Advanced Search (OLGA)

Gene: CLDN3 (claudin 3) Pan paniscus

Subscribe to Updates

Analyze

Symbol:

CLDN3

Name:

claudin 3

RGD ID:

11841711

Description:

ENCODES a protein that exhibits cell-cell adhesion mediator activity (inferred); identical protein binding (inferred); structural molecule activity (inferred); INVOLVED IN response to ethanol (ortholog); response to Gram-positive bacterium (ortholog); ASSOCIATED WITH allergic rhinitis (ortholog); autism spectrum disorder (ortholog); autistic disorder (ortholog); FOUND IN bicellular tight junction (ortholog); lateral plasma membrane (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

claudin-3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CLDN3 (claudin 3)	NCBI	Ortholog
Mus musculus (house mouse):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CLDN3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cldn3 (claudin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

Mhudiblu_PPA_v0 - Bonobo Mhudiblu_PPA_v0 Assembly

Position:

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,123,883 - 91,130,587 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,393,595 - 139,395,219 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,924,338 - 80,925,761 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,924,731 - 80,925,393 (-)	Ensembl	panpan1.1		panPan2

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	Intestinal Reperfusion Injury		ISO	Cldn3 (Rattus norvegicus)	9068941	protein:decreased expression:colon:	RGD	PMID:19929946 and REF_RGD_ID:2325127
CLDN3	Bonobo	peptic esophagitis		ISO	Cldn3 (Rattus norvegicus)	9068941	protein:altered expression:epithelial cell and esophagus:	RGD	PMID:21373849 and REF_RGD_ID:11344880

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	autism spectrum disorder		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism spectrum disorder	ClinVar	PMID:21658581 more ...
CLDN3	Bonobo	autistic disorder		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autism	ClinVar	PMID:21681106 and PMID:30208311
CLDN3	Bonobo	intestinal volvulus		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: INTESTINAL MALROTATION and FAMILIAL	ClinVar	PMID:25741868
CLDN3	Bonobo	Neurodevelopmental Disorders		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868
CLDN3	Bonobo	pleomorphic xanthoastrocytoma		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Pleomorphic xanthoastrocytoma	ClinVar	PMID:28299358
CLDN3	Bonobo	schizophrenia		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Schizophrenia	ClinVar	PMID:21681106 and PMID:30208311
CLDN3	Bonobo	supravalvular aortic stenosis		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Supravalvar aortic stenosis	ClinVar	PMID:10627943 more ...
CLDN3	Bonobo	Volvulus Of Midgut		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Volvulus of midgut	ClinVar	PMID:25741868
CLDN3	Bonobo	Williams-Beuren syndrome		ISO	CLDN3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Williams syndrome	ClinVar	PMID:25741868

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	allergic rhinitis		ISO	CLDN3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:33441633
CLDN3	Bonobo	Prostatic Neoplasms		ISO	CLDN3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:17013881
CLDN3	Bonobo	Stomach Neoplasms		ISO	CLDN3 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:16367923

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	actin cytoskeleton organization	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	bicellular tight junction assembly	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules	involved_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	cell junction assembly	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	cell junction maintenance	involved_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	cell-cell junction maintenance	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	epithelial cell morphogenesis	involved_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	establishment of endothelial blood-brain barrier	involved_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	negative regulation of cell migration	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	negative regulation of gene expression	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	negative regulation of phosphate transmembrane transport	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	positive regulation of cell migration	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	positive regulation of gene expression	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	positive regulation of wound healing	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	regulation of cell morphogenesis	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	regulation of membrane permeability	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	regulation of transepithelial transport	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	response to ethanol		ISO	Cldn3 (Rattus norvegicus)	9068941		RGD	PMID:17889313 and REF_RGD_ID:11344881
CLDN3	Bonobo	response to Gram-positive bacterium		ISO	Cldn3 (Rattus norvegicus)	9068941	Bifidobacterium bifidum	RGD	PMID:20501441 and REF_RGD_ID:2324672
CLDN3	Bonobo	response to hypoxia	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	retinal pigment epithelium development	involved_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	anchoring junction	located_in	IEA	UniProtKB-KW:KW-0965	150520179		UniProt	GO_REF:0000043
CLDN3	Bonobo	apical junction complex	located_in	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	apicolateral plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	bicellular tight junction		ISO	Cldn3 (Rattus norvegicus)	9068941		RGD	PMID:11159882 and REF_RGD_ID:727233
CLDN3	Bonobo	bicellular tight junction	located_in	IEA	UniProtKB:O15551 more ...	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	bicellular tight junction	located_in	IEA	InterPro:IPR003549 and InterPro:IPR006187	150520179		InterPro	GO_REF:0000002
CLDN3	Bonobo	bicellular tight junction	located_in	IEA	UniRule:UR000060637	150520179		UniProt	GO_REF:0000104
CLDN3	Bonobo	bicellular tight junction	located_in	IEA	UniProtKB-KW:KW-0796	150520179		UniProt	GO_REF:0000043
CLDN3	Bonobo	bicellular tight junction	located_in	IEA	UniProtKB-SubCell:SL-0265	150520179		UniProt	GO_REF:0000044
CLDN3	Bonobo	cell-cell junction	located_in	IEA	UniProtKB:O15551 more ...	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	lateral plasma membrane		ISO	Cldn3 (Rattus norvegicus)	9068941		RGD	PMID:19929946 and REF_RGD_ID:2325127
CLDN3	Bonobo	lateral plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	membrane	located_in	IEA	InterPro:IPR004031	150520179		InterPro	GO_REF:0000002
CLDN3	Bonobo	membrane	located_in	IEA	UniProtKB-KW:KW-0472	150520179		UniProt	GO_REF:0000043
CLDN3	Bonobo	membrane	located_in	IEA	UniRule:UR000060637	150520179		UniProt	GO_REF:0000104
CLDN3	Bonobo	plasma membrane	located_in	IEA	UniProtKB-SubCell:SL-0039	150520179		UniProt	GO_REF:0000044
CLDN3	Bonobo	plasma membrane	located_in	IEA	UniProtKB:Q9Z0G9 and ensembl:ENSMUSP00000091799	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	plasma membrane	located_in	IEA	UniProtKB-KW:KW-1003	150520179		UniProt	GO_REF:0000043
CLDN3	Bonobo	protein-containing complex	part_of	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	tight junction	located_in	IEA	UniProtKB:O15551 more ...	150520179		Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
CLDN3	Bonobo	cell-cell adhesion mediator activity	enables	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	identical protein binding	enables	IEA	UniProtKB:O15551 more ...	150520179		Ensembl	GO_REF:0000107
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:O95832	9068941	PMID:25849148	UniProt	PMID:25849148
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:P01558	9068941	PMID:25678664	UniProt	PMID:25678664
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:O88551 and UniProtKB:O88552	9068941	PMID:10562289	UniProt	PMID:10562289
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:P39447 more ...	9068941	PMID:10601346	UniProt	PMID:10601346
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:P57739	9068941	PMID:36008380	UniProt	PMID:36008380
CLDN3	Bonobo	protein binding	enables	ISO	UniProtKB:Q8N6F1-2	9068941	PMID:28028216	UniProt	PMID:28028216
CLDN3	Bonobo	structural molecule activity	enables	IEA	InterPro:IPR003549 and InterPro:IPR006187	150520179		InterPro	GO_REF:0000002
CLDN3	Bonobo	structural molecule activity	enables	IEA	UniProtKB:O15551 and ensembl:ENSP00000378577	150520179		Ensembl	GO_REF:0000107

PMID:22301074	PMID:30032202

CLDN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	91,123,883 - 91,130,587 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	139,393,595 - 139,395,219 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1	7	80,924,338 - 80,925,761 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	80,924,731 - 80,925,393 (-)	Ensembl	panpan1.1		panPan2

CLDN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	73,768,997 - 73,770,270 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	73,768,997 - 73,770,270 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	73,183,327 - 73,184,600 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	72,821,263 - 72,822,512 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	7	72,627,978 - 72,629,227	NCBI
Celera	7	68,661,514 - 68,662,787 (-)	NCBI		Celera
Cytogenetic Map	7	q11.23	NCBI
HuRef	7	69,065,982 - 69,067,255 (-)	NCBI		HuRef
CHM1_1	7	73,329,029 - 73,330,302 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	74,969,874 - 74,971,147 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	72,516,399 - 72,517,672 (-)	NCBI

Cldn3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	135,015,068 - 135,016,330 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	135,015,068 - 135,016,326 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	134,986,214 - 134,987,476 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	134,986,214 - 134,987,472 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	135,462,084 - 135,463,342 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	135,270,841 - 135,272,099 (+)	NCBI		MGSCv36	mm8
Celera	5	131,997,044 - 131,998,302 (+)	NCBI		Celera
Cytogenetic Map	5	G2	NCBI
cM Map	5	74.93	NCBI

Cldn3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	12	27,345,075 - 27,346,547 (-)	NCBI		GRCr8
mRatBN7.2	12	21,708,538 - 21,710,010 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	21,708,398 - 21,711,001 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	12	22,849,399 - 22,850,871 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	12	23,461,727 - 23,463,199 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	12	22,529,747 - 22,531,219 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	12	21,831,341 - 21,832,813 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	12	21,831,342 - 21,832,813 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	12	23,849,259 - 23,850,731 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	12	23,471,431 - 23,472,903 (-)	NCBI		Celera
Cytogenetic Map	12	q12	NCBI

CLDN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	6,534,229 - 6,535,237 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	8,231,695 - 8,232,703 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	6,349,000 - 6,350,005 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	6,348,948 - 6,350,256 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	6,338,822 - 6,339,825 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	6,286,583 - 6,287,588 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	6,450,257 - 6,451,264 (+)	NCBI		UU_Cfam_GSD_1.0

Cldn3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	131,083,239 - 131,084,510 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936543	2,951,086 - 2,953,956 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936543	2,952,054 - 2,953,313 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CLDN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	11,019,073 - 11,020,102 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	11,019,073 - 11,020,102 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	10,715,404 - 10,716,250 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CLDN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	28	9,301,312 - 9,303,496 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	28	9,302,446 - 9,303,108 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666070	7,203,761 - 7,205,348 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cldn3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624740	14,065,478 - 14,066,137 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624740	14,065,172 - 14,066,432 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_003815566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JARIFH020000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSPPAT00000011329 ⟹ ENSPPAP00000002314

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
PanPan1.1 Ensembl	7	80,924,731 - 80,925,393 (-)	Ensembl

RefSeq Acc Id:

XM_003815566 ⟹ XP_003815614

Type:

CODING

Position:

Bonobo Assembly	Chr	Position (strand)	Source
NHGRI_mPanPan1-v2	6	91,123,883 - 91,130,587 (+)	NCBI
NHGRI_mPanPan1	7	139,393,595 - 139,395,219 (+)	NCBI
PanPan1.1	7	80,924,338 - 80,925,761 (-)	NCBI

Sequence:

show sequence

CCTCCCAGGACGCTCGGTGAAGGTGGGGGGCAGGGGCCACGTCACTGTCCTTAGGCCCTGGAGAGCGCGGCTCCGCCCCTCCCGCCCCCACCGGAGCGCTGGGCACTTAGCTAAGACGCACCGGCCCC
AGCCCAGGGCCAGCCCAGTCGCCGCCGCCCGCCCACAAAGCCACAGGCAGGTGCAGGCGCAGCCGCGGCGAGAGCGTGTGGAGCCGAGCCGTTAGCGCGCGCCGTCGGTGAGTCAGTGCGTCCGTCCG
TCCGTCCGTCCGTCCGTCGGGGCGCCGCAGCTCCCGCCAGGCCCAGCGGCCCCGGCCCCTCGTCTCCCCGCACCCGGAGCCACCCGGTGGAGTGGGCCTTGCCGCGGCAGCCATGTCCATGGGCCTGG
AGATCACGGGCACCGCGCTGGCCGTGCTGGGCTGGCTGGGCACCATCGTGTGCTGCGCGCTGCCCATGTGGCGCGTGTCGGCCTTCATCGGCAGCAACATCATCACGTCGCAGAACATCTGGGAGGGC
CTGTGGATGAACTGCGTGGTGCAGAGCACCGGCCAGATGCAGTGCAAGGTGTACGACTCGCTGCTGGCACTGCCGCAGGACCTGCAGGCGGCCCGCGCCCTCATCGTGGTGGCCATCCTGCTGGCCGC
CTTCGGGCTGCTAGTGGCGCTGGTGGGCGCCCAGTGCACCAACTGCGTGCAGGACGACACGGCCAAGGCCAAGATCACCATCGTGGCGGGCGTGCTGTTCCTTCTCGCCGCCCTGCTCACCCTCGTGC
CGGTGTCCTGGTCGGCCAACACCATTATCCGGGACTTCTACAACCCCGTGGTGCCCGAGGCGCAGAAGCGCGAGATGGGCGCGGGCCTGTACGTGGGCTGGGCGGCCGCGGCGCTGCAGCTGCTGGGG
GGCGCGCTGCTCTGCTGCTCGTGTCCCCCACGCGAGAAGAAGTACACGGCCACCAAGGTCGTCTACTCCGCGCCGCGCTCCACCGGCCCGGGAGCCAGCCTGGGCACAGGCTACGACCGCAAGGACTA
CGTCTAAGGGACAGACGCAGGGAGACACCACCACCACCACCACCACCACCACCACCACCACCACCACCGCGAGCTGGAGCGCGCACCAGGCCATCCAGCGTGCAGCCTTGCCTCGGAGGCCAGCCCAC
CCCCAGAAGCCAGGAAGCCCCCGCGCTGGACTGGGGCAGCTTCCCCAGCAGCCACCGCTTTGCCGGCCGGGCAGTCGACTTCGGGGCCCAGGGACCAACCTGCATGGACTGTGAAACCTCACCCTTCT
GGAGCACGGGGCCTGGGTGCCCGCCAATACTTGACCACCCCATCGAGTCCCATCGGGCCGCTGCCCCCATGCTCGCGCTGGGCAGGGACCGGCAGCCCTGGAAGGGGCACTTGATATTTTTCAATAAA
AGCCTTTCGTTTTGCA

hide sequence


Protein RefSeqs	XP_003815614	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSPPAP00000002314.1

RefSeq Acc Id:

XP_003815614 ⟸ XM_003815566

- UniProtKB:

A0A2R8ZHZ2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVAGVLFLLAA
LLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV

hide sequence

Ensembl Acc Id:

ENSPPAP00000002314 ⟸ ENSPPAT00000011329

Database	Acc Id	Source(s)
Ensembl Genes	ENSPPAG00000010463	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSPPAT00000011329.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.140.150	UniProtKB/TrEMBL
InterPro	Claudin	UniProtKB/TrEMBL
	Claudin3	UniProtKB/TrEMBL
	Claudin_CS	UniProtKB/TrEMBL
	PMP22/EMP/MP20/Claudin	UniProtKB/TrEMBL
KEGG Report	pps:100975200	UniProtKB/TrEMBL
NCBI Gene	CLDN3	ENTREZGENE
PANTHER	PTHR12002	UniProtKB/TrEMBL
Pfam	PMP22_Claudin	UniProtKB/TrEMBL
PRINTS	CLAUDIN	UniProtKB/TrEMBL
	CLAUDIN3	UniProtKB/TrEMBL
PROSITE	CLAUDIN	UniProtKB/TrEMBL
UniProt	A0A2R8ZHZ2	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD