Advanced Search (OLGA)

Gene: POLR2G (RNA polymerase II subunit G) Pan paniscus

Subscribe to Updates

Analyze

Symbol:

POLR2G

Name:

RNA polymerase II subunit G

RGD ID:

11994012

Description:

ENCODES a protein that exhibits nucleic acid binding (inferred); single-stranded DNA binding (inferred); single-stranded RNA binding (inferred); INVOLVED IN DNA-templated transcription (inferred); DNA-templated transcription initiation (inferred); positive regulation of nuclear-transcribed mRNA poly(A) tail shortening (inferred); PARTICIPATES IN RNA polymerase II transcription pathway; ASSOCIATED WITH Chemical and Drug Induced Liver Injury (ortholog); intellectual disability (ortholog); leukocyte adhesion deficiency 3 (ortholog); FOUND IN DNA-directed RNA polymerase complex (inferred); nucleoplasm (inferred); nucleus (inferred)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

DNA-directed RNA polymerase II subunit RPB7; polymerase (RNA) II (DNA directed) polypeptide G

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly

Position:

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	63,986,513 - 63,991,720 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	65,029,219 - 65,034,411 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	58,116,833 - 58,122,031 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	61,470,866 - 61,476,073 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	61,470,866 - 61,476,073 (+)	Ensembl	panpan1.1		panPan2

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	intellectual disability		ISO	POLR2G (Homo sapiens)	8554872	ClinVar Annotator: match by term: Intellectual disability	ClinVar
POLR2G	Bonobo	leukocyte adhesion deficiency 3		ISO	POLR2G (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leukocyte adhesion deficiency 3	ClinVar	PMID:28492532

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	Chemical and Drug Induced Liver Injury		ISO	POLR2G (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:25231249

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	DNA-templated transcription	involved_in	IEA	InterPro:IPR005576	150520179		InterPro	GO_REF:0000002
POLR2G	Bonobo	DNA-templated transcription initiation	involved_in	IEA	InterPro:IPR045113	150520179		InterPro	GO_REF:0000002
POLR2G	Bonobo	DNA-templated transcription initiation	involved_in	IEA	UniRule:UR001695796	150520179		UniProt	GO_REF:0000104
POLR2G	Bonobo	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	involved_in	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	positive regulation of translational initiation	involved_in	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	transcription by RNA polymerase II	involved_in	IEA	UniProtKB:P62487 and ensembl:ENSP00000301788	150520179		Ensembl	GO_REF:0000107
POLR2G	Bonobo	transcription initiation at RNA polymerase II promoter	involved_in	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	DNA-directed RNA polymerase complex	part_of	IEA	UniProtKB-KW:KW-0240	150520179		UniProt	GO_REF:0000043
POLR2G	Bonobo	nucleoplasm	located_in	IEA	UniProtKB:P62487 and ensembl:ENSP00000301788	150520179		Ensembl	GO_REF:0000107
POLR2G	Bonobo	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	150520179		UniProt	GO_REF:0000044
POLR2G	Bonobo	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	150520179		UniProt	GO_REF:0000043
POLR2G	Bonobo	nucleus	located_in	IEA	UniRule:UR001695796	150520179		UniProt	GO_REF:0000104
POLR2G	Bonobo	nucleus	located_in	IEA	UniProtKB:P62487 and ensembl:ENSP00000301788	150520179		Ensembl	GO_REF:0000107
POLR2G	Bonobo	P-body	located_in	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	RNA polymerase II, core complex	part_of	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	RNA polymerase II, core complex	part_of	IEA	UniProtKB:P62487 and ensembl:ENSP00000301788	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	nucleic acid binding	enables	IEA	InterPro:IPR003029	150520179		InterPro	GO_REF:0000002
POLR2G	Bonobo	protein binding	enables	ISO	UniProtKB:O15514	9068941	PMID:9528765	UniProt	PMID:9528765
POLR2G	Bonobo	protein binding	enables	ISO	UniProtKB:P25791-3	9068941	PMID:28514442	IntAct	PMID:28514442
POLR2G	Bonobo	protein binding	enables	ISO	UniProtKB:O15160 more ...	9068941	PMID:32296183	IntAct	PMID:32296183
POLR2G	Bonobo	single-stranded DNA binding	enables	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	single-stranded RNA binding	enables	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118
POLR2G	Bonobo	translation initiation factor binding	enables	IEA	PANTHER:PTN000295300	150520179		TreeGrafter	GO_REF:0000118

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
POLR2G	Bonobo	RNA polymerase II transcription pathway		ISO	POLR2G (Homo sapiens)	9068941		RGD	PMID:22960599 and REF_RGD_ID:9588243

PMID:22301074	PMID:30032202

POLR2G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	63,986,513 - 63,991,720 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	65,029,219 - 65,034,411 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	58,116,833 - 58,122,031 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	61,470,866 - 61,476,073 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	61,470,866 - 61,476,073 (+)	Ensembl	panpan1.1		panPan2

POLR2G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	62,761,580 - 62,766,710 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	62,761,565 - 62,766,710 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	62,529,052 - 62,534,182 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	62,285,591 - 62,290,757 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	62,285,590 - 62,290,757	NCBI
Celera	11	59,857,593 - 59,862,769 (+)	NCBI		Celera
Cytogenetic Map	11	q12.3	NCBI
HuRef	11	58,857,889 - 58,863,065 (+)	NCBI		HuRef
CHM1_1	11	62,412,016 - 62,417,192 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	62,750,899 - 62,756,030 (+)	NCBI		T2T-CHM13v2.0

Polr2g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	8,770,493 - 8,775,921 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	8,770,491 - 8,775,941 (-)	Ensembl		GRCm39 Ensembl
GRCm38	19	8,793,129 - 8,798,557 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	8,793,127 - 8,798,577 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	8,867,619 - 8,873,047 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	8,860,174 - 8,865,602 (-)	NCBI		MGSCv36	mm8
Celera	19	8,553,021 - 8,558,449 (-)	NCBI		Celera
Cytogenetic Map	19	A	NCBI
cM Map	19	5.62	NCBI

Polr2g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	215,118,278 - 215,125,389 (-)	NCBI		GRCr8
mRatBN7.2	1	205,689,160 - 205,692,537 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	205,689,160 - 205,692,686 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	214,097,574 - 214,100,946 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	221,132,707 - 221,136,084 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	213,825,410 - 213,828,787 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	224,991,250 - 224,998,355 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	224,991,222 - 224,994,653 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	231,929,423 - 231,936,528 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	211,462,321 - 211,465,698 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	211,620,752 - 211,627,860 (-)	NCBI
Celera	1	203,202,089 - 203,205,466 (-)	NCBI		Celera
Cytogenetic Map	1	q43	NCBI

Polr2g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955599	464,879 - 471,976 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955599	469,233 - 471,761 (-)	NCBI	ChiLan1.0	ChiLan1.0

POLR2G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	53,916,431 - 53,919,724 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	53,916,435 - 53,919,549 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	52,522,261 - 52,530,211 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	54,968,916 - 54,976,918 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	54,966,549 - 54,972,077 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	54,065,288 - 54,073,274 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	53,639,765 - 53,647,770 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	54,436,033 - 54,444,050 (-)	NCBI		UU_Cfam_GSD_1.0

Polr2g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	10,409,272 - 10,414,410 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936581	522,950 - 528,933 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936581	523,018 - 528,167 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR2G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	9,004,390 - 9,017,779 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	9,004,388 - 9,008,631 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	8,349,630 - 8,353,856 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR2G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	11,140,897 - 11,150,879 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	11,140,867 - 11,150,882 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	108,483,625 - 108,488,373 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr2g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624926	1,228,602 - 1,230,943 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624926	1,228,590 - 1,230,943 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_003828505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JARIFH020000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSPPAT00000056879 ⟹ ENSPPAP00000033998

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
PanPan1.1 Ensembl	11	61,470,866 - 61,476,073 (+)	Ensembl

Ensembl Acc Id:

ENSPPAT00000056884 ⟹ ENSPPAP00000034003

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
PanPan1.1 Ensembl	11	61,471,023 - 61,471,988 (+)	Ensembl

RefSeq Acc Id:

XM_003828505 ⟹ XP_003828553

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1-v2	9	63,986,513 - 63,991,720 (+)	NCBI
NHGRI_mPanPan1	11	65,029,219 - 65,034,411 (+)	NCBI
Mhudiblu_PPA_v0	11	58,116,833 - 58,122,031 (+)	NCBI
PanPan1.1	11	61,470,866 - 61,476,073 (+)	NCBI

Sequence:

show sequence

GGAGCTGGTGGAGTTCCGCCCTCGCGGAGGAGGTGGAGTTCCGCCCTCCTAGTCGCAGCAAGCGCGGAACTGGGGTTGCGGCGTCTAAGTGTGTTTCCGGTGGATTCCCAGGGACTGTCGGAGGTGTG
GACTCTGCCTGCCTACCTGGTCTGGGAAGATGTTCTACCATATCTCCCTAGAGCACGAAATCCTGCTGCACCCGCGCTACTTCGGCCCCAACTTGCTCAACACGGTGAAGCAGAAGCTCTTCACCGAG
GTGGAGGGGACCTGCACAGGGAAGTATGGCTTTGTAATTGCTGTCACCACCATTGACAATATTGGTGCTGGTGTGATCCAGCCAGGCCGAGGCTTTGTCCTTTATCCAGTTAAGTACAAGGCCATTGT
TTTCCGGCCATTTAAAGGGGAGGTCGTGGATGCTGTTGTCACTCAGGTCAACAAGGTTGGACTCTTCACAGAAATTGGGCCCATGTCTTGCTTCATCTCTCGACATTCCATCCCTTCAGAGATGGAGT
TTGATCCTAACTCCAACCCACCATGTTACAAGACAATGGATGAGGATATTGTGATTCAGCAGGACGATGAGATCCGCTTAAAGATTGTGGGGACCCGTGTGGACAAGAATGACATTTTTGCTATTGGC
TCCCTGATGGACGATTACTTGGGGCTTGTAAGCTGAGCCTGGTGGCCTCCTACCCTTGGTCCTACTCTAGGAAGTGTGATTGTCACACTTATCATGTTGTCCAGAGGTCCAGTCTGGCTGCTGTTGTG
GAGGCAAGGAAGGCAACTCATCCCAGAAGGCATCTGGTGCTTCTTGTAGCTTAACTACTGCCTCCTGATTTTTCAGTATGTGTTCTAAGTATAAAAAGTCCTTGGTTCTCATGGAA

hide sequence


Protein RefSeqs	XP_003828553	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSPPAP00000033998.1
	ENSPPAP00000034003.1

RefSeq Acc Id:	XP_003828553 ⟸ XM_003828505
- UniProtKB:	A0A2R9BWD8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQPGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFDPNSNPPCY KTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS hide sequence

Ensembl Acc Id:

ENSPPAP00000033998 ⟸ ENSPPAT00000056879

Ensembl Acc Id:

ENSPPAP00000034003 ⟸ ENSPPAT00000056884

Protein Domains

S1 motif

Database	Acc Id	Source(s)
Ensembl Genes	ENSPPAG00000039868	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSPPAT00000056879.1	UniProtKB/TrEMBL
	ENSPPAT00000056884.1	UniProtKB/TrEMBL
Gene3D-CATH	2.40.50.140	UniProtKB/TrEMBL
	3.30.1490.120	UniProtKB/TrEMBL
InterPro	NA-bd_OB-fold	UniProtKB/TrEMBL
	RNA_pol_Rpb7-like_N_sf	UniProtKB/TrEMBL
	Rpb7-like	UniProtKB/TrEMBL
	Rpb7-like_N	UniProtKB/TrEMBL
	S1_domain	UniProtKB/TrEMBL
KEGG Report	pps:100968084	UniProtKB/TrEMBL
NCBI Gene	POLR2G	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB7	UniProtKB/TrEMBL
	PTHR12709	UniProtKB/TrEMBL
Pfam	PF00575	UniProtKB/TrEMBL
	SHS2_Rpb7-N	UniProtKB/TrEMBL
SMART	SM00316	UniProtKB/TrEMBL
Superfamily-SCOP	SSF50249	UniProtKB/TrEMBL
	SSF88798	UniProtKB/TrEMBL
UniProt	A0A2R9BWD8	ENTREZGENE, UniProtKB/TrEMBL
	A0A2R9BWE2_PANPA	UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations