Symbol:
Piga
Name:
phosphatidylinositol glycan anchor biosynthesis, class A
RGD ID:
11100
MGI Page
MGI
Description:
Predicted to enable phosphatidylinositol N-acetylglucosaminyltransferase activity. Acts upstream of or within GPI anchor biosynthetic process and cellular response to leukemia inhibitory factor. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. Is expressed in 1st branchial arch; central nervous system; heart; limb; and medial-nasal process. Used to study autosomal recessive congenital ichthyosis 4B. Human ortholog(s) of this gene implicated in multiple congenital anomalies-hypotonia-seizures syndrome 2 and paroxysmal nocturnal hemoglobinuria. Orthologous to human PIGA (phosphatidylinositol glycan anchor biosynthesis class A).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI194334; glcNAc-PI synthesis protein; N-acetylglucosaminyl-phosphatidylinositol biosynthetic protein; phosphatidylinositol glycan, class A; phosphatidylinositol N-acetylglucosaminyltransferase subunit A; phosphatidylinositol-glycan biosynthesis class A protein; phosphatidylinositolglycan class A; Pi; Pig-a
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Piga (phosphatidylinositol glycan anchor biosynthesis, class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Piga (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Piga (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Piga (phosphatidylinositol glycan anchor biosynthesis class A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Piga (phosphatidylinositol glycan anchor biosynthesis, class A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PIGA (phosphatidylinositol glycan anchor biosynthesis class A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
piga (phosphatidylinositol glycan anchor biosynthesis, class A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
piga-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
PIG-A
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
SPT14
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
piga
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm19121
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 163,202,814 - 163,216,912 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 163,202,783 - 163,216,912 (+) Ensembl GRCm39 Ensembl GRCm38 X 164,419,780 - 164,433,916 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 164,419,787 - 164,433,916 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 160,857,719 - 160,871,847 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 159,763,921 - 159,778,021 (+) NCBI MGSCv36 mm8 Celera X 147,635,146 - 147,649,303 (+) NCBI Celera Cytogenetic Map X F5 NCBI cM Map X 76.49 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Piga Mouse (-)-epigallocatechin 3-gallate increases expression ISO PIGA (Homo sapiens) 6480464 epigallocatechin gallate results in increased expression of PIGA mRNA CTD PMID:16084531 Piga Mouse (-)-epigallocatechin 3-gallate multiple interactions ISO PIGA (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PIGA mRNA CTD PMID:22079256 Piga Mouse (S)-nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PIGA mRNA CTD PMID:21955143 Piga Mouse 1,2-dichloroethene multiple interactions ISO PIGA (Homo sapiens) 6480464 1 more ... CTD PMID:32199159 Piga Mouse 1,3-Propane sultone increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 1 more ... CTD PMID:22923490 and PMID:32659469 Piga Mouse 1,3-Propane sultone multiple interactions ISO Piga (Rattus norvegicus) 6480464 1 and 3-propane sultone results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse 1,4-phenylenediamine increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 4-phenylenediamine results in increased mutagenesis of PIGA gene CTD PMID:30439388 Piga Mouse 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of PIGA mRNA CTD PMID:17555576 Piga Mouse 17beta-estradiol increases expression ISO PIGA (Homo sapiens) 6480464 Estradiol results in increased expression of PIGA mRNA CTD PMID:20106945 Piga Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of PIGA mRNA CTD PMID:39298647 Piga Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Piga Mouse 2,3',4,4',5-Pentachlorobiphenyl increases mutagenesis ISO PIGA (Homo sapiens) 6480464 2 more ... CTD PMID:32199159 Piga Mouse 2,3',4,4',5-Pentachlorobiphenyl multiple interactions ISO PIGA (Homo sapiens) 6480464 1 more ... CTD PMID:32199159 Piga Mouse 2,3,4,3',4'-Pentachlorobiphenyl increases mutagenesis ISO PIGA (Homo sapiens) 6480464 2 more ... CTD PMID:32199159 Piga Mouse 2,3,4,3',4'-Pentachlorobiphenyl multiple interactions ISO PIGA (Homo sapiens) 6480464 1 more ... CTD PMID:32199159 Piga Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Piga (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of PIGA mRNA CTD PMID:22298810 Piga Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Piga (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIGA mRNA CTD PMID:33387578 Piga Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PIGA mRNA CTD PMID:31961203 Piga Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PIGA (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIGA mRNA CTD PMID:21632981 Piga Mouse 2-acetamidofluorene increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 2-Acetylaminofluorene results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse 2-amino-2-deoxy-D-glucopyranose decreases expression EXP 6480464 Glucosamine results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse 2-hydroxypropanoic acid increases expression ISO PIGA (Homo sapiens) 6480464 Lactic Acid results in increased expression of PIGA mRNA CTD PMID:30851411 Piga Mouse 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PIGA mRNA CTD PMID:18648102 Piga Mouse 4-nitroquinoline N-oxide multiple interactions ISO Piga (Rattus norvegicus) 6480464 4-Nitroquinoline-1-oxide results in increased mutagenesis of and results in decreased activity of PIGA protein more ... CTD PMID:19965957 and PMID:20202993 Piga Mouse 4-nitroquinoline N-oxide increases mutagenesis EXP 6480464 4-Nitroquinoline-1-oxide results in increased mutagenesis of PIGA gene CTD PMID:29362862 Piga Mouse 4-nitroquinoline N-oxide increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 4-Nitroquinoline-1-oxide results in increased mutagenesis of PIGA and 4-Nitroquinoline-1-oxide results in increased mutagenesis of PIGA gene CTD PMID:20202993 and PMID:22923490 Piga Mouse 6-propyl-2-thiouracil decreases expression ISO Piga (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of PIGA mRNA CTD PMID:24780913 Piga Mouse 7,12-dimethyltetraphene multiple interactions ISO Piga (Rattus norvegicus) 6480464 9 more ... CTD PMID:19965957 and PMID:20202993 Piga Mouse 7,12-dimethyltetraphene increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 9 more ... CTD PMID:20202993 and PMID:22923490 Piga Mouse aldehydo-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse amiodarone increases expression ISO PIGA (Homo sapiens) 6480464 Amiodarone results in increased expression of PIGA mRNA CTD PMID:19774075 Piga Mouse antirheumatic drug decreases expression ISO PIGA (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PIGA mRNA CTD PMID:24449571 Piga Mouse aristolochic acid A decreases expression ISO PIGA (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of PIGA mRNA CTD PMID:33212167 Piga Mouse aristolochic acids multiple interactions ISO Piga (Rattus norvegicus) 6480464 Aristolochic Acids results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of PIGA mRNA CTD PMID:23650126 Piga Mouse azathioprine affects mutagenesis ISO Piga (Rattus norvegicus) 6480464 Azathioprine affects the mutagenesis of PIGA CTD PMID:22923490 Piga Mouse benzo[a]pyrene multiple interactions ISO Piga (Rattus norvegicus) 6480464 [Benzo(a)pyrene results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein more ... CTD PMID:19965957 more ... Piga Mouse benzo[a]pyrene affects methylation ISO PIGA (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PIGA 5' UTR and Benzo(a)pyrene affects the methylation of PIGA promoter CTD PMID:27901495 Piga Mouse benzo[a]pyrene decreases methylation ISO PIGA (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PIGA 3' UTR CTD PMID:27901495 Piga Mouse benzo[a]pyrene multiple interactions EXP 6480464 POR protein affects the reaction [Benzo(a)pyrene results in increased mutagenesis of PIGA gene] CTD PMID:28111842 Piga Mouse benzo[a]pyrene increases mutagenesis ISO PIGA (Homo sapiens) 6480464 Benzo(a)pyrene results in increased mutagenesis of PIGA gene CTD PMID:28461126 Piga Mouse benzo[a]pyrene increases mutagenesis EXP 6480464 Benzo(a)pyrene results in increased mutagenesis of PIGA gene CTD PMID:24105957 and PMID:28111842 Piga Mouse benzo[a]pyrene increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Benzo(a)pyrene results in increased mutagenesis of PIGA and Benzo(a)pyrene results in increased mutagenesis of PIGA gene CTD PMID:20202993 more ... Piga Mouse benzo[a]pyrene diol epoxide I decreases expression ISO PIGA (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Piga Mouse beta-D-glucosamine decreases expression EXP 6480464 Glucosamine results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse beta-lapachone increases expression ISO PIGA (Homo sapiens) 6480464 beta-lapachone results in increased expression of PIGA mRNA CTD PMID:38218311 Piga Mouse beta-lapachone decreases expression ISO PIGA (Homo sapiens) 6480464 beta-lapachone results in decreased expression of PIGA mRNA CTD PMID:38218311 Piga Mouse bisphenol A affects expression ISO Piga (Rattus norvegicus) 6480464 bisphenol A affects the expression of PIGA mRNA CTD PMID:25181051 Piga Mouse bisphenol A decreases expression ISO Piga (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of PIGA mRNA CTD PMID:30816183 more ... Piga Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIGA mRNA CTD PMID:25594700 Piga Mouse cadmium dichloride affects expression ISO Piga (Rattus norvegicus) 6480464 Cadmium Chloride affects the expression of PIGA mRNA CTD PMID:22110744 Piga Mouse cadmium dichloride increases expression ISO PIGA (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of PIGA mRNA CTD PMID:38568856 Piga Mouse carbamazepine affects expression ISO PIGA (Homo sapiens) 6480464 Carbamazepine affects the expression of PIGA mRNA CTD PMID:25979313 Piga Mouse carbamazepine increases mutagenesis ISO PIGA (Homo sapiens) 6480464 Carbamazepine results in increased mutagenesis of PIGA gene CTD PMID:36995427 Piga Mouse carbon nanotube increases expression EXP 6480464 Nanotubes and Carbon results in increased expression of PIGA mRNA CTD PMID:25620056 Piga Mouse CGP 52608 multiple interactions ISO PIGA (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PIGA gene] CTD PMID:28238834 Piga Mouse chlorambucil increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Chlorambucil results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse chlorambucil multiple interactions ISO Piga (Rattus norvegicus) 6480464 Chlorambucil results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PIGA mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIGA gene CTD PMID:20938992 Piga Mouse chromium(6+) multiple interactions ISO PIGA (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PIGA mRNA CTD PMID:38479592 Piga Mouse cisplatin multiple interactions ISO PIGA (Homo sapiens) 6480464 [Cisplatin co-treated with Etoposide] results in increased mutagenesis of PIGA and [Cisplatin co-treated with jinfukang] results in decreased expression of PIGA mRNA CTD PMID:21826740 and PMID:27392435 Piga Mouse cisplatin multiple interactions ISO Piga (Rattus norvegicus) 6480464 Cisplatin results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse cisplatin increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Cisplatin results in increased mutagenesis of PIGA gene CTD PMID:23677247 Piga Mouse cobalt dichloride increases expression ISO PIGA (Homo sapiens) 6480464 cobaltous chloride results in increased expression of PIGA mRNA CTD PMID:19376846 Piga Mouse copper atom multiple interactions ISO PIGA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PIGA mRNA CTD PMID:20971185 Piga Mouse copper(0) multiple interactions ISO PIGA (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of PIGA mRNA CTD PMID:20971185 Piga Mouse copper(II) sulfate increases expression ISO PIGA (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PIGA mRNA CTD PMID:19549813 Piga Mouse cyclophosphamide increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Cyclophosphamide results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse cyclosporin A increases expression ISO PIGA (Homo sapiens) 6480464 Cyclosporine results in increased expression of PIGA mRNA CTD PMID:20106945 and PMID:27989131 Piga Mouse D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse Dibutyl phosphate affects expression ISO PIGA (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PIGA mRNA CTD PMID:37042841 Piga Mouse dicrotophos decreases expression ISO PIGA (Homo sapiens) 6480464 dicrotophos results in decreased expression of PIGA mRNA CTD PMID:28302478 Piga Mouse doxorubicin decreases expression ISO PIGA (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PIGA mRNA CTD PMID:29803840 Piga Mouse endosulfan increases expression ISO Piga (Rattus norvegicus) 6480464 Endosulfan results in increased expression of PIGA mRNA CTD PMID:29391264 Piga Mouse ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PIGA mRNA CTD PMID:21955143 Piga Mouse ethyl methanesulfonate increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Ethyl Methanesulfonate results in increased mutagenesis of PIGA CTD PMID:21729764 Piga Mouse ethyl methanesulfonate increases mutagenesis ISO PIGA (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased mutagenesis of PIGA protein CTD PMID:38823534 Piga Mouse ethyl methanesulfonate increases mutagenesis EXP 6480464 Ethyl Methanesulfonate results in increased mutagenesis of PIGA gene CTD PMID:29362862 Piga Mouse ethyl methanesulfonate multiple interactions ISO Piga (Rattus norvegicus) 6480464 Ethyl Methanesulfonate results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse etoposide multiple interactions ISO PIGA (Homo sapiens) 6480464 [Cisplatin co-treated with Etoposide] results in increased mutagenesis of PIGA CTD PMID:21826740 Piga Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PIGA mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIGA gene CTD PMID:20938992 Piga Mouse gentamycin increases expression ISO Piga (Rattus norvegicus) 6480464 Gentamicins results in increased expression of PIGA mRNA CTD PMID:33387578 Piga Mouse glucose decreases expression EXP 6480464 Glucose results in decreased expression of PIGA mRNA CTD PMID:17178593 Piga Mouse gold atom decreases expression ISO PIGA (Homo sapiens) 6480464 Gold results in decreased expression of PIGA mRNA CTD PMID:25523186 Piga Mouse gold(0) decreases expression ISO PIGA (Homo sapiens) 6480464 Gold results in decreased expression of PIGA mRNA CTD PMID:25523186 Piga Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of PIGA mRNA CTD PMID:21823215 Piga Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PIGA mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIGA gene CTD PMID:20938992 Piga Mouse melphalan increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Melphalan results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse melphalan multiple interactions ISO Piga (Rattus norvegicus) 6480464 Melphalan results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse methyl methanesulfonate increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Methyl Methanesulfonate results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse morphine decreases expression EXP 6480464 Morphine results in decreased expression of PIGA mRNA CTD PMID:21955143 Piga Mouse N-acetyl-L-cysteine increases expression ISO PIGA (Homo sapiens) 6480464 Acetylcysteine results in increased expression of PIGA mRNA CTD PMID:16084531 Piga Mouse N-ethyl-N-nitrosourea multiple interactions ISO Piga (Rattus norvegicus) 6480464 [Ethylnitrosourea results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein more ... CTD PMID:19965957 more ... Piga Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of PIGA gene CTD PMID:24105957 and PMID:29362862 Piga Mouse N-ethyl-N-nitrosourea increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Ethylnitrosourea results in increased mutagenesis of PIGA and Ethylnitrosourea results in increased mutagenesis of PIGA gene CTD PMID:20202993 more ... Piga Mouse N-methyl-N-nitrosourea multiple interactions ISO Piga (Rattus norvegicus) 6480464 [Methylnitrosourea results in increased mutagenesis of and results in decreased activity of PIGA protein] which affects the localization of CD59 protein more ... CTD PMID:19965957 more ... Piga Mouse N-methyl-N-nitrosourea increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Methylnitrosourea results in increased mutagenesis of PIGA and Methylnitrosourea results in increased mutagenesis of PIGA gene CTD PMID:20202993 and PMID:22923490 Piga Mouse nickel atom increases expression ISO PIGA (Homo sapiens) 6480464 Nickel results in increased expression of PIGA mRNA CTD PMID:23195993 Piga Mouse nicotine decreases expression EXP 6480464 Nicotine results in decreased expression of PIGA mRNA CTD PMID:21955143 Piga Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of PIGA mRNA CTD PMID:17562736 Piga Mouse paracetamol increases expression ISO Piga (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of PIGA mRNA CTD PMID:33387578 Piga Mouse paracetamol increases expression ISO PIGA (Homo sapiens) 6480464 Acetaminophen results in increased expression of PIGA mRNA CTD PMID:21420995 Piga Mouse potassium chromate increases expression ISO PIGA (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of PIGA mRNA CTD PMID:22079256 Piga Mouse potassium chromate multiple interactions ISO PIGA (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of PIGA mRNA CTD PMID:22079256 Piga Mouse propiconazole increases expression EXP 6480464 propiconazole results in increased expression of PIGA mRNA CTD PMID:21278054 Piga Mouse pyrene increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 pyrene results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse rac-lactic acid increases expression ISO PIGA (Homo sapiens) 6480464 Lactic Acid results in increased expression of PIGA mRNA CTD PMID:30851411 Piga Mouse sodium arsenite decreases expression ISO PIGA (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PIGA mRNA CTD PMID:28595984 Piga Mouse sodium arsenite affects expression ISO PIGA (Homo sapiens) 6480464 sodium arsenite affects the expression of PIGA mRNA CTD PMID:34032870 Piga Mouse sodium arsenite increases expression ISO PIGA (Homo sapiens) 6480464 sodium arsenite results in increased expression of PIGA mRNA CTD PMID:38568856 Piga Mouse sunitinib increases expression ISO PIGA (Homo sapiens) 6480464 Sunitinib results in increased expression of PIGA mRNA CTD PMID:31533062 Piga Mouse tamoxifen affects expression EXP 6480464 Tamoxifen affects the expression of PIGA mRNA CTD PMID:17555576 Piga Mouse temozolomide multiple interactions ISO Piga (Rattus norvegicus) 6480464 temozolomide results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse testosterone decreases expression EXP 6480464 Testosterone deficiency results in decreased expression of PIGA mRNA CTD PMID:33848595 Piga Mouse testosterone multiple interactions EXP 6480464 1 more ... CTD PMID:33848595 Piga Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PIGA mRNA CTD PMID:27339419 and PMID:31919559 Piga Mouse tetrachloromethane increases expression ISO Piga (Rattus norvegicus) 6480464 Carbon Tetrachloride results in increased expression of PIGA mRNA CTD PMID:31150632 Piga Mouse Thiotepa increases mutagenesis ISO Piga (Rattus norvegicus) 6480464 Thiotepa results in increased mutagenesis of PIGA CTD PMID:22923490 Piga Mouse Thiotepa multiple interactions ISO Piga (Rattus norvegicus) 6480464 Thiotepa results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of PIGA gene and titanium dioxide results in increased methylation of PIGA promoter CTD PMID:35295148 Piga Mouse trans-1,2-dichloroethene multiple interactions ISO PIGA (Homo sapiens) 6480464 1 more ... CTD PMID:32199159 Piga Mouse tributylstannane increases expression ISO Piga (Rattus norvegicus) 6480464 tributyltin results in increased expression of PIGA mRNA CTD PMID:31129395 Piga Mouse trichostatin A affects expression ISO PIGA (Homo sapiens) 6480464 trichostatin A affects the expression of PIGA mRNA CTD PMID:28542535 Piga Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of PIGA mRNA CTD PMID:33045310 Piga Mouse tris(2-butoxyethyl) phosphate increases mutagenesis ISO PIGA (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate results in increased mutagenesis of PIGA protein CTD PMID:38823534 Piga Mouse troglitazone increases expression EXP 6480464 troglitazone results in increased expression of PIGA mRNA CTD PMID:28973697 Piga Mouse urethane multiple interactions ISO Piga (Rattus norvegicus) 6480464 Urethane results in increased mutagenesis of and results in decreased activity of PIGA protein CTD PMID:27931811 Piga Mouse valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of PIGA mRNA CTD PMID:17292431 Piga Mouse valproic acid decreases expression ISO PIGA (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PIGA mRNA CTD PMID:23179753 and PMID:27188386 Piga Mouse valproic acid affects expression ISO PIGA (Homo sapiens) 6480464 Valproic Acid affects the expression of PIGA mRNA CTD PMID:25979313 Piga Mouse valproic acid increases expression ISO PIGA (Homo sapiens) 6480464 Valproic Acid results in increased expression of PIGA mRNA CTD PMID:29154799 Piga Mouse valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of PIGA mRNA CTD PMID:21427059 Piga Mouse vinclozolin decreases expression ISO Piga (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of PIGA mRNA CTD PMID:22570695
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (EXP) 1,2-dichloroethene (ISO) 1,3-Propane sultone (ISO) 1,4-phenylenediamine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,4,3',4'-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-acetamidofluorene (ISO) 2-amino-2-deoxy-D-glucopyranose (EXP) 2-hydroxypropanoic acid (ISO) 4,4'-diaminodiphenylmethane (EXP) 4-nitroquinoline N-oxide (EXP,ISO) 6-propyl-2-thiouracil (ISO) 7,12-dimethyltetraphene (ISO) aldehydo-D-glucosamine (EXP) aldehydo-D-glucose (EXP) amiodarone (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) aristolochic acids (ISO) Aroclor 1254 (EXP) azathioprine (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) beta-D-glucosamine (EXP) beta-lapachone (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) carbamazepine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chlorambucil (ISO) choline (EXP) chromium(6+) (ISO) cisplatin (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) cyclophosphamide (ISO) cyclosporin A (ISO) D-glucose (EXP) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) endosulfan (ISO) ethanol (EXP) ethyl methanesulfonate (EXP,ISO) etoposide (ISO) folic acid (EXP) gentamycin (ISO) glucose (EXP) gold atom (ISO) gold(0) (ISO) isoprenaline (EXP) L-methionine (EXP) melphalan (ISO) methyl methanesulfonate (ISO) morphine (EXP) N-acetyl-L-cysteine (ISO) N-ethyl-N-nitrosourea (EXP,ISO) N-methyl-N-nitrosourea (ISO) nickel atom (ISO) nicotine (EXP) paracetamol (EXP,ISO) potassium chromate (ISO) propiconazole (EXP) pyrene (ISO) rac-lactic acid (ISO) sodium arsenite (ISO) sunitinib (ISO) tamoxifen (EXP) temozolomide (ISO) testosterone (EXP) tetrachloromethane (EXP,ISO) Thiotepa (ISO) titanium dioxide (EXP) trans-1,2-dichloroethene (ISO) tributylstannane (ISO) trichostatin A (ISO) triptonide (EXP) tris(2-butoxyethyl) phosphate (ISO) troglitazone (EXP) urethane (ISO) valproic acid (EXP,ISO) vinclozolin (ISO)
1.
Functional annotation of a full-length mouse cDNA collection.
Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
2.
Comparative FISH mapping of mouse and rat homologues of twenty-five human X-linked genes.
Kuroiwa A, etal., Cytogenet Cell Genet 1998;81(3-4):208-12.
3.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
4.
MGDs mouse GO annotations
MGD data from the GO Consortium
5.
The spectrum of PIG-A gene mutations in aplastic anemia/paroxysmal nocturnal hemoglobinuria (AA/PNH): a high incidence of multiple mutations and evidence of a mutational hot spot.
Mortazavi Y, etal., Blood. 2003 Apr 1;101(7):2833-41. Epub 2002 Nov 7.
6.
Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.
Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Piga Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 163,202,814 - 163,216,912 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 163,202,783 - 163,216,912 (+) Ensembl GRCm39 Ensembl GRCm38 X 164,419,780 - 164,433,916 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 164,419,787 - 164,433,916 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 160,857,719 - 160,871,847 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 159,763,921 - 159,778,021 (+) NCBI MGSCv36 mm8 Celera X 147,635,146 - 147,649,303 (+) NCBI Celera Cytogenetic Map X F5 NCBI cM Map X 76.49 NCBI
PIGA Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 15,319,451 - 15,335,554 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 15,319,452 - 15,335,554 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 15,337,573 - 15,353,676 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 15,247,499 - 15,263,581 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 19,453,077 - 19,469,182 (-) NCBI Celera Cytogenetic Map X p22.2 NCBI HuRef X 13,096,081 - 13,112,522 (-) NCBI HuRef CHM1_1 X 15,368,527 - 15,384,630 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 14,902,337 - 14,918,440 (-) NCBI T2T-CHM13v2.0
Piga Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 33,672,832 - 33,687,747 (-) NCBI GRCr8 mRatBN7.2 X 30,043,033 - 30,055,861 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 30,042,343 - 30,055,804 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 31,082,324 - 31,095,044 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 34,512,908 - 34,525,604 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 30,706,657 - 30,719,377 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 31,786,823 - 31,799,751 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 31,786,194 - 31,799,560 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 32,160,574 - 32,173,353 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 50,797,413 - 50,812,217 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 30,389,874 - 30,399,559 (-) NCBI Celera Cytogenetic Map X q14 NCBI
Piga Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955519 2,852,555 - 2,867,600 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955519 2,852,605 - 2,865,848 (+) NCBI ChiLan1.0 ChiLan1.0
PIGA Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 17,118,790 - 17,135,672 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 17,122,457 - 17,139,351 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 7,946,158 - 7,962,320 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 15,228,881 - 15,244,949 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 15,228,881 - 15,244,949 (-) Ensembl panpan1.1 panPan2
PIGA Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 11,570,327 - 11,583,401 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 11,477,560 - 11,490,558 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 11,532,405 - 11,545,403 (-) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 X 11,595,315 - 11,608,309 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 11,586,669 - 11,599,667 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 11,614,747 - 11,627,744 (-) NCBI UU_Cfam_GSD_1.0
Piga Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 4,730,960 - 4,747,006 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936470 4,730,961 - 4,746,985 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936470 4,730,955 - 4,746,958 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PIGA Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 11,871,750 - 11,886,438 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 11,871,746 - 11,886,519 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 12,832,314 - 12,847,100 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIGA Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 13,787,658 - 13,803,575 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 13,787,646 - 13,803,405 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 15,624,328 - 15,640,151 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Piga
.
Predicted Target Of
Count of predictions: 4442 Count of miRNA genes: 818 Interacting mature miRNAs: 1141 Transcripts: ENSMUST00000033754, ENSMUST00000112255, ENSMUST00000112257, ENSMUST00000133813, ENSMUST00000151911, ENSMUST00000155849 Prediction methods: Miranda, Pita, Pita,Targetscan, Rnahybrid, Targetscan Result types: miRGate_prediction
10401118 Pgia39_m proteoglycan induced arthritis 39 (mouse) Not determined X 144474380 169476592 Mouse 1558900 Bw3_m body weight QTL 3 (mouse) Not determined X 133540040 165298595 Mouse 1302000 Pgia25_m proteoglycan induced arthritis 2 (mouse) Not determined X 144474380 169476592 Mouse 12738421 Lfibq17_m liver fibrosis QTL 17 (mouse) X 148148453 164945064 Mouse 1357619 Obsty5_m obesity 5 (mouse) Not determined X 160212893 164149284 Mouse
RH135928
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 164,426,307 - 164,426,500 UniSTS GRCm38 MGSCv37 X 160,864,239 - 160,864,432 UniSTS GRCm37 Celera X 147,641,572 - 147,641,765 UniSTS Cytogenetic Map X F3-F4 UniSTS
D26047
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 164,432,903 - 164,433,041 UniSTS GRCm38 MGSCv37 X 160,870,835 - 160,870,973 UniSTS GRCm37 Celera X 147,648,291 - 147,648,429 UniSTS Cytogenetic Map X F3-F4 UniSTS Whitehead/MRC_RH X 1990.44 UniSTS Whitehead/MRC_RH X 1990.96 UniSTS
BF387721
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 164,431,839 - 164,432,018 UniSTS GRCm38 MGSCv37 X 160,869,771 - 160,869,950 UniSTS GRCm37 Celera X 147,647,237 - 147,647,416 UniSTS Cytogenetic Map X F3-F4 UniSTS
PMC22111P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 164,422,633 - 164,423,251 UniSTS GRCm38 MGSCv37 X 160,860,565 - 160,861,183 UniSTS GRCm37 Cytogenetic Map X F3-F4 UniSTS
PMC23833P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 X 164,430,290 - 164,430,530 UniSTS GRCm38 MGSCv37 X 160,868,222 - 160,868,462 UniSTS GRCm37 Celera X 147,645,555 - 147,645,791 UniSTS Cytogenetic Map X F3-F4 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000033754 ⟹ ENSMUSP00000033754
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,783 - 163,216,912 (+) Ensembl GRCm38.p6 Ensembl X 164,419,787 - 164,433,916 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112255 ⟹ ENSMUSP00000107874
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,905 - 163,216,909 (+) Ensembl GRCm38.p6 Ensembl X 164,419,909 - 164,433,913 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000112257 ⟹ ENSMUSP00000137831
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,783 - 163,216,907 (+) Ensembl GRCm38.p6 Ensembl X 164,419,787 - 164,433,911 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000133813 ⟹ ENSMUSP00000122176
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,205,580 - 163,214,968 (+) Ensembl GRCm38.p6 Ensembl X 164,422,584 - 164,431,972 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151911 ⟹ ENSMUSP00000138077
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,783 - 163,216,912 (+) Ensembl GRCm38.p6 Ensembl X 164,419,787 - 164,433,916 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000155849
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,208,506 - 163,215,051 (+) Ensembl GRCm38.p6 Ensembl X 164,425,510 - 164,432,055 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000208261 ⟹ ENSMUSP00000146808
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,803 - 163,214,868 (+) Ensembl GRCm38.p6 Ensembl X 164,419,807 - 164,431,872 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000208697 ⟹ ENSMUSP00000146731
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,794 - 163,215,056 (+) Ensembl GRCm38.p6 Ensembl X 164,419,798 - 164,432,060 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000208741 ⟹ ENSMUSP00000147146
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl X 163,202,783 - 163,214,832 (+) Ensembl GRCm38.p6 Ensembl X 164,419,787 - 164,431,836 (+) Ensembl
RefSeq Acc Id:
NM_011081 ⟹ NP_035211
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 163,202,814 - 163,216,912 (+) NCBI GRCm38 X 164,419,780 - 164,433,915 (+) NCBI MGSCv37 X 160,857,719 - 160,871,847 (+) RGD Celera X 147,635,146 - 147,649,303 (+) RGD cM Map X ENTREZGENE
Sequence:
GGGGCGGGATTCTGTTAACTGCCGCGGGAGGTCCGGACAGTGGCGGCCATGGGACTGGAGGGTGACAGAAGACACATTTCTTAACTGGCTTGCTCTGAGAACTGATGCTTGGACCACCTCAGCATGGC
hide sequence
RefSeq Acc Id:
NR_152315
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 163,202,814 - 163,216,912 (+) NCBI GRCm38 X 164,419,780 - 164,433,915 (+) NCBI
Sequence:
GGGGCGGGATTCTGTTAACTGCCGCGGGAGGTCCGGACAGTGGCGGCCATGGGACTGGAGGGTG
hide sequence
RefSeq Acc Id:
XM_011247793 ⟹ XP_011246095
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 163,206,675 - 163,216,912 (+) NCBI GRCm38 X 164,425,280 - 164,433,916 (+) NCBI
Sequence:
ATGTGCTATGTGGCCTTTTCTTTTTAGATCTCAGAAGTAATGGCTTCTTATTGCAGGAGTTTGCAAAGCTCACCTAGCACATCTGTGACGATGTCATTCAGAGATGGCCCTAATGACTATTTTCATGC
hide sequence
RefSeq Acc Id:
XM_017318428 ⟹ XP_017173917
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 X 163,202,862 - 163,216,912 (+) NCBI GRCm38 X 164,419,868 - 164,433,916 (+) NCBI
Sequence:
TCTAACGTTCTCGGTCTCTCTGGATGGGGTTGTGCCGTTCTCACAGGACCGTGGCAGGCTGTGG
hide sequence
RefSeq Acc Id:
NP_035211 ⟸ NM_011081
- UniProtKB:
Q6LD71 (UniProtKB/Swiss-Prot), Q8CCQ6 (UniProtKB/Swiss-Prot), Q64323 (UniProtKB/Swiss-Prot), A2AIH5 (UniProtKB/TrEMBL), Q3TU17 (UniProtKB/TrEMBL)
- Sequence:
MANRRGGGQGQPPSVSPSPGSSGNLSDDRTCTHNICMVSDFFYPNMGGVESHIYQLSQCLIERGHKVITVTHAYGNRKGVRYLTNGLKVYYLPLRVMYNQSTATTLFHSLPLLRYIFVRERITIIHSH
hide sequence
RefSeq Acc Id:
XP_011246095 ⟸ XM_011247793
- Peptide Label:
isoform X2
- UniProtKB:
A0A140LI97 (UniProtKB/TrEMBL)
- Sequence:
MLPACNRQRNSLREGTDLLSGIIPELCQKYQELHFLIGGEGPKRIILEEVRERYQLHDRVQLLGALEHKDVRNVLVQGHIFLNTSLTEAFCMAIVEAASCGLQVVSTKVGGIPEVLPESLIILCEPSV
hide sequence
RefSeq Acc Id:
XP_017173917 ⟸ XM_017318428
- Peptide Label:
isoform X1
- UniProtKB:
Q6LD71 (UniProtKB/Swiss-Prot), Q8CCQ6 (UniProtKB/Swiss-Prot), Q64323 (UniProtKB/Swiss-Prot), A2AIH5 (UniProtKB/TrEMBL), Q3TU17 (UniProtKB/TrEMBL)
- Sequence:
MANRRGGGQGQPPSVSPSPGSSGNLSDDRTCTHNICMVSDFFYPNMGGVESHIYQLSQCLIERG
hide sequence
Ensembl Acc Id:
ENSMUSP00000138077 ⟸ ENSMUST00000151911
Ensembl Acc Id:
ENSMUSP00000107874 ⟸ ENSMUST00000112255
Ensembl Acc Id:
ENSMUSP00000137831 ⟸ ENSMUST00000112257
Ensembl Acc Id:
ENSMUSP00000033754 ⟸ ENSMUST00000033754
Ensembl Acc Id:
ENSMUSP00000147146 ⟸ ENSMUST00000208741
Ensembl Acc Id:
ENSMUSP00000146731 ⟸ ENSMUST00000208697
Ensembl Acc Id:
ENSMUSP00000146808 ⟸ ENSMUST00000208261
Ensembl Acc Id:
ENSMUSP00000122176 ⟸ ENSMUST00000133813
RGD ID: 6846095 Promoter ID: MM_KWN:62694 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: ENSMUST00000112255, NM_011081, OTTMUST00000046586, UC009UVN.1, UC009UVP.1 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 160,857,291 - 160,857,862 (+) MPROMDB
RGD ID: 6846091 Promoter ID: MM_KWN:62696 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Kidney Transcripts: ENSMUST00000073093 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 160,861,011 - 160,861,511 (+) MPROMDB
RGD ID: 6846092 Promoter ID: MM_KWN:62697 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, Brain, Spleen Transcripts: OTTMUST00000046589 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 X 160,863,596 - 160,864,096 (+) MPROMDB
RGD ID: 13681822 Promoter ID: EPDNEW_M25060 Type: multiple initiation site Name: Piga_1 Description: Mus musculus phosphatidylinositol glycan anchor biosynthesis,class A , transcript variant 2, non-coding RNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 X 164,419,818 - 164,419,878 EPDNEW
