Advanced Search (OLGA)

Gene: Txnl4a (thioredoxin like 4A) Ictidomys tridecemlineatus

Subscribe to Updates

Analyze

Symbol:

Txnl4a

Name:

thioredoxin like 4A

RGD ID:

12518652

Description:

INVOLVED IN mRNA processing (inferred); mRNA splicing, via spliceosome (inferred); RNA splicing (inferred); PARTICIPATES IN spliceosome pathway; ASSOCIATED WITH Burn-McKeown syndrome (ortholog); chromosome 18q deletion syndrome (ortholog); genetic disease (ortholog); FOUND IN cytoplasm (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

thioredoxin like 4A, transcript variant X1; thioredoxin-like protein 4A

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TXNL4A (thioredoxin like 4A)	NCBI	Ortholog
Mus musculus (house mouse):	Txnl4a (thioredoxin-like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Txnl4a (thioredoxin-like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Txnl4a (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TXNL4A (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TXNL4A (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TXNL4A (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TXNL4A (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Txnl4a (thioredoxin like 4A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

SpeTri2.0 - Squirrel SpeTri2.0 Assembly

Position:

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	14,899,459 - 14,912,032 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936616	220,274 - 234,870 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936616	220,255 - 232,042 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	Burn-McKeown syndrome		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1342861 more ...
Txnl4a	Squirrel	chromosome 18q deletion syndrome		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Monosomy 18q and deletion 18q	ClinVar	PMID:25741868 and PMID:31690835
Txnl4a	Squirrel	genetic disease		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868
Txnl4a	Squirrel	intestinal volvulus		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTESTINAL MALROTATION and FAMILIAL	ClinVar	PMID:25741868
Txnl4a	Squirrel	Neurodevelopmental Disorders		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
Txnl4a	Squirrel	Oculootofacial Dysplasia		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:1342861 more ...
Txnl4a	Squirrel	pulmonary valve stenosis		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pulmonary valve stenosis	ClinVar	PMID:25741868
Txnl4a	Squirrel	Volvulus Of Midgut		ISO	TXNL4A (Homo sapiens)	8554872	ClinVar Annotator: match by term: Volvulus of midgut	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	Burn-McKeown syndrome		ISO	TXNL4A (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	mRNA processing	involved_in	IEA	UniProtKB-KW:KW-0507	150520179		UniProt	GO_REF:0000043
Txnl4a	Squirrel	mRNA splicing, via spliceosome	involved_in	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	mRNA splicing, via spliceosome	involved_in	IEA	InterPro:IPR004123	150520179		InterPro	GO_REF:0000002
Txnl4a	Squirrel	RNA splicing	involved_in	IEA	UniProtKB-KW:KW-0508	150520179		UniProt	GO_REF:0000043

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	cytoplasm	located_in	ISO	TXNL4A (Homo sapiens)	9068941	PMID:18559850	MGI	PMID:18559850
Txnl4a	Squirrel	cytosol	located_in	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	nucleoplasm	located_in	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
Txnl4a	Squirrel	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
Txnl4a	Squirrel	nucleus	located_in	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	spliceosomal complex	part_of	IEA	PANTHER:PTN000248422	150520179		TreeGrafter	GO_REF:0000118
Txnl4a	Squirrel	U2-type precatalytic spliceosome	part_of	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	U4/U6 x U5 tri-snRNP complex	part_of	IEA	PANTHER:PTN000248422	150520179		TreeGrafter	GO_REF:0000118
Txnl4a	Squirrel	U4/U6 x U5 tri-snRNP complex	part_of	IEA	InterPro:IPR004123	150520179		InterPro	GO_REF:0000002
Txnl4a	Squirrel	U4/U6 x U5 tri-snRNP complex	part_of	IEA	UniRule:UR000977769	150520179		UniProt	GO_REF:0000104
Txnl4a	Squirrel	U4/U6 x U5 tri-snRNP complex	part_of	IEA	UniProtKB:P83876 and ensembl:ENSP00000269601	150520179		Ensembl	GO_REF:0000107
Txnl4a	Squirrel	U5 snRNP	part_of	IEA	PANTHER:PTN000248422	150520179		TreeGrafter	GO_REF:0000118
Txnl4a	Squirrel	U5 snRNP	part_of	IEA	UniRule:UR000977769	150520179		UniProt	GO_REF:0000104

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:O95400	9068941	PMID:15840814 and PMID:35271311	BHF-UCL	PMID:15840814 and PMID:35271311
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:O00471 and UniProtKB:Q9BRK4	9068941	PMID:25416956	IntAct	PMID:25416956
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:O94906	9068941	PMID:16723661	IntAct	PMID:16723661
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:Q15303	9068941	PMID:20858735	UniProt	PMID:20858735
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:Q96D03	9068941	PMID:32296183	IntAct	PMID:32296183
Txnl4a	Squirrel	protein binding	enables	ISO	UniProtKB:O94906 and UniProtKB:O95400	9068941	PMID:28514442 and PMID:33961781	IntAct	PMID:28514442 and PMID:33961781

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Txnl4a	Squirrel	spliceosome pathway		ISO	TXNL4A (Homo sapiens)	9068941		RGD	PMID:19239890 and REF_RGD_ID:9686089

PMID:22301074	PMID:30032202

Txnl4a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404944	14,899,459 - 14,912,032 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936616	220,274 - 234,870 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936616	220,255 - 232,042 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TXNL4A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	18	79,970,813 - 80,033,936 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	18	79,970,813 - 80,033,949 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	18	77,730,813 - 77,793,936 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	18	75,833,855 - 75,849,520 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	18	75,833,855 - 75,849,520	NCBI
Celera	18	74,505,339 - 74,521,004 (-)	NCBI		Celera
Cytogenetic Map	18	q23	NCBI
HuRef	18	74,354,321 - 74,369,986 (-)	NCBI		HuRef
CHM1_1	18	77,728,173 - 77,743,835 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	18	80,247,334 - 80,310,473 (-)	NCBI		T2T-CHM13v2.0

Txnl4a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	80,250,041 - 80,269,066 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	80,249,980 - 80,255,956 (+)	Ensembl		GRCm39 Ensembl
GRCm39 Ensembl	18	80,250,010 - 80,269,070 (+)	Ensembl		GRCm39 Ensembl
GRCm38	18	80,206,826 - 80,225,851 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	80,206,795 - 80,225,855 (+)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	18	80,206,765 - 80,212,741 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	80,403,537 - 80,422,590 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	80,368,858 - 80,387,910 (+)	NCBI		MGSCv36	mm8
Celera	18	81,326,193 - 81,346,625 (+)	NCBI		Celera
Cytogenetic Map	18	E3	NCBI
cM Map	18	53.34	NCBI

Txnl4a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	18	75,934,085 - 75,949,873 (+)	NCBI		GRCr8
mRatBN7.2	18	73,659,107 - 73,674,893 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	73,659,107 - 73,674,893 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	75,760,800 - 75,776,460 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	18	76,430,148 - 76,445,808 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	18	74,275,535 - 74,291,375 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	18	76,725,221 - 76,740,673 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	76,725,247 - 76,740,688 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	72,067,372 - 72,082,799 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	18	72,321,825 - 72,336,942 (+)	NCBI		Celera
Cytogenetic Map	18	q12.3	NCBI

Txnl4a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955402	63,153,052 - 63,166,199 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955402	63,153,274 - 63,166,208 (+)	NCBI	ChiLan1.0	ChiLan1.0

TXNL4A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	17	97,606,821 - 97,670,745 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	18	83,302,072 - 83,363,366 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	18	73,618,302 - 73,679,603 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	18	76,937,460 - 76,952,428 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	18	76,937,460 - 76,952,428 (-)	Ensembl	panpan1.1		panPan2

TXNL4A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	722,223 - 735,253 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	722,293 - 735,258 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	1,724,232 - 1,737,274 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	520,112 - 533,019 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	520,550 - 533,021 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	573,166 - 586,068 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	518,510 - 531,414 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	689,716 - 702,621 (+)	NCBI		UU_Cfam_GSD_1.0

TXNL4A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	127,974,543 - 127,991,177 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	127,975,164 - 127,991,112 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	310,124,483 - 310,140,432 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TXNL4A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	18	270,392 - 286,243 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	18	270,938 - 285,966 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666060	26,031,195 - 26,046,998 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Txnl4a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624806	367,286 - 385,946 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624806	367,668 - 385,946 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005334364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_040271735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_040271742	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_002484924	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAESOR010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSSTOT00000023844 ⟹ ENSSTOP00000022461

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
SpeTri2.0 Ensembl	NW_004936616	220,274 - 234,870 (+)	Ensembl

RefSeq Acc Id:

XM_005334364 ⟹ XP_005334421

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024404944	14,899,459 - 14,912,032 (+)	NCBI
SpeTri2.0	NW_004936616	220,256 - 232,042 (+)	NCBI

Sequence:

show sequence

CGTAGGCGTCAGAGCGTGATTCCGGAAGTGCCCCTGCGCGGGAGGCGCTAGTGCGGCCGGGAGGTGCGGGCCGGTCGAGACCCGGAGACCGAGGGCAAGGCAGCTCGCGCGGCGCCCTGCCGCATAGC
CCGGCCACGCCAGCATGTCGTACATGCTCCCTCACCTGCACAACGGCTGGCAGGTGGACCAGGCCATCCTCTCGGAGGAGGACCGCGTCGTGGTCATTCGTTTCGGGCACGACTGGGACCCCACCTGC
ATGAAGATGGACGAGGTGCTGTACAGCATAGCGGAGAAGGTAAAAAATTTTGCAGTTATTTATCTCGTGGATATTACAGAAGTACCTGACTTCAACAAAATGTATGAATTATACGATCCATGTACTGT
CATGTTTTTCTTCAGGAACAAACACATCATGATTGACTTGGGCACAGGCAACAACAACAAGATCAACTGGGCCATGGAAGATAAGCAGGAGATGGTTGACATAATTGAGACTGTATACCGTGGCGCCC
GGAAGGGCCGGGGCCTGGTGGTGTCCCCCAAGGACTACTCGACCAAGTACAGATACTGAGGCGCGTGCCAGGGCCTGCATGGTGCCATGGGGCCCTTCCCTGGACTTGTCCTGGTCTGTTGAGAACTG
GAGGGCTAAAGGTCACACACCTTCACTAGCTGAAGCAAATAAACACCTGAAGGATCACCCACCACTGTTTGTTCTTAAGAACCTGTGTAGCTGA

hide sequence

RefSeq Acc Id:

XM_040271735 ⟹ XP_040127669

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024404944	14,899,483 - 14,912,032 (+)	NCBI

RefSeq Acc Id:

XM_040271742 ⟹ XP_040127676

Type:

CODING

Position:

Squirrel Assembly	Chr	Position (strand)	Source
HiC_Itri_2	NW_024404944	14,899,637 - 14,912,032 (+)	NCBI


Protein RefSeqs	XP_005334421	(Get FASTA)	NCBI Sequence Viewer
	XP_040127669	(Get FASTA)	NCBI Sequence Viewer
	XP_040127676	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSSTOP00000022461.1
GenBank Protein	KAG3293671	(Get FASTA)	NCBI Sequence Viewer
	KAG3293672	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_005334421 ⟸ XM_005334364
- Peptide Label:	isoform X1
- UniProtKB:	I3NDL4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRG LVVSPKDYSTKYRY hide sequence

RefSeq Acc Id:	XP_040127669 ⟸ XM_040271735
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_040127676 ⟸ XM_040271742
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSSTOP00000022461 ⟸ ENSSTOT00000023844

Database	Acc Id	Source(s)
Ensembl Genes	ENSSTOG00000022277	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSSTOT00000023844.2	UniProtKB/TrEMBL
Gene3D-CATH	Glutaredoxin	UniProtKB/TrEMBL
InterPro	Dim1	UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/TrEMBL
NCBI Gene	Txnl4a	ENTREZGENE
PANTHER	PTHR12052	UniProtKB/TrEMBL
	THIOREDOXIN-LIKE PROTEIN 4A	UniProtKB/TrEMBL
Pfam	DIM1	UniProtKB/TrEMBL
PIRSF	mRNA_splic_U5	UniProtKB/TrEMBL
SMART	DIM1	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52833	UniProtKB/TrEMBL
UniProt	I3NDL4	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations