Advanced Search (OLGA)

Gene: CFL1 (cofilin 1) Canis lupus familiaris

Subscribe to Updates

Analyze

Symbol:

CFL1

Name:

cofilin 1

RGD ID:

12254992

Description:

ENCODES a protein that exhibits actin binding (ortholog); actin filament binding (ortholog); phosphatidylinositol bisphosphate binding (ortholog); INVOLVED IN actin filament organization (ortholog); cell motility (ortholog); cell projection organization (ortholog); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rab family mediated signaling pathway; ASSOCIATED WITH Aicardi-Goutieres Syndrome 3 (ortholog); Bardet-Biedl syndrome (ortholog); brain compression (ortholog); FOUND IN cell leading edge (ortholog); cell-cell junction (ortholog); cofilin-actin rod (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

cofilin-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CFL1 (cofilin 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cfl1 (cofilin 1, non-muscle)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Cfl1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cfl1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CFL1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cfl1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CFL1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CFL1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cfl1 (cofilin 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CFL2 (cofilin 2)	HGNC	OrthoDB

Latest Assembly:

CanFam3.1 - Dog CanFam3.1 Assembly

Position:

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	51,404,649 - 51,408,240 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	51,401,659 - 51,408,212 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	50,013,157 - 50,016,753 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	52,442,507 - 52,446,103 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	52,439,523 - 52,446,096 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	51,542,563 - 51,546,159 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	51,116,937 - 51,120,532 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	51,906,246 - 51,909,842 (+)	NCBI		UU_Cfam_GSD_1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	brain compression	treatment	ISO	RGD:732970	9068941		RGD	PMID:25708984\|REF_RGD_ID:12738361
CFL1	Dog	Cocaine-Related Disorders		ISO	RGD:69285	9068941	protein:altered expression:striatum (rat)	RGD	PMID:27018876\|REF_RGD_ID:11568696
CFL1	Dog	Diabetic Cardiomyopathies	treatment	ISO	RGD:69285	9068941	associated with Diabetes Mellitus, Experimental	RGD	PMID:27576917\|REF_RGD_ID:11568692
CFL1	Dog	Diabetic Nephropathies		ISO	RGD:69285	9068941	associated with Diabetes Mellitus, Experimental;protein:increased phosphorylation:renal glomerulus (rat)	RGD	PMID:24726496\|REF_RGD_ID:11570419
CFL1	Dog	gallbladder carcinoma	severity	ISO	RGD:732970	9068941	Squamous Cell/Adenosquamous Carcinoma and Adenocarcinoma;protein:increased expression:gall bladder (human)	RGD	PMID:23320827\|REF_RGD_ID:11571623
CFL1	Dog	Hyperalgesia		ISO	RGD:69285	9068941	protein:increased phosphorylation:dorsal root ganglion (rat)	RGD	PMID:24962708\|REF_RGD_ID:11570412
CFL1	Dog	Hypertensive Nephropathy		ISO	RGD:69285	9068941	protein:increased phosphorylation:kidney (rat)	RGD	PMID:26450610\|REF_RGD_ID:11520804
CFL1	Dog	impotence	treatment	ISO	RGD:69285	9068941		RGD	PMID:25444982\|REF_RGD_ID:11570410
CFL1	Dog	impotence		ISO	RGD:69285	9068941	protein:increased phosphorylation:corpus cavernosum penis (rat)	RGD	PMID:25923835\|REF_RGD_ID:11568706
CFL1	Dog	muscular atrophy		ISO	RGD:69285	9068941	protein:decreased phosphorylation:gastrocnemius (rat)	RGD	PMID:24711688\|REF_RGD_ID:11570530
CFL1	Dog	myocardial infarction	treatment	ISO	RGD:69285	9068941		RGD	PMID:24292258\|REF_RGD_ID:11570534
CFL1	Dog	nephrotic syndrome	treatment	ISO	RGD:69285	9068941		RGD	PMID:24737737\|REF_RGD_ID:11570418
CFL1	Dog	Neuralgia	treatment	ISO	RGD:69285	9068941	associated with Sciatic Neuropathy	RGD	PMID:27216618\|REF_RGD_ID:11568694
CFL1	Dog	Optic Nerve Injuries	treatment	ISO	RGD:69285	9068941		RGD	PMID:27443501\|REF_RGD_ID:11568693
CFL1	Dog	status epilepticus	treatment	ISO	RGD:69285	9068941		RGD	PMID:27642592\|REF_RGD_ID:11568691
CFL1	Dog	ureteral obstruction		ISO	RGD:69285	9068941	protein:increased expression:inner medulla of kidney (rat)	RGD	PMID:24761003\|REF_RGD_ID:11570413
CFL1	Dog	vitamin B12 deficiency		ISO	RGD:69285	9068941	protein:increased expression:kidney (rat)	RGD	PMID:25982389\|REF_RGD_ID:11352764
CFL1	Dog	West syndrome		ISO	RGD:69285	9068941	protein:decreased expression:brain (rat)	RGD	PMID:24994451\|REF_RGD_ID:11570411

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	Aicardi-Goutieres Syndrome 3		ISO	RGD:732970	8554872	ClinVar Annotator: match by term: Aicardi-Goutieres syndrome 3	ClinVar	PMID:28492532\|PMID:28600438
CFL1	Dog	Bardet-Biedl syndrome		ISO	RGD:732970	8554872	ClinVar Annotator: match by term: Bardet-Biedl syndrome	ClinVar	PMID:12118255\|PMID:16786513\|PMID:21520335\|PMID:27032803\|PMID:28492532\|PMID:8316268
CFL1	Dog	glycogen storage disease V		ISO	RGD:732970	8554872	ClinVar Annotator: match by term: Glycogen storage disease, type V	ClinVar	PMID:12118255\|PMID:16786513\|PMID:21520335\|PMID:27032803\|PMID:28492532\|PMID:8316268
CFL1	Dog	immunodeficiency 90		ISO	RGD:732970	8554872	ClinVar Annotator: match by term: Infections, recurrent, with encephalopathy, hepatic dysfunction, and cardiovascular malformations	ClinVar	PMID:28492532
CFL1	Dog	intellectual disability		ISO	RGD:732970	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	Breast Neoplasms		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:20562527
CFL1	Dog	esophagus squamous cell carcinoma		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21517111
CFL1	Dog	Neoplasm Invasiveness		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:15048980
CFL1	Dog	Neoplasm Metastasis		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:20562527
CFL1	Dog	pre-malignant neoplasm		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:21472284
CFL1	Dog	spina bifida		ISO	RGD:732970	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17352815

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	actin filament depolymerization	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	actin filament depolymerization	involved_in	IEA	InterPro:IPR017904	150520179		InterPro	GO_REF:0000002
CFL1	Dog	actin filament fragmentation	involved_in	IBA	MGI:101757\|MGI:101763\|MGI:1929270\|PANTHER:PTN000227261	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	actin filament organization	involved_in	ISO	RGD:735417	9068941	PMID:25208553	UniProt	PMID:25208553
CFL1	Dog	actin filament organization	acts_upstream_of_or_within	ISO	MGI:3574399	9068941	PMID:15649475	MGI	PMID:15649475
CFL1	Dog	actin filament severing	involved_in	IBA	PANTHER:PTN000227259\|PomBase:SPAC20G4.06c\|SGD:S000003973\|UniProtKB:C4LVG4\|WB:WBGene00006794\|dictyBase:DDB_G0277833	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	cell motility	acts_upstream_of_or_within	ISO	RGD:735417	9068941	PMID:15548599	MGI	PMID:15548599
CFL1	Dog	cell projection organization	acts_upstream_of_or_within	ISO	RGD:69285	9068941	PMID:16286931	MGI	PMID:16286931\|REF_RGD_ID:8554187
CFL1	Dog	cellular response to epidermal growth factor stimulus		ISO	RGD:69285	9068941		RGD	PMID:23704350\|PMID:26324884\|REF_RGD_ID:11568705\|REF_RGD_ID:11570555
CFL1	Dog	cellular response to ether		ISO	RGD:69285	9068941	polybrominated diphenyl ethers	RGD	PMID:24239914\|REF_RGD_ID:11570536
CFL1	Dog	cellular response to hydrogen peroxide		ISO	RGD:69285	9068941		RGD	PMID:23765104\|REF_RGD_ID:11570554
CFL1	Dog	cellular response to insulin-like growth factor stimulus		ISO	RGD:69285	9068941		RGD	PMID:24195677\|REF_RGD_ID:10053669
CFL1	Dog	cellular response to interleukin-1		ISO	RGD:69285	9068941		RGD	PMID:24760020\|REF_RGD_ID:11570414
CFL1	Dog	cellular response to interleukin-6		ISO	RGD:69285	9068941		RGD	PMID:24760020\|REF_RGD_ID:11570414
CFL1	Dog	cellular response to tumor necrosis factor		ISO	RGD:69285	9068941		RGD	PMID:24760020\|REF_RGD_ID:11570414
CFL1	Dog	cytoskeleton organization	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	establishment of cell polarity	acts_upstream_of_or_within	ISO	MGI:3574399	9068941	PMID:15649475	MGI	PMID:15649475
CFL1	Dog	establishment of spindle localization	involved_in	ISO	RGD:735417	9068941	PMID:25208553	UniProt	PMID:25208553
CFL1	Dog	hippocampus development		ISO	RGD:69285	9068941		RGD	PMID:27073215\|REF_RGD_ID:11568695
CFL1	Dog	mitotic cytokinesis	involved_in	IBA	MGI:101757\|PANTHER:PTN001375639	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	mitotic cytokinesis	acts_upstream_of_or_within	ISO	RGD:735417	9068941	PMID:15548599	MGI	PMID:15548599
CFL1	Dog	modification of postsynaptic actin cytoskeleton	involved_in	ISO	RGD:69285	9068941	PMID:16025109	SynGO	PMID:16025109\|REF_RGD_ID:13702428
CFL1	Dog	modulation of chemical synaptic transmission	involved_in	ISO	RGD:69285	9068941	PMID:16025109	SynGO	PMID:16025109\|REF_RGD_ID:13702428
CFL1	Dog	negative regulation of actin filament bundle assembly		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	negative regulation of actin filament depolymerization		ISO	RGD:69285	9068941		RGD	PMID:15252126\|REF_RGD_ID:2306210
CFL1	Dog	negative regulation of cell adhesion		ISO	RGD:69285	9068941		RGD	PMID:26169356\|REF_RGD_ID:11074527
CFL1	Dog	negative regulation of cell motility		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	negative regulation of cell size	acts_upstream_of_or_within	ISO	RGD:69285	9068941	PMID:16286931	MGI	PMID:16286931\|REF_RGD_ID:8554187
CFL1	Dog	negative regulation of dendritic spine maintenance		ISO	RGD:69285	9068941		RGD	PMID:23974706\|REF_RGD_ID:11570553
CFL1	Dog	negative regulation of lamellipodium assembly		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	negative regulation of postsynaptic density organization		ISO	RGD:69285	9068941		RGD	PMID:26169356\|REF_RGD_ID:11074527
CFL1	Dog	negative regulation of unidimensional cell growth		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	neural crest cell migration	acts_upstream_of_or_within	ISO	MGI:3574399	9068941	PMID:15649475	MGI	PMID:15649475
CFL1	Dog	neural fold formation	acts_upstream_of_or_within	ISO	MGI:3574399	9068941	PMID:15649475	MGI	PMID:15649475
CFL1	Dog	positive regulation by host of viral process	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	positive regulation of actin filament depolymerization	involved_in	ISO	RGD:735417	9068941	PMID:23921380	CACAO	PMID:23921380
CFL1	Dog	positive regulation of actin filament depolymerization	acts_upstream_of_or_within	ISO	RGD:735417	9068941	PMID:15548599	MGI	PMID:15548599
CFL1	Dog	positive regulation of barbed-end actin filament capping		ISO	RGD:69285	9068941		RGD	PMID:23704350\|REF_RGD_ID:11570555
CFL1	Dog	positive regulation of cell growth		ISO	RGD:69285	9068941	cell area	RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	positive regulation of cell motility		ISO	RGD:69285	9068941		RGD	PMID:24214978\|REF_RGD_ID:9590192
CFL1	Dog	positive regulation of dendritic spine development		ISO	RGD:69285	9068941		RGD	PMID:25723479\|REF_RGD_ID:11570400
CFL1	Dog	positive regulation of embryonic development	involved_in	ISO	RGD:735417	9068941	PMID:25208553	UniProt	PMID:25208553
CFL1	Dog	positive regulation of establishment of cell polarity regulating cell shape		ISO	RGD:69285	9068941		RGD	PMID:26169356\|REF_RGD_ID:11074527
CFL1	Dog	positive regulation of focal adhesion assembly		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	positive regulation of lamellipodium assembly		ISO	RGD:69285	9068941		RGD	PMID:15252126\|REF_RGD_ID:2306210
CFL1	Dog	positive regulation of NMDA glutamate receptor activity		ISO	RGD:69285	9068941		RGD	PMID:24089484\|REF_RGD_ID:11570552
CFL1	Dog	positive regulation of protein localization to cell leading edge		ISO	RGD:69285	9068941	Pdxp	RGD	PMID:26324884\|REF_RGD_ID:11568705
CFL1	Dog	positive regulation of proteolysis		ISO	RGD:69285	9068941		RGD	PMID:24093776\|REF_RGD_ID:11570550
CFL1	Dog	positive regulation of synaptic plasticity		ISO	RGD:69285	9068941		RGD	PMID:25723479\|REF_RGD_ID:11570400
CFL1	Dog	protein import into nucleus		ISO	RGD:69285	9068941		RGD	PMID:12566455\|REF_RGD_ID:724709
CFL1	Dog	protein phosphorylation	acts_upstream_of_or_within	ISO	RGD:735417	9068941	PMID:17018287	MGI	PMID:17018287
CFL1	Dog	regulation of cell morphogenesis	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	regulation of dendritic spine morphogenesis	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	response to activity		ISO	RGD:69285	9068941		RGD	PMID:26678157\|REF_RGD_ID:11568698
CFL1	Dog	response to amino acid	acts_upstream_of_or_within	ISO	RGD:735417	9068941	PMID:17018287	MGI	PMID:17018287
CFL1	Dog	response to virus	involved_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	actin cytoskeleton	located_in	IEA	InterPro:IPR017904	150520179		InterPro	GO_REF:0000002
CFL1	Dog	actin cytoskeleton	is_active_in	IBA	MGI:101757\|MGI:1929270\|PANTHER:PTN000227258\|PomBase:SPAC20G4.06c\|RGD:69285\|SGD:S000003973\|TAIR:locus:2131879\|TAIR:locus:2156727\|UniProtKB:Q8I467\|UniProtKB:Q8ID92\|WB:WBGene00006794\|dictyBase:DDB_G0272568\|dictyBase:DDB_G0277833	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	cell leading edge		ISO	RGD:69285	9068941		RGD	PMID:15252126\|REF_RGD_ID:2306210
CFL1	Dog	cell-cell junction	located_in	ISO	RGD:735417	9068941	PMID:23793062	MGI	PMID:23793062
CFL1	Dog	cofilin-actin rod		ISO	RGD:69285	9068941		RGD	PMID:24760020\|REF_RGD_ID:11570414
CFL1	Dog	cortical actin cytoskeleton	located_in	ISO	RGD:735417	9068941	PMID:15004221, PMID:15548599	MGI	PMID:15004221\|PMID:15548599
CFL1	Dog	cytoplasm	located_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	cytoplasm	is_active_in	IBA	MGI:101757\|MGI:1929270\|PANTHER:PTN000227258\|PomBase:SPAC20G4.06c\|RGD:69285\|SGD:S000003973\|UniProtKB:A0A8J1MVR2\|UniProtKB:C4LVG4\|UniProtKB:P23528\|UniProtKB:Q580V7\|UniProtKB:Q8I467\|UniProtKB:Q9Y281\|WB:WBGene00006794\|dictyBase:DDB_G0277833	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	dendritic spine		ISO	RGD:69285	9068941		RGD	PMID:24760020\|REF_RGD_ID:11570414
CFL1	Dog	filopodium		ISO	RGD:69285	9068941		RGD	PMID:24515839\|REF_RGD_ID:11570532
CFL1	Dog	focal adhesion	located_in	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	glutamatergic synapse	is_active_in	ISO	RGD:69285	9068941	PMID:16025109	SynGO	PMID:16025109\|REF_RGD_ID:13702428
CFL1	Dog	glutamatergic synapse	is_active_in	ISO	RGD:735417	9068941	PMID:16388910	SynGO	PMID:16388910
CFL1	Dog	growth cone		ISO	RGD:69285	9068941		RGD	PMID:24515839\|REF_RGD_ID:11570532
CFL1	Dog	lamellipodium		ISO	RGD:69285	9068941		RGD	PMID:15252126\|REF_RGD_ID:2306210
CFL1	Dog	lamellipodium	is_active_in	IBA	MGI:101757\|PANTHER:PTN000227296\|RGD:69285	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	lamellipodium	located_in	ISO	RGD:735417	9068941	PMID:25107909	UniProt	PMID:25107909
CFL1	Dog	mitochondrial membrane		ISO	RGD:69285	9068941		RGD	PMID:27642592\|REF_RGD_ID:11568691
CFL1	Dog	neuronal cell body		ISO	RGD:69285	9068941		RGD	PMID:24515839\|REF_RGD_ID:11570532
CFL1	Dog	postsynaptic density, intracellular component	is_active_in	ISO	RGD:735417	9068941	PMID:16388910	SynGO	PMID:16388910
CFL1	Dog	synaptic membrane		ISO	RGD:69285	9068941		RGD	PMID:25708984\|REF_RGD_ID:12738361

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	actin binding		ISO	RGD:69285	9068941		RGD	PMID:12566455\|REF_RGD_ID:724709
CFL1	Dog	actin binding	enables	IEA	UniProtKB-KW:KW-0009	150520179		UniProt	GO_REF:0000043
CFL1	Dog	actin binding	enables	IEA	InterPro:IPR002108	150520179		InterPro	GO_REF:0000002
CFL1	Dog	actin filament binding		ISO	RGD:69285	9068941		RGD	PMID:24740405\|REF_RGD_ID:11570417
CFL1	Dog	actin filament binding	enables	IBA	MGI:101757\|MGI:101763\|MGI:1929270\|PANTHER:PTN000227258\|PomBase:SPAC20G4.06c\|RGD:69285\|SGD:S000003973\|TAIR:locus:2059861\|UniProtKB:A0A8J1MVR2\|UniProtKB:P10668\|UniProtKB:P23528\|UniProtKB:P60981\|WB:WBGene00006794	150520179		GO_Central	GO_REF:0000033
CFL1	Dog	actin filament binding	enables	IEA	UniProtKB:P23528\|ensembl:ENSP00000309629	150520179		Ensembl	GO_REF:0000107
CFL1	Dog	phosphatidylinositol bisphosphate binding		ISO	CHEBI:18348	9068941		RGD	PMID:19029335\|REF_RGD_ID:11041716
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P00533	9068941	PMID:20029029, PMID:24658140, PMID:31980649	IntAct	PMID:20029029\|PMID:24658140\|PMID:31980649
CFL1	Dog	protein binding	enables	ISO	UniProtKB:Q9R1M5\|UniProtKB:Q9WVB3	9068941	PMID:25208553	UniProt	PMID:25208553
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P53667\|UniProtKB:P57058	9068941	PMID:20133759	IntAct	PMID:20133759
CFL1	Dog	protein binding	enables	ISO	UniProtKB:O14939\|UniProtKB:P53667\|UniProtKB:Q13393	9068941	PMID:17853892	IntAct	PMID:17853892
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P54253\|UniProtKB:Q96CV9	9068941	PMID:32814053	IntAct	PMID:32814053
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P54253	9068941	PMID:16713569	IntAct	PMID:16713569
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P53667	9068941	PMID:19424295	IntAct	PMID:19424295
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P60709\|UniProtKB:P63261\|UniProtKB:Q1KLZ0\|UniProtKB:Q549N0	9068941	PMID:25416956	IntAct	PMID:25416956
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P60709	9068941	PMID:29892012, PMID:31515488	IntAct	PMID:29892012\|PMID:31515488
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P27958-PRO_0000037566	9068941	PMID:15846844	AgBase	PMID:15846844
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P0DOE7	9068941	PMID:25556234	AgBase	PMID:25556234
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P63104	9068941	PMID:12361576, PMID:15161933	IntAct	PMID:12361576\|PMID:15161933
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P60709\|UniProtKB:P63261	9068941	PMID:16189514, PMID:32296183, PMID:35271311	IntAct	PMID:16189514\|PMID:32296183\|PMID:35271311
CFL1	Dog	protein binding	enables	ISO	UniProtKB:Q9Y281	9068941	PMID:21516116	IntAct	PMID:21516116
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P68032	9068941	PMID:30021884	IntAct	PMID:30021884
CFL1	Dog	protein binding		ISO	RGD:1311323	9068941		RGD	PMID:23765104\|REF_RGD_ID:11570554
CFL1	Dog	protein binding	enables	ISO	UniProtKB:Q66HL2	9068941	PMID:19704022	IntAct	PMID:19704022\|REF_RGD_ID:8553677
CFL1	Dog	protein binding		ISO	RGD:2192	9068941		RGD	PMID:24195677\|REF_RGD_ID:10053669
CFL1	Dog	protein binding	enables	ISO	UniProtKB:Q8WYL5	9068941	PMID:21525957	IntAct	PMID:21525957
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P54686	9068941	PMID:20668166	dictyBase	PMID:20668166\|REF_RGD_ID:8553986
CFL1	Dog	protein binding	enables	ISO	UniProtKB:P60709\|UniProtKB:P68032\|UniProtKB:Q9Y281	9068941	PMID:33961781	IntAct	PMID:33961781
CFL1	Dog	protein phosphatase binding		ISO	RGD:1351799	9068941		RGD	PMID:26324884\|REF_RGD_ID:11568705
CFL1	Dog	signaling receptor binding	enables	ISO	UniProtKB:P97484	9068941	PMID:24052308	ARUK-UCL	PMID:24052308

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CFL1	Dog	insulin responsive facilitative sugar transporter mediated glucose transport pathway		ISO	RGD:69285	9068941		RGD	PMID:20739464\|REF_RGD_ID:10054052
CFL1	Dog	Rab family mediated signaling pathway		ISO	RGD:69285	9068941		RGD	PMID:20739464\|REF_RGD_ID:10054052

PMID:18070928	PMID:22301074	PMID:30032202

CFL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	51,404,649 - 51,408,240 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	51,401,659 - 51,408,212 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	50,013,157 - 50,016,753 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	52,442,507 - 52,446,103 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	52,439,523 - 52,446,096 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	51,542,563 - 51,546,159 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	51,116,937 - 51,120,532 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	51,906,246 - 51,909,842 (+)	NCBI		UU_Cfam_GSD_1.0

CFL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	65,854,673 - 65,858,180 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	65,823,022 - 65,862,026 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	65,622,144 - 65,625,651 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	65,378,858 - 65,382,380 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	65,378,862 - 65,382,380	NCBI
Celera	11	62,946,188 - 62,949,710 (-)	NCBI		Celera
Cytogenetic Map	11	q13.1	NCBI
HuRef	11	61,948,799 - 61,952,321 (-)	NCBI		HuRef
CHM1_1	11	65,506,695 - 65,510,217 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	65,849,144 - 65,852,651 (-)	NCBI		T2T-CHM13v2.0

Cfl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	5,540,483 - 5,544,059 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	5,540,483 - 5,545,229 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	5,490,455 - 5,494,031 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	5,490,455 - 5,495,201 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	5,490,455 - 5,494,031 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	5,490,525 - 5,495,201 (+)	NCBI		MGSCv36	mm8
Celera	19	5,362,154 - 5,365,730 (+)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	4.34	NCBI

Cfl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	212,227,124 - 212,230,656 (+)	NCBI		GRCr8
mRatBN7.2	1	202,796,012 - 202,801,337 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	202,786,627 - 202,817,587 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	211,150,090 - 211,153,626 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	218,243,191 - 218,246,723 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	210,934,235 - 210,937,767 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	220,869,805 - 220,873,337 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	220,869,805 - 220,873,337 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	227,799,126 - 227,802,658 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	208,133,876 - 208,137,408 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	208,287,328 - 208,290,861 (+)	NCBI
Celera	1	200,333,275 - 200,336,807 (+)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

Cfl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	19,479,181 - 19,482,571 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	19,479,181 - 19,482,571 (+)	NCBI	ChiLan1.0	ChiLan1.0

CFL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	67,083,366 - 67,089,768 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	68,126,152 - 68,131,657 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	61,215,092 - 61,218,628 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	64,544,275 - 64,548,372 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	64,544,275 - 64,550,806 (-)	Ensembl	panpan1.1		panPan2

Cfl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	7,236,442 - 7,239,965 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936599	3,677,804 - 3,682,307 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936599	3,678,724 - 3,682,314 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CFL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	6,469,254 - 6,475,035 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	6,471,558 - 6,475,019 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	5,575,587 - 5,579,048 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CFL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	8,408,560 - 8,410,564 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	105,687,711 - 105,692,145 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cfl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	20,574,966 - 20,579,796 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	20,574,884 - 20,578,413 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in CFL1
62 total Variants

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

adipose tissue	alimentary part of gastrointestinal system	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
6	5	5	23	22	16	6	6	6	6	33	22	12	14	10


RefSeq Transcripts	XM_038424961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038501200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038563900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_038628028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_533231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AAEX04000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAHUQ010000214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAQRD010000037	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAAUVH010000176	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	REHQ01000018	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCAFT00000038591 ⟹ ENSCAFP00000034331

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	18	51,404,725 - 51,408,010 (+)	Ensembl

Ensembl Acc Id:

ENSCAFT00000082338 ⟹ ENSCAFP00000066287

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1 Ensembl	18	51,401,659 - 51,408,212 (+)	Ensembl

Ensembl Acc Id:

ENSCAFT00845031982 ⟹ ENSCAFP00845025009

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	18	52,439,523 - 52,446,096 (+)	Ensembl

Ensembl Acc Id:

ENSCAFT00845032022 ⟹ ENSCAFP00845025042

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	18	52,442,556 - 52,446,096 (+)	Ensembl

Ensembl Acc Id:

ENSCAFT00845032060 ⟹ ENSCAFP00845025068

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0 Ensembl	18	52,442,842 - 52,446,089 (+)	Ensembl

RefSeq Acc Id:

XM_038424961 ⟹ XP_038280889

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
ROS_Cfam_1.0	18	52,442,507 - 52,446,103 (+)	NCBI

RefSeq Acc Id:

XM_038501200 ⟹ XP_038357128

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UMICH_Zoey_3.1	18	51,542,563 - 51,546,159 (+)	NCBI

RefSeq Acc Id:

XM_038563900 ⟹ XP_038419828

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UU_Cfam_GSD_1.0	18	51,906,246 - 51,909,842 (+)	NCBI

RefSeq Acc Id:

XM_038628028 ⟹ XP_038483956

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
UNSW_CanFamBas_1.0	18	51,116,937 - 51,120,532 (+)	NCBI

RefSeq Acc Id:

XM_533231 ⟹ XP_533231

Type:

CODING

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	18	51,404,649 - 51,408,240 (+)	NCBI
Dog10K_Boxer_Tasha	18	50,013,157 - 50,016,753 (+)	NCBI

Sequence:

show sequence

GAGCGCCGGAAGCCCGCCCCGCCCCTCATTGTGCGGCTCCTACTAAACGGAAGGGGCCGGGAGAGGCCGCGTTCAGTCGGATCCCGGCGGCAGCTGCAGCGGCTCTCATCTCTTCTGACCCTTTTTGC
TATCTCCCTTTCGCTTCCGGAAACATGGCCTCTGGCGTGGCGGTTTCTGATGGCGTCATCAAAGTGTTCAATGACATGAAGGTGCGTAAGTCTTCAACACCCGAGGAAGTGAAGAAGCGCAAGAAGGC
AGTTCTTTTCTGCCTGAGCGAGGACAAGAAGAACATCATCCTCGAGGAGGGCAAGGAGATCCTGGTAGGTGATGTGGGCCAGACTGTAGATGACCCCTACGCCACCTTTGTCAAGATGCTACCAGACA
AGGACTGCCGCTATGCCCTCTATGACGCAACCTATGAGACCAAGGAGAGCAAGAAGGAGGACCTGGTGTTTATCTTCTGGGCACCTGAGTCTGCACCCCTTAAGAGCAAAATGATTTATGCCAGCTCC
AAGGATGCCATCAAGAAAAAGCTGACTGGGATCAAGCATGAGTTACAAGCAAACTGCTACGAGGAGGTCAAGGACCGCTGCACCCTGGCAGAGAAACTGGGGGGCAGTGCCGTCATCTCTCTGGAGGG
CAAGCCTTTGTGAGCCCCCTCCAGCCCCCTGCCTGGAGCATCTGGCAGCCCCAGACCTGCCCATGGGGGTTGCAGGCTGCCCCCTTCCTGCCAGACCGGAGGGGCTGGGGGGATCCCAGCAGGGGGAG
GGCAATCCCTTCACCCCAGTTGCCAAACAGCCCCCTCACCCCCTGGACCTTCCTCCTCCCTCTATCCCTGACGGTTCTGGCTTTCCCAAACCGCTTTTGATCTTCTGATTCCTCTTGGGTTGAAGCAG
ACCAAGTTCCCCCCAGGCACCCCAGTTTGGGGGGGGCCTGTATTTTTTTTAACGACACCCCAGTTCCTCACCTGTTCCTCCCTTTTCCCATGCTGCCAACTTCTAACCGCAATAGTGACTCTGTGCTT
GTCTGTTTAGTTCTGTGTATAAATGGAATGTTGTGGAGATGACCCTTCCTTGCGCCACCTGGTTCCCCTCCCCTTTTCCCCTGGTCTTGGCACTCATGGAAACAGGACCAGTAAGGGACCTTCAATTA
AAAAAAAACCAACAACACACACAACAATAAAAAGGCTCACTAATGGGA

hide sequence


Protein RefSeqs	XP_038280889	(Get FASTA)	NCBI Sequence Viewer
	XP_038357128	(Get FASTA)	NCBI Sequence Viewer
	XP_038419828	(Get FASTA)	NCBI Sequence Viewer
	XP_038483956	(Get FASTA)	NCBI Sequence Viewer
	XP_533231	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCAFP00000034331.3
	ENSCAFP00000066287.1
	ENSCAFP00000070573.1
	ENSCAFP00030023225.1
	ENSCAFP00030023269.1
	ENSCAFP00040025436.1
	ENSCAFP00040025480.1
	ENSCAFP00845025009.1
	ENSCAFP00845025042
	ENSCAFP00845025042.1
	ENSCAFP00845025068.1

RefSeq Acc Id:	XP_533231 ⟸ XM_533231
- UniProtKB:	A0A8C0NGL0 (UniProtKB/TrEMBL), A0A8I3P3F3 (UniProtKB/TrEMBL), A0A8C0KR90 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKL TGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL hide sequence

Ensembl Acc Id:

ENSCAFP00000034331 ⟸ ENSCAFT00000038591

Ensembl Acc Id:

ENSCAFP00000066287 ⟸ ENSCAFT00000082338

RefSeq Acc Id:

XP_038357128 ⟸ XM_038501200

RefSeq Acc Id:

XP_038483956 ⟸ XM_038628028

Protein Domains

ADF-H

RGD ID:

13686597

Promoter ID:

EPDNEW_C4666

Type:

initiation region

Name:

CFL1_1

Description:

cofilin 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Dog Assembly	Chr	Position (strand)	Source
CanFam3.1	18	51,406,766 - 51,406,826	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSCAFG00000024955	Ensembl, UniProtKB/TrEMBL
	ENSCAFG00030014369	UniProtKB/TrEMBL
	ENSCAFG00040015884	UniProtKB/TrEMBL
	ENSCAFG00845018065	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCAFT00000038591.4	UniProtKB/TrEMBL
	ENSCAFT00000082338.2	UniProtKB/TrEMBL
	ENSCAFT00000102070.1	UniProtKB/TrEMBL
	ENSCAFT00030026606.1	UniProtKB/TrEMBL
	ENSCAFT00030026660.1	UniProtKB/TrEMBL
	ENSCAFT00040029281.1	UniProtKB/TrEMBL
	ENSCAFT00040029331.1	UniProtKB/TrEMBL
	ENSCAFT00845031982.1	UniProtKB/TrEMBL
	ENSCAFT00845032022	ENTREZGENE
	ENSCAFT00845032022.1	UniProtKB/TrEMBL
	ENSCAFT00845032060.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.20.10	UniProtKB/TrEMBL
InterPro	ADF-H	UniProtKB/TrEMBL
	ADF-H/Gelsolin-like_dom_sf	UniProtKB/TrEMBL
	ADF/Cofilin	UniProtKB/TrEMBL
KEGG Report	cfa:476022	UniProtKB/TrEMBL
NCBI Gene	CFL1	ENTREZGENE
PANTHER	PTHR11913	UniProtKB/TrEMBL
Pfam	Cofilin_ADF	UniProtKB/TrEMBL
PRINTS	COFILIN	UniProtKB/TrEMBL
PROSITE	ADF_H	UniProtKB/TrEMBL
SMART	ADF	UniProtKB/TrEMBL
Superfamily-SCOP	Actin depolymerizing proteins	UniProtKB/TrEMBL
UniProt	A0A8C0KR90	ENTREZGENE
	A0A8C0NGL0	ENTREZGENE, UniProtKB/TrEMBL
	A0A8C0RK39_CANLF	UniProtKB/TrEMBL
	A0A8I3P3F3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I3PA72_CANLF	UniProtKB/TrEMBL
	A0A8I3S096_CANLF	UniProtKB/TrEMBL
	A0A8P0TNM7_CANLF	UniProtKB/TrEMBL
VGNC ID	VGNC:56088	ENTREZGENE

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations