KLF2 (KLF transcription factor 2)

Advanced Search (OLGA)

Gene: KLF2 (KLF transcription factor 2) Pan paniscus

Analyze

Symbol:

KLF2

Name:

KLF transcription factor 2

RGD ID:

11902619

Description:

ENCODES a protein that exhibits DNA binding (ortholog); DNA-binding transcription factor activity (ortholog); DNA-binding transcription factor activity, RNA polymerase II-specific (ortholog); INVOLVED IN cell morphogenesis (ortholog); cellular response to cycloheximide (ortholog); cellular response to fluid shear stress (ortholog); ASSOCIATED WITH Colorectal Neoplasms (ortholog); COVID-19 (ortholog); lung disease (ortholog); FOUND IN chromatin (ortholog); nucleus (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

Krueppel-like factor 2; Kruppel like factor 2; Kruppel-like factor 2 (lung)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly

Position:

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	21,194,451 - 21,197,283 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	20,200,667 - 20,203,238 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	15,812,506 - 15,815,244 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	16,792,497 - 16,794,143 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Colorectal Neoplasms (ISO)

COVID-19 (ISO)

lung disease (ISO)

primary immunodeficiency disease (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell morphogenesis (ISO)

cellular response to cycloheximide (ISO)

cellular response to fluid shear stress (ISO)

cellular response to hydrogen peroxide (ISO)

cellular response to interleukin-1 (ISO)

cellular response to laminar fluid shear stress (ISO)

cellular response to organic cyclic compound (ISO)

cellular response to peptide (ISO)

cellular response to tumor necrosis factor (ISO)

cellular stress response to acid chemical (ISO)

epigenetic regulation of gene expression (ISO)

erythrocyte homeostasis (ISO)

erythrocyte maturation (ISO)

in utero embryonic development (ISO)

multicellular organism growth (ISO)

negative regulation of interleukin-6 production (ISO)

negative regulation of sprouting angiogenesis (ISO)

negative regulation of transcription by RNA polymerase II (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of nitric oxide biosynthetic process (ISO)

positive regulation of protein metabolic process (ISO)

positive regulation of retinoic acid receptor signaling pathway (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

response to laminar fluid shear stress (ISO)

type I pneumocyte differentiation (ISO)

vasodilation (ISO)

Cellular Component

chromatin (ISO)

nucleus (ISO)

Molecular Function

DNA binding (ISO)

DNA-binding transcription factor activity (ISO)

DNA-binding transcription factor activity, RNA polymerase II-specific (ISO)

protein binding (ISO)

sequence-specific double-stranded DNA binding (ISO)

References

Additional References at PubMed

PMID:30032202

Genomics

Comparative Map Data

KLF2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	21,194,451 - 21,197,283 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	20,200,667 - 20,203,238 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	15,812,506 - 15,815,244 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	16,792,497 - 16,794,143 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

KLF2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	16,324,826 - 16,328,685 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	16,324,826 - 16,328,685 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	16,435,637 - 16,439,496 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	16,296,651 - 16,299,345 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	16,296,650 - 16,299,337	NCBI
Celera	19	16,337,566 - 16,340,260 (+)	NCBI		Celera
Cytogenetic Map	19	p13.11	NCBI
HuRef	19	16,006,724 - 16,007,405 (+)	NCBI		HuRef
CHM1_1	19	16,435,181 - 16,437,875 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	16,459,702 - 16,463,562 (+)	NCBI		T2T-CHM13v2.0

Klf2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	73,072,906 - 73,075,498 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	73,072,877 - 73,075,500 (+)	Ensembl		GRCm39 Ensembl
GRCm38	8	72,319,062 - 72,321,654 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	72,319,033 - 72,321,656 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	74,842,961 - 74,845,553 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	75,248,022 - 75,250,338 (+)	NCBI		MGSCv36	mm8
Celera	8	76,656,424 - 76,659,017 (+)	NCBI		Celera
Cytogenetic Map	8	B3.3	NCBI
cM Map	8	34.99	NCBI

Klf2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	17,555,136 - 17,557,768 (-)	NCBI		GRCr8
mRatBN7.2	16	17,521,107 - 17,523,739 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	17,514,552 - 17,523,944 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	16	17,587,223 - 17,589,173 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	18,720,530 - 18,722,483 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	17,640,143 - 17,642,093 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	19,223,087 - 19,225,037 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	19,223,087 - 19,225,037 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	16	19,084,196 - 19,086,146 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	16	17,941,780 - 17,943,730 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	16	17,941,777 - 17,943,728 (-)	NCBI
Celera	16	17,739,313 - 17,741,263 (-)	NCBI		Celera
Cytogenetic Map	16	p14	NCBI

KLF2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	46,182,565 - 46,183,704 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	46,096,492 - 46,098,925 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	46,670,279 - 46,672,712 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	46,670,789 - 46,672,713 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	45,904,933 - 45,907,365 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	46,316,205 - 46,318,628 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	46,591,720 - 46,594,153 (-)	NCBI		UU_Cfam_GSD_1.0

KLF2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	61,270,199 - 61,273,138 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	61,270,733 - 61,273,037 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	60,903,997 - 60,904,625 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KLF2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	14,832,013 - 14,834,744 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	14,832,029 - 14,837,462 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	4,637,274 - 4,640,383 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Klf2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624908	1,021,865 - 1,023,279 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	XM_014342534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JARIFH020000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

XM_014342534 ⟹ XP_014198020

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1-v2	20	21,194,451 - 21,197,283 (+)	NCBI
NHGRI_mPanPan1	19	20,200,667 - 20,203,238 (+)	NCBI
Mhudiblu_PPA_v0	19	15,812,506 - 15,815,244 (+)	NCBI
PanPan1.1	19	16,792,497 - 16,794,143 (+)	NCBI

Sequence:

show sequence

CTGGAGCTGCTGGAGGCCAAGCCAAAGCGCGGCCGCCGCTCTTGGCCCCGCAAACGCACCGCCA
CTCACACCTGCAGCTACGCGGGCTGCGGCAAGACCTACACCAAGAGTTCGCATCTGAAGGCGCA
TCTGCGCACGCACACAGGTGAGAAGCCCTACCACTGCAACTGGGACGGCTGCGGCTGGAAGTTT
GCGCGCTCAGACGAGCTCACGCGCCACTACCGAAAGCACACGGGCCACCGGCCATTCCAGTGCC
ATCTGTGCGATCGTGCCTTCTCGCGCTCCGATCACCTGGCGCTGCACATGAAACGGCACATGTA
GCCGGGACGCCCCCGCCCACCTGCGCGCGGCCGTGGCGGGTCCCACGCGCCGGGCGCGGCCCCC
TCCCAAACTGTGACTGGTATTTATTGGACCCAGAGAACCGGGCCGGGCACGGCGTGGCTACAGA
GGGTCTCCCTCGATGACGACGACGACGACGCCACCACCCCAGCCCCCGTCTGTGACTGAAGGCC
CGGTGGGAAAAGACCACGATCCTCCTTGACGAGTTTTGTTTTTCAAAATGGTGCAATAATTTAA
GTGGCATCTTCTCTCCCACCGGGTCTACACTAGAGGATCGAGGCTTGTGATGCCTTGTGAGAAA
TAAGGGCCTTAATTTGTACTGTCTGCGGCATTTTTTATAATATTGTATATAGTGACTGACAAAT
ATTGTATTACTGTACATAGAGAGACAGGTGGGCATTTTTGGGCTACCTGGTTCGTTTTTATAAG
ATTTTGCTGGGTTGGTTTTTTTTTAATTAAAAAGTTTTGCATCTTTTAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	XP_014198020	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	XP_014198020 ⟸ XM_014342534
- Sequence:	show sequence LELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKF ARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM hide sequence

Additional Information

External Database Links

Database	Acc Id	Source(s)
NCBI Gene	KLF2	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-07-12	KLF2	KLF transcription factor 2	KLF2	Kruppel like factor 2	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD