Symbol:
Pik3r3
Name:
phosphoinositide-3-kinase regulatory subunit 3
RGD ID:
621042
Description:
Enables 1-phosphatidylinositol-3-kinase regulator activity. Predicted to be involved in several processes, including cell migration involved in sprouting angiogenesis; insulin receptor signaling pathway; and phosphatidylinositol 3-kinase/protein kinase B signal transduction. Predicted to be part of phosphatidylinositol 3-kinase complex, class IA. Biomarker of hepatocellular carcinoma. Human ortholog(s) of this gene implicated in colon adenocarcinoma. Orthologous to human PIK3R3 (phosphoinositide-3-kinase regulatory subunit 3); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; FasL mediated signaling pathway; phosphatidylinositol 3-kinase class I signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
p55PIK; phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3; phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55); phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma; phosphatidylinositol 3-kinase p55 subunit; phosphatidylinositol 3-kinase regulatory subunit gamma; phosphoinositide-3-kinase, regulatory subunit 3 (gamma); PI3-kinase p85 subunit gamma; PI3-kinase regulatory subunit gamma; PI3-kinase subunit p55-gamma; PI3K regulatory subunit gamma; ptdIns-3-kinase p85-gamma; ptdIns-3-kinase regulatory subunit gamma; ptdIns-3-kinase regulatory subunit p55-gamma
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 134,936,790 - 135,009,303 (+) NCBI GRCr8 mRatBN7.2 5 129,700,925 - 129,772,591 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 129,701,229 - 129,772,583 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,318,324 - 132,396,864 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,072,913 - 134,151,457 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,095,352 - 134,173,900 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,069,972 - 135,145,633 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,074,297 - 135,142,488 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 138,858,124 - 138,930,177 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,497,494 - 136,566,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 136,502,719 - 136,571,699 (+) NCBI Celera 5 128,230,224 - 128,297,191 (+) NCBI Celera Cytogenetic Map 5 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pik3r3 Rat 1,1-dichloroethene decreases expression ISO Pik3r3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PIK3R3 mRNA CTD PMID:26682919 Pik3r3 Rat 1,2-dimethylhydrazine decreases expression ISO Pik3r3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of PIK3R3 mRNA CTD PMID:22206623 Pik3r3 Rat 17beta-estradiol multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PIK3R3 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of PIK3R3 mRNA CTD PMID:19619570 and PMID:30165855 Pik3r3 Rat 17beta-estradiol increases expression ISO Pik3r3 (Mus musculus) 6480464 Estradiol results in increased expression of PIK3R3 mRNA CTD PMID:39298647 Pik3r3 Rat 17beta-estradiol multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PIK3R3 mRNA CTD PMID:26496021 Pik3r3 Rat 17beta-estradiol decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Estradiol results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat 17beta-estradiol increases expression ISO PIK3R3 (Homo sapiens) 6480464 Estradiol results in increased expression of PIK3R3 mRNA CTD PMID:19619570 Pik3r3 Rat 2,2',4,4'-Tetrabromodiphenyl ether multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Flame Retardants results in increased abundance of 2 more ... CTD PMID:38995820 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in increased expression of PIK3R3 mRNA CTD PMID:19619570 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3R3 mRNA CTD PMID:33387578 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3R3 mRNA CTD PMID:27913140 and PMID:32109520 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pik3r3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3R3 mRNA CTD PMID:19770486 more ... Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pik3r3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PIK3R3 mRNA CTD PMID:21570461 and PMID:26377647 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of PIK3R3 mRNA CTD PMID:25975270 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PIK3R3 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PIK3R3 mRNA CTD PMID:19619570 Pik3r3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pik3r3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PIK3R3 mRNA CTD PMID:20159946 Pik3r3 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Pik3r3 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Pik3r3 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of PIK3R3 mRNA CTD PMID:25172293 Pik3r3 Rat 4,4'-sulfonyldiphenol increases expression ISO PIK3R3 (Homo sapiens) 6480464 bisphenol S results in increased expression of PIK3R3 mRNA CTD PMID:27685785 Pik3r3 Rat 4-hydroxyphenyl retinamide increases expression ISO Pik3r3 (Mus musculus) 6480464 Fenretinide results in increased expression of PIK3R3 mRNA CTD PMID:28973697 Pik3r3 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PIK3R3 mRNA CTD PMID:22504374 Pik3r3 Rat 8-Br-cAMP decreases expression ISO PIK3R3 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of PIK3R3 mRNA CTD PMID:22079614 Pik3r3 Rat 9-cis-retinoic acid increases expression EXP 6480464 Alitretinoin results in increased expression of PIK3R3 mRNA CTD PMID:16648578 Pik3r3 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PIK3R3 mRNA CTD PMID:28959563 Pik3r3 Rat afimoxifene multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in decreased expression of PIK3R3 mRNA] CTD PMID:21233418 Pik3r3 Rat all-trans-retinoic acid decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Tretinoin results in decreased expression of PIK3R3 mRNA CTD PMID:23724009 Pik3r3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PIK3R3 mRNA CTD PMID:16483693 Pik3r3 Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of PIK3R3 mRNA CTD PMID:30779732 Pik3r3 Rat aristolochic acid A increases expression ISO PIK3R3 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PIK3R3 mRNA CTD PMID:33212167 Pik3r3 Rat arsane increases response to substance ISO PIK3R3 (Homo sapiens) 6480464 PIK3R3 mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Pik3r3 Rat arsane multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat arsane affects methylation ISO PIK3R3 (Homo sapiens) 6480464 Arsenic affects the methylation of PIK3R3 gene CTD PMID:25304211 Pik3r3 Rat arsenic atom increases response to substance ISO PIK3R3 (Homo sapiens) 6480464 PIK3R3 mRNA results in increased susceptibility to Arsenic CTD PMID:17976673 Pik3r3 Rat arsenic atom multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat arsenic atom affects methylation ISO PIK3R3 (Homo sapiens) 6480464 Arsenic affects the methylation of PIK3R3 gene CTD PMID:25304211 Pik3r3 Rat arsenite(3-) decreases expression ISO Pik3r3 (Mus musculus) 6480464 arsenite results in decreased expression of PIK3R3 mRNA CTD PMID:33053406 Pik3r3 Rat benzo[a]pyrene increases expression ISO Pik3r3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PIK3R3 mRNA CTD PMID:19770486 Pik3r3 Rat benzo[a]pyrene increases methylation ISO Pik3r3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of PIK3R3 intron CTD PMID:27901495 Pik3r3 Rat benzo[b]fluoranthene increases expression ISO Pik3r3 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PIK3R3 mRNA CTD PMID:26377693 Pik3r3 Rat bexarotene increases expression EXP 6480464 bexarotene results in increased expression of PIK3R3 mRNA CTD PMID:16648578 Pik3r3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Pik3r3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PIK3R3 mRNA CTD PMID:34319233 Pik3r3 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Estradiol] results in increased expression of PIK3R3 mRNA CTD PMID:26496021 Pik3r3 Rat bisphenol A multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PIK3R3 gene CTD PMID:31601247 Pik3r3 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PIK3R3 mRNA CTD PMID:25181051 and PMID:30816183 Pik3r3 Rat calcitriol increases expression ISO PIK3R3 (Homo sapiens) 6480464 Calcitriol results in increased expression of PIK3R3 mRNA CTD PMID:26485663 Pik3r3 Rat carbamazepine affects expression ISO PIK3R3 (Homo sapiens) 6480464 Carbamazepine affects the expression of PIK3R3 mRNA CTD PMID:24752500 and PMID:25979313 Pik3r3 Rat carmustine increases expression ISO PIK3R3 (Homo sapiens) 6480464 Carmustine results in increased expression of PIK3R3 mRNA CTD PMID:15980968 Pik3r3 Rat CGP 52608 multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PIK3R3 gene] CTD PMID:28238834 Pik3r3 Rat chenodeoxycholic acid multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA more ... CTD PMID:33819548 Pik3r3 Rat chlorpyrifos decreases expression ISO Pik3r3 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of PIK3R3 mRNA CTD PMID:34289071 Pik3r3 Rat choline multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIK3R3 gene CTD PMID:20938992 Pik3r3 Rat cisplatin increases expression ISO PIK3R3 (Homo sapiens) 6480464 Cisplatin results in increased expression of PIK3R3 mRNA CTD PMID:27392435 and PMID:27594783 Pik3r3 Rat clomiphene increases expression ISO PIK3R3 (Homo sapiens) 6480464 Clomiphene results in increased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of PIK3R3 mRNA CTD PMID:16715494 Pik3r3 Rat copper atom multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PIK3R3 mRNA CTD PMID:30911355 Pik3r3 Rat copper(0) multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PIK3R3 mRNA CTD PMID:30911355 Pik3r3 Rat copper(II) chloride decreases expression ISO PIK3R3 (Homo sapiens) 6480464 cupric chloride results in decreased expression of PIK3R3 mRNA CTD PMID:38568856 Pik3r3 Rat copper(II) sulfate increases expression ISO PIK3R3 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PIK3R3 mRNA CTD PMID:19549813 Pik3r3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of PIK3R3 mRNA CTD PMID:27523638 Pik3r3 Rat cyclosporin A increases expression ISO PIK3R3 (Homo sapiens) 6480464 Cyclosporine results in increased expression of PIK3R3 mRNA CTD PMID:20106945 Pik3r3 Rat DDE decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of PIK3R3 mRNA CTD PMID:38568856 Pik3r3 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of PIK3R3 mRNA CTD PMID:23914054 Pik3r3 Rat deguelin decreases expression ISO PIK3R3 (Homo sapiens) 6480464 deguelin results in decreased expression of PIK3R3 mRNA CTD PMID:33512557 Pik3r3 Rat deoxycholic acid multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA more ... CTD PMID:33819548 Pik3r3 Rat Dibutyl phosphate affects expression ISO PIK3R3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PIK3R3 mRNA CTD PMID:37042841 Pik3r3 Rat diclofenac affects expression ISO PIK3R3 (Homo sapiens) 6480464 Diclofenac affects the expression of PIK3R3 mRNA CTD PMID:24752500 Pik3r3 Rat diethylstilbestrol decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Diethylstilbestrol results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat Diosbulbin B increases expression ISO Pik3r3 (Mus musculus) 6480464 diosbulbin B results in increased expression of PIK3R3 mRNA CTD PMID:39368342 Pik3r3 Rat Doramectin decreases expression EXP 6480464 doramectin results in decreased expression of PIK3R3 mRNA CTD PMID:35137919 Pik3r3 Rat dorsomorphin multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIK3R3 mRNA CTD PMID:27188386 Pik3r3 Rat doxorubicin decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PIK3R3 mRNA CTD PMID:29803840 Pik3r3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of PIK3R3 mRNA CTD PMID:29391264 Pik3r3 Rat entinostat decreases expression ISO PIK3R3 (Homo sapiens) 6480464 entinostat results in decreased expression of PIK3R3 mRNA CTD PMID:26272509 Pik3r3 Rat entinostat multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIK3R3 mRNA CTD PMID:27188386 Pik3r3 Rat estrone decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Estrone results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PIK3R3 mRNA CTD PMID:20655511 Pik3r3 Rat ethanol multiple interactions EXP 6480464 [Ethanol results in decreased susceptibility to INS1 protein] which results in decreased expression of and results in decreased activity of PIK3R3 protein more ... CTD PMID:12700235 and PMID:20655511 Pik3r3 Rat ethyl methanesulfonate increases expression ISO PIK3R3 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of PIK3R3 mRNA CTD PMID:23649840 Pik3r3 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of PIK3R3 mRNA CTD PMID:31881178 Pik3r3 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PIK3R3 mRNA CTD PMID:18035473 Pik3r3 Rat folic acid multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIK3R3 gene CTD PMID:20938992 Pik3r3 Rat formaldehyde decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of PIK3R3 mRNA CTD PMID:20655997 Pik3r3 Rat formaldehyde increases expression ISO PIK3R3 (Homo sapiens) 6480464 Formaldehyde results in increased expression of PIK3R3 mRNA CTD PMID:23649840 Pik3r3 Rat fructose increases expression EXP 6480464 Fructose results in increased expression of PIK3R3 mRNA CTD PMID:36049592 Pik3r3 Rat fulvestrant increases expression ISO PIK3R3 (Homo sapiens) 6480464 fulvestrant results in increased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat fulvestrant multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PIK3R3 gene CTD PMID:31601247 Pik3r3 Rat furan increases expression EXP 6480464 furan results in increased expression of PIK3R3 mRNA CTD PMID:25539665 Pik3r3 Rat genistein increases expression ISO PIK3R3 (Homo sapiens) 6480464 Genistein results in increased expression of PIK3R3 mRNA CTD PMID:15378649 Pik3r3 Rat genistein decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Genistein results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat glycochenodeoxycholic acid multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA more ... CTD PMID:33819548 Pik3r3 Rat glycocholic acid multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA more ... CTD PMID:33819548 Pik3r3 Rat glycodeoxycholic acid multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA more ... CTD PMID:33819548 Pik3r3 Rat glyphosate increases expression ISO PIK3R3 (Homo sapiens) 6480464 Glyphosate results in increased expression of PIK3R3 mRNA CTD PMID:17984146 Pik3r3 Rat glyphosate decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Glyphosate results in decreased expression of PIK3R3 mRNA CTD PMID:31295307 Pik3r3 Rat GSK-J4 decreases expression ISO PIK3R3 (Homo sapiens) 6480464 GSK-J4 results in decreased expression of PIK3R3 mRNA CTD PMID:29301935 Pik3r3 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of PIK3R3 mRNA CTD PMID:16715494 Pik3r3 Rat hexestrol decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Hexestrol results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat iron dichloride decreases expression ISO PIK3R3 (Homo sapiens) 6480464 ferrous chloride results in decreased expression of PIK3R3 mRNA CTD PMID:35984750 Pik3r3 Rat L-methionine multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of PIK3R3 gene CTD PMID:20938992 Pik3r3 Rat leflunomide decreases expression ISO PIK3R3 (Homo sapiens) 6480464 leflunomide results in decreased expression of PIK3R3 mRNA CTD PMID:28988120 Pik3r3 Rat maneb multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of PIK3R3 mRNA CTD PMID:36117858 Pik3r3 Rat manganese atom multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat manganese(0) multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat manganese(II) chloride multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat melphalan decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Melphalan results in decreased expression of PIK3R3 mRNA CTD PMID:22363485 Pik3r3 Rat mestranol decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Mestranol results in decreased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PIK3R3 mRNA CTD PMID:22504374 Pik3r3 Rat methyl methanesulfonate increases expression ISO PIK3R3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of PIK3R3 mRNA CTD PMID:23649840 Pik3r3 Rat methylisothiazolinone increases expression ISO PIK3R3 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of PIK3R3 mRNA CTD PMID:31629900 Pik3r3 Rat microcystin-LR decreases expression ISO Pik3r3 (Mus musculus) 6480464 cyanoginosin LR results in decreased expression of PIK3R3 mRNA and cyanoginosin LR results in decreased expression of PIK3R3 protein CTD PMID:28414124 Pik3r3 Rat N-methyl-4-phenylpyridinium decreases expression EXP 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PIK3R3 mRNA CTD PMID:28801915 Pik3r3 Rat N-methyl-4-phenylpyridinium decreases expression ISO PIK3R3 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of PIK3R3 protein CTD PMID:34773593 Pik3r3 Rat N-methyl-4-phenylpyridinium multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 PIK3R3 protein affects the reaction [MIR134 affects the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of PCNA protein]] more ... CTD PMID:34773593 Pik3r3 Rat N-nitrosodiethylamine increases expression EXP 152177911 N-nitrosodiethylamine increases expression of PI3Kp85 protein in liver in rats RGD Pik3r3 Rat Nookatone multiple interactions EXP 6480464 nootkatone inhibits the reaction [Rotenone results in decreased phosphorylation of PIK3R3 protein] CTD PMID:35833337 Pik3r3 Rat ochratoxin A decreases expression ISO PIK3R3 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of PIK3R3 mRNA CTD PMID:30763683 Pik3r3 Rat okadaic acid increases phosphorylation ISO PIK3R3 (Homo sapiens) 6480464 Okadaic Acid results in increased phosphorylation of PIK3R3 protein CTD PMID:38832940 Pik3r3 Rat okadaic acid increases expression ISO PIK3R3 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of PIK3R3 mRNA CTD PMID:38832940 Pik3r3 Rat paracetamol increases expression ISO PIK3R3 (Homo sapiens) 6480464 Acetaminophen results in increased expression of PIK3R3 mRNA CTD PMID:29067470 Pik3r3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of PIK3R3 mRNA CTD PMID:33387578 Pik3r3 Rat paracetamol multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Acetaminophen] results in increased expression of PIK3R3 mRNA CTD PMID:33819548 Pik3r3 Rat paraquat decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Paraquat results in decreased expression of PIK3R3 mRNA and Paraquat results in decreased expression of PIK3R3 protein CTD PMID:24130211 Pik3r3 Rat paraquat multiple interactions ISO Pik3r3 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of PIK3R3 mRNA CTD PMID:36117858 Pik3r3 Rat paraquat multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 benzyloxycarbonyl-valyl-alanyl-aspartic acid analog inhibits the reaction [Paraquat results in decreased expression of PIK3R3 protein] CTD PMID:24130211 Pik3r3 Rat Phellopterin decreases phosphorylation ISO PIK3R3 (Homo sapiens) 6480464 phellopterin results in decreased phosphorylation of PIK3R3 protein CTD PMID:37708916 Pik3r3 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of PIK3R3 mRNA CTD PMID:22037397 Pik3r3 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of PIK3R3 mRNA CTD PMID:19162173 Pik3r3 Rat potassium chromate decreases expression ISO PIK3R3 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PIK3R3 mRNA CTD PMID:22714537 Pik3r3 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PIK3R3 mRNA CTD PMID:19162173 Pik3r3 Rat progesterone decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Progesterone results in decreased expression of PIK3R3 mRNA CTD PMID:21795739 Pik3r3 Rat propanal increases expression ISO PIK3R3 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PIK3R3 mRNA CTD PMID:26079696 Pik3r3 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Air Pollutants and Occupational results in increased phosphorylation of PIK3R3 protein] CTD PMID:37467934 Pik3r3 Rat quercetin increases expression ISO PIK3R3 (Homo sapiens) 6480464 Quercetin results in increased expression of PIK3R3 mRNA CTD PMID:30152185 Pik3r3 Rat raloxifene increases expression ISO PIK3R3 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased expression of PIK3R3 mRNA CTD PMID:26865669 Pik3r3 Rat resveratrol affects expression ISO PIK3R3 (Homo sapiens) 6480464 resveratrol affects the expression of PIK3R3 mRNA CTD PMID:18586690 Pik3r3 Rat rotenone increases expression ISO Pik3r3 (Mus musculus) 6480464 Rotenone results in increased expression of PIK3R3 mRNA CTD PMID:32937126 Pik3r3 Rat rotenone decreases phosphorylation EXP 6480464 Rotenone results in decreased phosphorylation of PIK3R3 protein CTD PMID:35833337 Pik3r3 Rat rotenone multiple interactions EXP 6480464 nootkatone inhibits the reaction [Rotenone results in decreased phosphorylation of PIK3R3 protein] CTD PMID:35833337 Pik3r3 Rat SB 431542 multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of PIK3R3 mRNA CTD PMID:27188386 Pik3r3 Rat silicon dioxide decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of PIK3R3 mRNA CTD PMID:25351596 Pik3r3 Rat silver atom decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Silver results in decreased expression of PIK3R3 mRNA CTD PMID:26551752 Pik3r3 Rat silver(0) decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Silver results in decreased expression of PIK3R3 mRNA CTD PMID:26551752 Pik3r3 Rat sodium arsenate increases expression ISO Pik3r3 (Mus musculus) 6480464 sodium arsenate results in increased expression of PIK3R3 mRNA CTD PMID:21795629 Pik3r3 Rat sodium arsenite decreases expression ISO PIK3R3 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PIK3R3 mRNA CTD PMID:20886546 and PMID:38568856 Pik3r3 Rat sodium arsenite multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PIK3R3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PIK3R3 mRNA CTD PMID:39836092 Pik3r3 Rat sodium chloride increases expression EXP 6480464 Sodium Chloride results in increased expression of PIK3R3 mRNA CTD PMID:37992803 Pik3r3 Rat sotorasib multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of PIK3R3 mRNA CTD PMID:36139627 Pik3r3 Rat sulforaphane decreases expression ISO PIK3R3 (Homo sapiens) 6480464 sulforaphane results in decreased expression of PIK3R3 mRNA CTD PMID:31838189 Pik3r3 Rat sunitinib decreases expression ISO PIK3R3 (Homo sapiens) 6480464 Sunitinib results in decreased expression of PIK3R3 mRNA CTD PMID:31533062 Pik3r3 Rat T-2 toxin increases expression ISO PIK3R3 (Homo sapiens) 6480464 T-2 Toxin results in increased expression of PIK3R3 mRNA CTD PMID:34581912 Pik3r3 Rat tartrazine multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Tartrazine] results in increased expression of PIK3R3 mRNA CTD PMID:33819548 Pik3r3 Rat tert-butyl hydroperoxide decreases expression ISO PIK3R3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of PIK3R3 mRNA CTD PMID:15336504 Pik3r3 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PIK3R3 mRNA CTD PMID:23411599 and PMID:34492290 Pik3r3 Rat titanium dioxide decreases methylation ISO Pik3r3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PIK3R3 promoter CTD PMID:35295148 Pik3r3 Rat trametinib multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in increased expression of PIK3R3 mRNA CTD PMID:36139627 Pik3r3 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PIK3R3 mRNA CTD PMID:33387578 Pik3r3 Rat triclosan multiple interactions ISO PIK3R3 (Homo sapiens) 6480464 [Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid co-treated with Triclosan] results in increased expression of PIK3R3 mRNA CTD PMID:33819548 Pik3r3 Rat triphenyl phosphate affects expression ISO PIK3R3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PIK3R3 mRNA CTD PMID:37042841 Pik3r3 Rat Triptolide increases expression ISO Pik3r3 (Mus musculus) 6480464 triptolide results in increased expression of PIK3R3 mRNA CTD PMID:32835833 Pik3r3 Rat triptonide increases expression ISO Pik3r3 (Mus musculus) 6480464 triptonide results in increased expression of PIK3R3 mRNA CTD PMID:33045310 Pik3r3 Rat urethane increases expression ISO PIK3R3 (Homo sapiens) 6480464 Urethane results in increased expression of PIK3R3 mRNA CTD PMID:28818685 Pik3r3 Rat valproic acid affects expression ISO Pik3r3 (Mus musculus) 6480464 Valproic Acid affects the expression of PIK3R3 mRNA CTD PMID:17963808 Pik3r3 Rat valproic acid affects expression ISO PIK3R3 (Homo sapiens) 6480464 Valproic Acid affects the expression of PIK3R3 mRNA CTD PMID:25979313 Pik3r3 Rat valproic acid increases expression ISO PIK3R3 (Homo sapiens) 6480464 Valproic Acid results in increased expression of PIK3R3 mRNA CTD PMID:23179753 Pik3r3 Rat valproic acid decreases methylation ISO PIK3R3 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of PIK3R3 gene CTD PMID:29154799 Pik3r3 Rat vanadium atom increases expression ISO PIK3R3 (Homo sapiens) 6480464 Vanadium results in increased expression of PIK3R3 mRNA CTD PMID:19000753 Pik3r3 Rat vanadium(0) increases expression ISO PIK3R3 (Homo sapiens) 6480464 Vanadium results in increased expression of PIK3R3 mRNA CTD PMID:19000753 Pik3r3 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PIK3R3 mRNA CTD PMID:23555832 Pik3r3 Rat zinc atom increases expression ISO PIK3R3 (Homo sapiens) 6480464 Zinc results in increased expression of PIK3R3 mRNA CTD PMID:19071009 Pik3r3 Rat zinc(0) increases expression ISO PIK3R3 (Homo sapiens) 6480464 Zinc results in increased expression of PIK3R3 mRNA CTD PMID:19071009
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) 9-cis-retinoic acid (EXP) acrylamide (EXP) afimoxifene (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) calcitriol (ISO) carbamazepine (ISO) carmustine (ISO) CGP 52608 (ISO) chenodeoxycholic acid (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) clomiphene (ISO) clozapine (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) Cuprizon (EXP) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (EXP) deguelin (ISO) deoxycholic acid (ISO) Dibutyl phosphate (ISO) diclofenac (ISO) diethylstilbestrol (ISO) Diosbulbin B (ISO) Doramectin (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) entinostat (ISO) estrone (ISO) ethanol (EXP) ethyl methanesulfonate (ISO) fipronil (EXP) flavonoids (EXP) folic acid (ISO) formaldehyde (ISO) fructose (EXP) fulvestrant (ISO) furan (EXP) genistein (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (ISO) GSK-J4 (ISO) haloperidol (EXP) hexestrol (ISO) iron dichloride (ISO) L-methionine (ISO) leflunomide (ISO) maneb (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) melphalan (ISO) mestranol (ISO) methimazole (EXP) methyl methanesulfonate (ISO) methylisothiazolinone (ISO) microcystin-LR (ISO) N-methyl-4-phenylpyridinium (EXP,ISO) N-nitrosodiethylamine (EXP) Nookatone (EXP) ochratoxin A (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) paraquat (ISO) Phellopterin (ISO) phenobarbital (EXP) pirinixic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propanal (ISO) quercetin (EXP,ISO) raloxifene (ISO) resveratrol (ISO) rotenone (EXP,ISO) SB 431542 (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium chloride (EXP) sotorasib (ISO) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (ISO) tartrazine (ISO) tert-butyl hydroperoxide (ISO) thioacetamide (EXP) titanium dioxide (ISO) trametinib (ISO) trichloroethene (EXP) triclosan (ISO) triphenyl phosphate (ISO) Triptolide (ISO) triptonide (ISO) urethane (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vinclozolin (EXP) zinc atom (ISO) zinc(0) (ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Phosphoinositide 3-kinases as a common platform for multi-hormone signaling.
Hirsch E, etal., J Endocrinol. 2007 Aug;194(2):243-56.
4.
A novel 55-kDa regulatory subunit for phosphatidylinositol 3-kinase structurally similar to p55PIK Is generated by alternative splicing of the p85alpha gene.
Inukai K, etal., J Biol Chem 1996 Mar 8;271(10):5317-20.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
Analysis of expression profile of gene encoding proteins of signal cascades activated by insulin-like growth factors in colorectal cancer.
Nowakowska-Zajdel E, etal., Int J Immunopathol Pharmacol. 2011 Jul-Sep;24(3):781-7.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
PIK3R3 induces epithelial-to-mesenchymal transition and promotes metastasis in colorectal cancer.
Wang G, etal., Mol Cancer Ther. 2014 Jul;13(7):1837-47. doi: 10.1158/1535-7163.MCT-14-0049. Epub 2014 May 16.
14.
Altered p53 regulation of miR-148b and p55PIK contributes to tumor progression in colorectal cancer.
Wang G, etal., Oncogene. 2015 Feb 12;34(7):912-21. doi: 10.1038/onc.2014.30. Epub 2014 Mar 17.
15.
Garlic Oil Suppressed Nitrosodiethylamine-Induced Hepatocarcinoma in Rats by Inhibiting PI3K-AKT-NF-κB Pathway.
Zhang CL, etal., Int J Biol Sci. 2015 Apr 25;11(6):643-51. doi: 10.7150/ijbs.10785. eCollection 2015.
16.
MicroRNA-365 inhibits proliferation, migration and invasion of glioma by targeting PIK3R3.
Zhu Y, etal., Oncol Rep. 2017 Apr;37(4):2185-2192. doi: 10.3892/or.2017.5458. Epub 2017 Feb 16.
Pik3r3 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 134,936,790 - 135,009,303 (+) NCBI GRCr8 mRatBN7.2 5 129,700,925 - 129,772,591 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 129,701,229 - 129,772,583 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 132,318,324 - 132,396,864 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 134,072,913 - 134,151,457 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 134,095,352 - 134,173,900 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 135,069,972 - 135,145,633 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 135,074,297 - 135,142,488 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 138,858,124 - 138,930,177 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 136,497,494 - 136,566,473 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 136,502,719 - 136,571,699 (+) NCBI Celera 5 128,230,224 - 128,297,191 (+) NCBI Celera Cytogenetic Map 5 q35 NCBI
PIK3R3 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 46,040,140 - 46,174,901 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 46,040,140 - 46,133,036 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 46,505,812 - 46,640,573 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 46,278,399 - 46,370,901 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 46,217,832 - 46,310,334 NCBI Celera 1 44,793,099 - 44,886,009 (-) NCBI Celera Cytogenetic Map 1 p34.1 NCBI HuRef 1 44,620,825 - 44,713,687 (-) NCBI HuRef CHM1_1 1 46,622,976 - 46,715,844 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 45,917,331 - 46,052,095 (-) NCBI T2T-CHM13v2.0
Pik3r3 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 116,078,593 - 116,160,253 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 116,030,581 - 116,157,038 (+) Ensembl GRCm39 Ensembl GRCm39 Ensembl 4 116,078,815 - 116,160,253 (+) Ensembl GRCm39 Ensembl GRCm38 4 116,221,400 - 116,303,056 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,173,384 - 116,299,841 (+) Ensembl GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 116,221,618 - 116,303,056 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 115,894,519 - 115,975,661 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 115,719,846 - 115,800,988 (+) NCBI MGSCv36 mm8 Celera 4 114,959,917 - 115,043,525 (+) NCBI Celera Cytogenetic Map 4 D1 NCBI cM Map 4 53.1 NCBI
PIK3R3 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 180,672,682 - 180,765,512 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 179,814,236 - 179,907,088 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 45,345,946 - 45,481,031 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 46,700,153 - 46,835,812 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 46,700,153 - 46,792,920 (-) Ensembl panpan1.1 panPan2
LOC100856339 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 14,222,059 - 14,357,200 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 14,235,824 - 14,353,832 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 14,339,320 - 14,478,832 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 14,369,954 - 14,509,881 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 14,387,484 - 14,509,849 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 14,170,772 - 14,310,183 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 14,239,288 - 14,378,669 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 14,308,726 - 14,448,356 (+) NCBI UU_Cfam_GSD_1.0
Pik3r3 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 61,270,346 - 61,346,909 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 27,095,100 - 27,171,252 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 27,095,125 - 27,171,416 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
LOC100511937 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 165,268,568 - 165,402,649 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 165,268,260 - 165,402,668 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 152,797,396 - 152,914,712 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PIK3R3 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 86,651,692 - 86,748,670 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 86,651,520 - 86,745,116 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 30,235,811 - 30,332,860 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
.
Predicted Target Of
Count of predictions: 159 Count of miRNA genes: 128 Interacting mature miRNAs: 135 Transcripts: ENSRNOT00000000157 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 7411582 Foco3 Food consumption QTL 3 7.5 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 7411564 Bw135 Body weight QTL 135 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 87468046 132468046 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1581505 Rf54 Renal function QTL 54 kidney physiology trait (VT:0002136) kidney 20-HETE level (CMO:0001854) 5 128033842 133011550 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 7411601 Foco12 Food consumption QTL 12 19.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 5 87468046 132468046 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 7394710 Emca12 Estrogen-induced mammary cancer QTL 12 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 124160767 133749643 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 6903316 Bw113 Body weight QTL 113 2 0.0103 body mass (VT:0001259) body weight (CMO:0000012) 5 87765973 132765973 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Rat201
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 129,712,378 - 129,712,586 (+) MAPPER mRatBN7.2 Rnor_6.0 5 135,085,475 - 135,085,682 NCBI Rnor6.0 Rnor_5.0 5 138,869,546 - 138,869,753 UniSTS Rnor5.0 RGSC_v3.4 5 136,507,976 - 136,508,184 RGD RGSC3.4 RGSC_v3.4 5 136,507,977 - 136,508,184 UniSTS RGSC3.4 RGSC_v3.1 5 136,513,195 - 136,513,538 RGD Celera 5 128,240,707 - 128,240,922 UniSTS SHRSP x BN Map 5 68.3499 RGD SHRSP x BN Map 5 68.3499 UniSTS Cytogenetic Map 5 q36 UniSTS
RH144265
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 129,700,290 - 129,700,414 (+) MAPPER mRatBN7.2 Rnor_6.0 5 135,073,388 - 135,073,511 NCBI Rnor6.0 Rnor_5.0 5 138,857,423 - 138,857,546 UniSTS Rnor5.0 RGSC_v3.4 5 136,495,889 - 136,496,012 UniSTS RGSC3.4 Celera 5 128,228,619 - 128,228,742 UniSTS RH 3.4 Map 5 837.8 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000157 ⟹ ENSRNOP00000000157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 129,701,229 - 129,772,583 (+) Ensembl Rnor_6.0 Ensembl 5 135,074,297 - 135,142,488 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000096934 ⟹ ENSRNOP00000088375
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 129,701,229 - 129,772,583 (+) Ensembl
RefSeq Acc Id:
NM_022213 ⟹ NP_071549
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 134,938,606 - 135,009,303 (+) NCBI mRatBN7.2 5 129,701,892 - 129,772,591 (+) NCBI Rnor_6.0 5 135,074,993 - 135,142,291 (+) NCBI Rnor_5.0 5 138,858,124 - 138,930,177 (+) NCBI RGSC_v3.4 5 136,497,494 - 136,566,473 (+) RGD Celera 5 128,230,224 - 128,297,191 (+) RGD
Sequence:
ATGTACAATACGGTGTGGAGTATGGACCGCGATGACGCAGACTGGAGGGAGGTGATGATGCCCTATTCGACAGAACTGATATTTTATATTGAAATGGATCCTCCAGCTCTTCCACCAAAGCCACCTAA GCCAGTGACGTCAGCAGTTACAAACGGAATGAAGGACTGTTTCGTTTCTCTTCAAGATGCAGAGTGGTACTGGGGAGACATTTCCAGGGAAGAGGTAAATGACAAATTGCGGGACATGCCAGACGGTA CTTTCTTAGTTCGAGATGCCTCAACAAAAATGCAGGGAGACTATACACTGACTTTGAGGAAGGGAGGAAATAATAAATTAATAAAGATCTATCATCGGGATGGTAATTATGGCTTTTCTGAGCCCCTG ACGTTTAATTCTGTGGTGGAGCTCATTAACCACTATCACCATGAATCTCTCGCTCAGTACAATCCCAAACTTGATGTGAAGCTGATGTACCCAGTGTCCAGATACCAACAGGATCAGTTGGTAAAAGA AGATAACATTGATGCGGTAGGTAAAAACCTGCAAGAATTCCACTCTCAGTACCAGGAGAAGAGTAAAGAGTACGATAGGCTGTATGAAGAGTACACCAGGACGTCACAGGAAATACAAATGAAGAGAA CTGCCATTGAAGCCTTTAATGAAACGATTAAAATATTTGAGGAGCAGTGTCATACCCAAGAACAACACAGTAAAGACTATATTGAGCGGTTTCGCAGAGAGGGGAATGAGAAGGAGATTGAGCGGATT ATGATGAATTACGATAAATTGAAATCCCGTCTGGGTGAGATTCACGATAGCAAAGTGCGTCTTGAGCAGGACTTGAAGAAACAAGCTTTGGACAACCGGGAAATAGATAAAAAAATGAATAGCATCAA GCCTGACCTGATCCAGCTGCGTAAGATCCGAGACCAGCACCTCGTATGGCTCAATCACAGGGGAGTGAGGCAGAGGCGCCTGAACGCCTGGCTGGGGATCAAGAGTGAGGACACAGATGAGAGCTATT TTATCAATGAGGACGATGAGAGCCTCCCGCATTATGATGAGAAGACCTGGTTTGTGGAGGATGTGAACCGAGTACAGGCAGAGGACCTGCTTTATGGGAAGCCAGACGGTGCATTCTTAATTCGTGAG AGTAGCAAGAAAGGATGTTACGCTTGTTCTGTGGTTGCAGACGGGGAGGTGAAGCCCTGTGTCATCTACAGCCCTGCTCGAGGATATGGCTTTGCAGAACCCTACAACCTGTACGGCTCGCTGAAGGA GCTGGTGCTCCACTACCAGCAGACATCCCTGGTCCAGCACAACGACTCCCTCAACGTCACGCTCGCCTACCCTGTCCACGCACAGATGCCCTCGCTCTGCAGATAA
hide sequence
RefSeq Acc Id:
XM_006238714 ⟹ XP_006238776
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 134,937,723 - 135,009,303 (+) NCBI mRatBN7.2 5 129,701,061 - 129,772,591 (+) NCBI Rnor_6.0 5 135,074,158 - 135,145,633 (+) NCBI Rnor_5.0 5 138,858,124 - 138,930,177 (+) NCBI
Sequence:
ACCATCTTTACACGTTAAGCGCGATGTACAATACGGTGTGGAGTATGGACCGCGATGACGCAGACTGGAGGGAGGTGATGATGCCCTATTCGACAGAACTGATATTTTATATTGAAATGGATCCTCCA GCTCTTCCACCAAAGCCACCTAAGCCAGTGACGTCAGCAGTTACAAACGGAATGAAGGACTGTTTCGTTTCTCTTCAAGATGCAGAGTGGTACTGGGGAGACATTTCCAGGGAAGAGGTAAATGACAA ATTGCGGGACATGCCAGACGGTACTTTCTTAGTTCGAGATGCCTCAACAAAAATGCAGGGAGACTATACACTGACTTTGAGGAAGGGAGGAAATAATAAATTAATAAAGATCTATCATCGGGATGGTA AATATGGCTTTTCTGAGCCCCTGACGTTTAATTCTGTGGTGGAGCTCATTAACCACTATCACCATGAATCTCTCGCTCAGTACAATCCCAAACTTGATGTGAAGCTGATGTACCCAGTGTCCAGATAC CAACAGGATCAGTTGGTAAAAGAAGATAACATTGATGCGGTAGGTAAAAACCTGCAAGAATTCCACTCTCAGTACCAGGAGAAGAGTAAAGAGTACGATAGGCTGTATGAAGAGTACACCAGGACGTC ACAGGAAATACAAATGAAGAGAACTGCCATTGAAGCCTTTAATGAAACGATTAAAATATTTGAGGAGCAGTGTCATACCCAAGAACAACACAGTAAAGACTATATTGAGCGGTTTCGCAGAGAGGGGA ATGAGAAGGAGATTGAGCGGATTATGATGAATTACGATAAATTGAAATCCCGTCTGGGTGAGATTCACGATAGCAAAGTGCGTCTTGAGCAGGACTTGAAGAAACAAGCTTTGGACAACCGGGAAATA GATAAAAAAATGAATAGCATCAAGCCTGACCTGATCCAGCTGCGTAAGATCCGAGACCAGCACCTCGTATGGCTCAATCACAGGGGAGTGAGGCAGAGGCGCCTGAACGCCTGGCTGGGGATCAAGAG TGAGGACACAGATGGAGGCTATTTTATCAATGAGGACGATGAGAGCCTGCCGCATTATGATGAGAAGACCTGGTTTGTGGAGGATGTGAACCGAGTACAGGCAGAGGACCTGCTTTATGGGAAGCCAG ACGGTGCATTCTTAATTCGTGAGAGTAGCAAGAAAGGATGTTACGCTTGTTCTGTGGTTGCAGACGGGGAGGTGAAGCACTGTGTCATCTACAGCACTGCTCGAGGATATGGCTTTGCAGAACCCTAC AACCTGTACGGCTCGCTGAAGGAGCTGGTGCTCCACTACCAGCAGACATCCCTGGTCCAGCACAACGACTCCCTCAACGTCACGCTCGCCTACCCTGTCCACGCACAGATGCCCTCTCTCTGCAGATA AGCAGAGTGGAAGAGACATGCTCTCCAGCAGTTCTTTCCTATGGTTTTTATTAGACTACGATGAGGGCACTCTTTCGACGTAGACTGCCTGTTTTGCACAAGTGATTCTGTGAATGTGAAGTGGAGAG GCCAAGCAGTAGCTTGGATTTGGGGAGAAATGAGGCCCGGGTCTCTGGCCTCGGCGTGCTGCTGCACTGATGGACTAAGCTGGAAGCAGTTATTGGTTTCATGGGGTTCGGTTTTGTTGTCAGGCACC TTTGAAAGAAGTTAGACTTGTGGGTCGGCGTGGGGTTTATGTGGAAGCCTCTGAAGAGTCCGTGTCTCCTTGTCCTCAACTTGGAGAACGCAGCAGATTGTAGTTCTGCTGGCAGTTGTTTCGCTTCC ACAGTCTCTCCCCTTCCCCCGAATAAGGAGCCGATTTGGCTCTGTGGTAAAATGGGATTTGGTTTGGGAGGGAAAACAACCAAAGGAAAATAGGGAGGTGTGGGATTACATTTACAGAATCTAAACCA AGGAGGCAAAAGACCCCTTCAGTTGATGTTACTTCAATTTCACCAACGTAATTTAGGCTTCAGCATCTTAACCAGCTCCTCCCTCTAAAGCACTGTGTTTATAAGCCAACAAGGCAGCACTGCAGACC AAGGCTATGGGAGGACAGTAGTAGCTGAATGGACACTGTACCAAAACTTGAAAGAAACTAGAAATGTGAGTTTGAACAAACACTACAATTGGTCAGTGTGTTTCCCTCTGCCCTGGCCTCCTCTCTCA GATGAGGAATAGAATATTTTGTGGAGATAGTAAGCTGTGAGTCATGAAAAGTTGGTGCTCGTGTGGTGTTTCTTTAGACTAAAGATGTTTGAAACCCTCGTAAGTTGTTTTATGAGTCAAGAAAAGGT GCAATCCAGTGCTTTTAGATGGCTTGATATACCAAATAATGATCGAGAACAGCATTGTTGCGTGCGTCCTCAAGTTTAAAGCCTTGCCAAACTATTCAAGGGTTAATTTGCCTTCATTTCCCTTCCTT CTCTGGATAGGGTTTAGGGAGCTATAGTTAGCTAAAGGAGGACTCACGTTTGTGGTCAGAGACCTCAGTAAATCACATGGGCCCGTCACATTACATGTTATTCCATACTGTGGGTGAAGCTTTTGCCA GAAGAAGGGATCGCTTAGCGTGGAGTTCAGACTATCTGGGAAAATAATCCACAAGCTTTCCTATTTGCCCTTTTTGTGAGCCTGCGGTTAAGGCAGTGTGCATAGCCTGCCCAGCCTGCCCTCAGGCT TCCATGGCTGGGATTTTAGGCCATGAGTCTGCTCCATGTGGTTTAAGCCTTCCAGCTAAGTGAAGTTAGACAGAGGAGAGGGCAGGCATCTGTTTCTGGCTTCATAGTCATTTAAGAGTCCAGCTGCG CCAGAGTCAATCCTGGAGCCATAACAGGCTCAGTATGACTCAGTTGCTTGAGCCCAGAGATTTGCAGTCAGGCACTCTAGATATGCAGCCTGTACCTGGGTCTTGGCTCATAAGGCTTACAATCAGGG AAGTTGGAGTTTGGGGGCCAAAATAAAGACGAATATGACTTTCCCTGAGCACTTCCTTTGGTGACAGTGTCTAGAATGAACAACCGTATAGAGATAGGTCAAAAGCTTTGGGTAATGGTTGTCACAGG TGAGGGTAGGGTATGCTATTGCTTTTCTTGTTCATGCTCCAGTATGAAATGAGAGGAAATCGGGGGTTGGGGATTTAGCTCAGTGGTAGAGCGCTTGCCTAGGAAGCGCAAGGCCCTGGGTTCGGTCC CCAGCTCCGGAAAAAAAAAAAAAAAGAAAAAAAAAAAAAAAGAAATGAGAGGAAATCGACCACCCTCAGCTGCTGTTTAAGGCCCAGTATTTTTCAAAATAGCCAGCTTGAAATCTTGCTCAGTTTAC CAAGTAATGCCAGGCTACTTGTTGATTGGTATACCTATGTGGCGCTGTACTGACGTTGGACTTGCTGAAGCGGTTATATGCTCAAAATTAGGTGGGAGGAATCCCTCTGGTCCAGCACTAAAATTTTA GTATGTCCTGATGCTGTTTTTTTTTTTTTTTAAATCTCTTCCAAGTAAGTCAGAATGGAAGAATACACAGCTTTAGTGTTGAACAATGTCCTTACTTTGCAGGCAGACGTGGAAGACGTTCAGGAGAA AGCATCTTAGCTCCATACCCAGACTGGACTGTGGAGAACGGCTGTTTTTCAGTCCTACATTCCTTTCCTTTGAACGCTTTTTGAGATCTGAGACTAGGGATCATTTAATTAATTGGAAGCTATCCTTT TCTGACAAGTTGCTTCATGATTTATCTGACCCTGAGCTGTGGAAGTGGCATAAAGACCAGTTTCCTAACCGTGGCCTTGGTGTCTGAGGGAGCCATCATGGCTCGGAAGCACATCTTGGTCTTCTTCC CAGAGCTCAAAGTTTTGTCCCATGATCCAGGTCCTGGGACTGTCTCCTTTGGCATCCTAGCTGTAGTCTCACTGACTAAAGCAGAGGGTAGAGACAGAGCAAACCGTAGGGCACGCCAGCCAGCTCCC CAGCAGGGAAGCAGCTTGGGCTTGGTGAGATACATTTTTTTTTTTTAAAAAATAAAAACAAAACAAGGCTGTTTGCACCCGACACAGTTCAAGCATAGGTAGGTATTTACGTTCTCATTGCTGCTCCA GGATAGAAGACATCCTGTAGCTCCACTCCTAAGACATACAATCTCCACATTCACTTGAGACTCCTTAAGCCAGTGTGGGGTCTCCCTTGTGTGCCTTCTCTGCAAGGTACCAGCTCCACCCATTCTCT TCAACTTAAAAAGAAATGTATCTGAGCAGGCTCTGATTTCTAGGATGATCTCTACTGCCAGGTAGATCTTTGTGAGGTTTCCATGGCATCATAGACCGGGGGTCCATTCTTGGTCCTTTGCTGCCAAC TGCTCACTCTTGACTTAGCTCTAGCCATTTGTGACAACCACCCTTGTTTCCTTACAAATCCTCGCATGTAACCTTGGTACTCCTGTTGTTTCTTGTGAAGAATCTATTCTGTTGTCTTTGATGTAATA AAAAAAATCCATGTAGTTTATGTAAAAATAACTGACTCAGAAGGAAGCCAACTGTGTCTTGTGTTGGAACAATTCATAATGTAATTTCTAGACCACTTTTGCAAATTGTTCTTGTCACCAAATGTGTT CAGACATTGCTGTGCAGTTGTGGGGAAGGGGTGGGGGGGGGAAGGTAAGATGAGAAGATTGTTGGGCTTTTTTTTTAAACCTTCTCCAAATGTGGAATGGTCTGGCCAACTTGCTCCGGATGCAATAA AGACAATGCAGTGAA
hide sequence
RefSeq Acc Id:
XM_039110698 ⟹ XP_038966626
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 134,937,799 - 135,009,303 (+) NCBI mRatBN7.2 5 129,701,199 - 129,772,591 (+) NCBI
RefSeq Acc Id:
XM_039110699 ⟹ XP_038966627
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 134,936,790 - 135,009,303 (+) NCBI mRatBN7.2 5 129,700,925 - 129,772,591 (+) NCBI
RefSeq Acc Id:
NP_071549 ⟸ NM_022213
- UniProtKB:
Q63789 (UniProtKB/Swiss-Prot), G3V605 (UniProtKB/TrEMBL), A6JZ71 (UniProtKB/TrEMBL)
- Sequence:
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPVTSAVTNGMKDCFVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGNYGFSEPL TFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDYIERFRREGNEKEIERI MMNYDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKSEDTDESYFINEDDESLPHYDEKTWFVEDVNRVQAEDLLYGKPDGAFLIRE SSKKGCYACSVVADGEVKPCVIYSPARGYGFAEPYNLYGSLKELVLHYQQTSLVQHNDSLNVTLAYPVHAQMPSLCR
hide sequence
RefSeq Acc Id:
XP_006238776 ⟸ XM_006238714
- Peptide Label:
isoform X1
- Sequence:
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPVTSAVTNGMKDCFVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSEPL TFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKNLQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDYIERFRREGNEKEIERI MMNYDKLKSRLGEIHDSKVRLEQDLKKQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKSEDTDGGYFINEDDESLPHYDEKTWFVEDVNRVQAEDLLYGKPDGAFLIRE SSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYNLYGSLKELVLHYQQTSLVQHNDSLNVTLAYPVHAQMPSLCR
hide sequence
Ensembl Acc Id:
ENSRNOP00000000157 ⟸ ENSRNOT00000000157
RefSeq Acc Id:
XP_038966627 ⟸ XM_039110699
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_038966626 ⟸ XM_039110698
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000088375 ⟸ ENSRNOT00000096934
RGD ID: 13693933
Promoter ID: EPDNEW_R4458
Type: multiple initiation site
Name: Pik3r3_1
Description: phosphoinositide-3-kinase regulatory subunit 3
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 135,074,325 - 135,074,385 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-30
Pik3r3
phosphoinositide-3-kinase regulatory subunit 3
Pik3r3
phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-09-09
Pik3r3
phosphoinositide-3-kinase, regulatory subunit 3 (gamma)
Pik3r3
phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55)
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2008-02-22
Pik3r3
phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55)
Pik3r3
phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2005-01-20
Pik3r3
phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3
phosphatidylinositol 3-kinase p55 subunit
Name updated
1299863
APPROVED
2002-08-07
Pik3r3
phosphatidylinositol 3-kinase p55 subunit
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
ubiquitously expressed; enriched in brain
68289