0 Assembly

Position:

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	204,892,598 - 204,995,733 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	13,827,743 - 13,932,238 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	13,829,093 - 13,932,202 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	COVID-19		ISO	NDUFS4 (Homo sapiens)	9068941	mRNA:increased expression:peripheral blood mononuclear cell (human)	RGD	PMID:32228226 and REF_RGD_ID:28912744
Ndufs4	Squirrel	Metabolic Brain Diseases, Inborn		ISO	Ndufs4 (Mus musculus)	9068941		RGD	PMID:18396137 and REF_RGD_ID:6484689
Ndufs4	Squirrel	Parkinson's disease		ISO	Ndufs4 (Mus musculus)	9068941		RGD	PMID:21383081 and REF_RGD_ID:6484691

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	genetic disease		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:11165261 more ...
Ndufs4	Squirrel	lactic acidosis		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Lactic acidosis	ClinVar	PMID:25741868 and PMID:33093004
Ndufs4	Squirrel	Leigh disease		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:10944442 more ...
Ndufs4	Squirrel	Leigh disease		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10944442 more ...
Ndufs4	Squirrel	Leigh disease		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10944442 more ...
Ndufs4	Squirrel	mitochondrial complex I deficiency		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:10944442 more ...
Ndufs4	Squirrel	Neurodevelopmental Disorders		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Ndufs4	Squirrel	nuclear type mitochondrial complex I deficiency 1		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mitochondrial complex I deficiency and nuclear type 1	ClinVar	PMID:10944442 more ...
Ndufs4	Squirrel	Subacute Necrotizing Encephalopathy of Leigh, Infantile		ISO	NDUFS4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh's necrotizing encephalopathy	ClinVar	PMID:25741868 and PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	brain disease		ISO	NDUFS4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:24935635
Ndufs4	Squirrel	developmental coordination disorder		ISO	NDUFS4 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:24935635

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	nuclear type mitochondrial complex I deficiency 1		ISO	NDUFS4 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	adult behavior	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:28327638	MGI	PMID:28327638
Ndufs4	Squirrel	adult walking behavior	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:26363424	MGI	PMID:26363424
Ndufs4	Squirrel	brain development	involved_in	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	brain development	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:28916769	MGI	PMID:28916769
Ndufs4	Squirrel	cellular response to oxygen levels	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:26437605	MGI	PMID:26437605
Ndufs4	Squirrel	cognition	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:28327638	MGI	PMID:28327638
Ndufs4	Squirrel	dopamine metabolic process	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:28327638	MGI	PMID:28327638
Ndufs4	Squirrel	electron transport chain	involved_in	IEA	InterPro:IPR006885	150520179		InterPro	GO_REF:0000002
Ndufs4	Squirrel	inflammatory response	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:25652399	MGI	PMID:25652399
Ndufs4	Squirrel	innate immune response	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:25652399	MGI	PMID:25652399
Ndufs4	Squirrel	mitochondrial respiratory chain complex I assembly	involved_in	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	mitochondrial respiratory chain complex I assembly	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:18396137	MGI	PMID:18396137
Ndufs4	Squirrel	neuron apoptotic process	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:25652399	MGI	PMID:25652399
Ndufs4	Squirrel	neuron development	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:26363424	MGI	PMID:26363424
Ndufs4	Squirrel	proton transmembrane transport	involved_in	IEA	GO:0008137	150520179		GOC	GO_REF:0000108
Ndufs4	Squirrel	psychomotor behavior	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:28327638	MGI	PMID:28327638
Ndufs4	Squirrel	reactive oxygen species metabolic process	involved_in	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	reactive oxygen species metabolic process	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:29501746	MGI	PMID:29501746
Ndufs4	Squirrel	regulation of mitochondrial membrane potential	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:26712463	MGI	PMID:26712463
Ndufs4	Squirrel	regulation of protein phosphorylation	acts_upstream_of_or_within	ISO	NDUFS4 (Homo sapiens)	9068941	PMID:11165261	MGI	PMID:11165261
Ndufs4	Squirrel	respiratory electron transport chain	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:30391276	MGI	PMID:30391276
Ndufs4	Squirrel	respiratory system process	acts_upstream_of_or_within	ISO	MGI:3527173	9068941	PMID:28327638	MGI	PMID:28327638
Ndufs4	Squirrel	response to cAMP	involved_in	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	response to injury involved in regulation of muscle adaptation	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:29501746	MGI	PMID:29501746
Ndufs4	Squirrel	sensory perception of sound	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:18396137	MGI	PMID:18396137
Ndufs4	Squirrel	visual perception	acts_upstream_of_or_within	ISO	MGI:3793713	9068941	PMID:25652399	MGI	PMID:25652399

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
Ndufs4	Squirrel	mitochondrial inner membrane	is_active_in	ISO	Ndufs4 (Mus musculus)	9068941	PMID:38575788	UniProt	PMID:38575788
Ndufs4	Squirrel	mitochondrial inner membrane	located_in	IEA	UniProtKB-KW:KW-0999	150520179		UniProt	GO_REF:0000043
Ndufs4	Squirrel	mitochondrial inner membrane	located_in	IEA	UniProtKB-SubCell:SL-0168	150520179		UniProt	GO_REF:0000044
Ndufs4	Squirrel	mitochondrial inner membrane	located_in	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	150520179		UniProt	GO_REF:0000043
Ndufs4	Squirrel	mitochondrion	located_in	IEA	UniProtKB:A0A0S2Z433 more ...	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	respiratory chain complex I	part_of	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ndufs4	Squirrel	NADH dehydrogenase (ubiquinone) activity	contributes_to	ISO	NDUFS4 (Homo sapiens)	9068941	PMID:15038602 and PMID:16870178	UniProtKB	PMID:15038602 and PMID:16870178
Ndufs4	Squirrel	NADH dehydrogenase (ubiquinone) activity	enables	IEA	UniProtKB:O43181 and ensembl:ENSP00000296684	150520179		Ensembl	GO_REF:0000107
Ndufs4	Squirrel	protein binding	enables	ISO	UniProtKB:P51572	9068941	PMID:31206022	UniProt	PMID:31206022

PMID:22301074	PMID:30032202

Ndufs4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	204,892,598 - 204,995,733 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936480	13,827,743 - 13,932,238 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936480	13,829,093 - 13,932,202 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDUFS4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	53,560,639 - 53,683,338 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	53,560,633 - 53,683,338 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	52,856,469 - 52,979,168 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	52,892,242 - 53,014,925 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	52,892,241 - 53,014,924	NCBI
Celera	5	49,810,070 - 49,932,765 (+)	NCBI		Celera
Cytogenetic Map	5	q11.2	NCBI
HuRef	5	49,829,192 - 49,951,782 (+)	NCBI		HuRef
CHM1_1	5	52,859,382 - 52,982,064 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	54,388,486 - 54,511,162 (+)	NCBI		T2T-CHM13v2.0

Ndufs4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	114,424,331 - 114,524,630 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	114,424,331 - 114,524,794 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	114,287,795 - 114,388,094 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	114,287,795 - 114,388,258 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	115,078,003 - 115,178,302 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	115,409,528 - 115,508,921 (-)	NCBI		MGSCv36	mm8
Celera	13	118,620,039 - 118,721,271 (-)	NCBI		Celera
Cytogenetic Map	13	D2.2	NCBI
cM Map	13	64.12	NCBI

Ndufs4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	47,684,420 - 47,794,914 (-)	NCBI		GRCr8
mRatBN7.2	2	45,951,327 - 46,061,829 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	45,951,313 - 46,061,846 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	53,055,093 - 53,165,153 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	51,113,456 - 51,223,515 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	45,988,050 - 46,102,968 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	46,372,488 - 46,476,162 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	46,372,518 - 46,476,203 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	65,403,197 - 65,515,243 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	45,839,236 - 46,479,619 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	41,712,356 - 41,822,320 (-)	NCBI		Celera
Cytogenetic Map	2	q14	NCBI

Ndufs4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955446	13,764,907 - 13,864,824 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955446	13,764,907 - 13,864,824 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDUFS4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	60,256,021 - 60,378,662 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	58,409,645 - 58,532,287 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	60,344,363 - 60,467,008 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	61,966,124 - 62,088,388 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	61,966,124 - 62,088,375 (-)	Ensembl	panpan1.1		panPan2

NDUFS4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	61,613,580 - 61,727,219 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	61,613,589 - 61,727,205 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	61,379,036 - 61,492,669 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	62,107,235 - 62,231,743 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	4	61,884,352 - 61,997,681 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	62,012,344 - 62,126,203 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	62,529,496 - 62,643,162 (-)	NCBI		UU_Cfam_GSD_1.0

NDUFS4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	32,874,450 - 32,987,828 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	32,874,418 - 32,985,638 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	34,963,225 - 34,992,577 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDUFS4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	49,851,012 - 49,967,533 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	4	49,851,014 - 49,967,590 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666082	1,152,990 - 1,272,340 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndufs4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624759	5,630,522 - 5,733,928 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005319642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_040272191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAESOR010002273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSTOT00000005329 ⟹ ENSSTOP00000004777

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
SpeTri2.0 Ensembl	NW_004936480	13,827,743 - 13,932,238 (-)	Ensembl

RefSeq Acc Id:

XM_005319642 ⟹ XP_005319699

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024407213	204,892,598 - 204,995,733 (-)	NCBI
SpeTri2.0	NW_004936480	13,829,093 - 13,932,202 (-)	NCBI

Sequence:

show sequence

CCCATCCTGCCATTTGCCTGCAGCAAGATGGCGGCTGTCTTAATGTCAGTGGCGCTGAAGCAGGCGTTATTGGGGAGAAGAGCAGCGGCTACAGCTGCTGTTTCCGTTTCCAGGGTTCAAACCAGATT
GTTGAGCACATCCACATGGAGGCTGGCACAGGACCAAACTCGAGACACTCAACTTATAACAGTTGATGAAAAATTGGATATCACTACATTAACTGGTGTTCCAGAAGAGCATATCAAAACTAGAAAAG
TCAGGATCTTTGTTCCTGCTCGAAATAACATGCAATCTGGAGTAAACAACACAAAGAAATGGAGGATGGAGTTTGATACCAGGGAACGATGGGAAAATCCTTTGATGGGTTGGGCATCAACGGCTGAT
CCTTTGTCCAATATGGTTCTAACCTTCAGTACTAAAGAAGATGCAGCTGCCTTTGCAGAAAAAAATGGCTGGAGCTATGACATTGAAGAGAGAAAAGTTCCGAAACCCAAGTCCAAGTCTTATGGTGC
AAACTTTTCTTGGAACAAAAGAACAAGAGTATCCACAAAATAGATTGGCACTGACTGTATCTCTACTTGACTGTGAATAAAGTCAGCTGTGCAGTATTTATAGCCCATGTATACATCTCTTAATCACC
TAATAAATTTGACCTTAAAATTATAGATAGA

hide sequence

RefSeq Acc Id:

XM_040272191 ⟹ XP_040128125

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024407213	204,892,598 - 204,995,412 (-)	NCBI


Protein RefSeqs	XP_005319699	(Get FASTA)	NCBI Sequence Viewer
	XP_040128125	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSTOP00000004777.3
GenBank Protein	KAG3266697	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_005319699 ⟸ XM_005319642
- Peptide Label:	isoform X2
- UniProtKB:	I3M5W5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAVLMSVALKQALLGRRAAATAAVSVSRVQTRLLSTSTWRLAQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWRMEFDTRERWENPLMGWASTADPLSNMVLTF STKEDAAAFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK hide sequence

RefSeq Acc Id:	XP_040128125 ⟸ XM_040272191
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSSTOP00000004777 ⟸ ENSSTOT00000005329

Database	Acc Id	Source(s)
Ensembl Genes	ENSSTOG00000005327	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSSTOT00000005329.3	UniProtKB/TrEMBL
Gene3D-CATH	3.30.160.190	UniProtKB/TrEMBL
InterPro	NADH_UbQ_FeS_4_mit	UniProtKB/TrEMBL
	NDUFS4-like_sf	UniProtKB/TrEMBL
NCBI Gene	Ndufs4	ENTREZGENE
PANTHER	NADH DEHYDROGENASE [UBIQUINONE] IRON-SULFUR PROTEIN 4, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR12219	UniProtKB/TrEMBL
Pfam	ETC_C1_NDUFA4	UniProtKB/TrEMBL
UniProt	I3M5W5	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM