Symbol:
Ins2
Name:
insulin 2
RGD ID:
2916
Description:
Predicted to enable several functions, including identical protein binding activity; signaling receptor binding activity; and zinc ion binding activity. Predicted to be involved in several processes, including positive regulation of signal transduction; regulation of primary metabolic process; and regulation of protein localization. Predicted to act upstream of with a positive effect on receptor internalization. Predicted to act upstream of or within several processes, including intracellular signal transduction; positive regulation of intracellular signal transduction; and positive regulation of phosphorylation. Located in extracellular space and secretory granule. Used to study hypertension. Biomarker of Alzheimer's disease. Human ortholog(s) of this gene implicated in diabetic retinopathy; glucose metabolism disease (multiple); insulinoma; and pancreatic cancer. Orthologous to human INS (insulin); PARTICIPATES IN altered insulin signaling pathway; forkhead class A signaling pathway; gliclazide pharmacodynamics pathway; INTERACTS WITH (S)-nicotine; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
C-peptide; CP-II; insulin-2; LOC102549619; uncharacterized LOC102549619
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
INS (insulin) RGD
RGD
Mus musculus (house mouse):
Ins2 (insulin II) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ins (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
INS (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
INS (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ins (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
INS (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
INS (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ins (insulin) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
INS-IGF2 (INS-IGF2 readthrough) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Ins2 (insulin II)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
INS (insulin)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
insb (preproinsulin b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Danio rerio (zebrafish):
ins (preproinsulin)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
ins
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Candidate Gene For:
Hcar4 Iddm25
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 207,272,738 - 207,421,998 (-) NCBI GRCr8 mRatBN7.2 1 197,843,277 - 197,992,522 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 197,843,281 - 197,864,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 206,216,147 - 206,217,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 213,302,063 - 213,303,130 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 205,976,222 - 205,977,289 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 215,856,967 - 215,858,034 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 215,856,971 - 215,858,034 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 222,751,786 - 222,756,821 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 202,935,548 - 202,936,379 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 203,123,613 - 203,124,445 (-) NCBI Celera 1 195,461,309 - 195,462,376 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ins2 Rat (R)-adrenaline multiple interactions ISO INS (Homo sapiens) 6480464 [Epinephrine co-treated with INS protein] results in increased phosphorylation of AKT1 protein more ... CTD PMID:1218171 more ... Ins2 Rat (R)-adrenaline decreases expression ISO INS (Homo sapiens) 6480464 Epinephrine results in decreased expression of INS protein CTD PMID:6018752 and PMID:6314140 Ins2 Rat (R)-lipoic acid multiple interactions ISO INS (Homo sapiens) 6480464 Thioctic Acid inhibits the reaction [Glucose results in increased expression of INS protein] CTD PMID:16505238 Ins2 Rat (S)-nicotine increases expression EXP 6480464 Nicotine results in increased expression of INS2 mRNA CTD PMID:20426880 Ins2 Rat 1-Oleoyl-2-acetyl-sn-glycerol affects response to substance ISO INS (Homo sapiens) 6480464 INS protein affects the susceptibility to 1-oleoyl-2-acetylglycerol CTD PMID:22031853 Ins2 Rat 15-deoxy-Delta(12,14)-prostaglandin J2 multiple interactions ISO INS (Homo sapiens) 6480464 15-deoxy-delta(12 more ... CTD PMID:14625208 Ins2 Rat 17alpha-hydroxyprogesterone multiple interactions ISO INS (Homo sapiens) 6480464 17-alpha-Hydroxyprogesterone inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and [17-alpha-Hydroxyprogesterone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein CTD PMID:29782964 Ins2 Rat 17beta-estradiol multiple interactions ISO INS (Homo sapiens) 6480464 Estradiol promotes the reaction [INS protein results in decreased oxidation of Palmitates] and Estradiol promotes the reaction [INS protein results in increased chemical synthesis of Glycogen] CTD PMID:21632903 Ins2 Rat 17beta-estradiol increases expression ISO Ins2 (Mus musculus) 6480464 Estradiol results in increased expression of INS2 protein CTD PMID:18446233 Ins2 Rat 17beta-estradiol multiple interactions ISO Ins2 (Mus musculus) 6480464 ESR1 protein affects the reaction [Estradiol results in increased expression of INS2 protein] more ... CTD PMID:18446233 Ins2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of INS2 mRNA CTD PMID:18446233 Ins2 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression EXP 6480464 2 more ... CTD PMID:27291303 Ins2 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:23829299 Ins2 Rat 2,2,2-tetramine multiple interactions ISO INS (Homo sapiens) 6480464 Trientine inhibits the reaction [[Copper co-treated with Ascorbic Acid] results in increased oxidation of and affects the folding of INS protein] CTD PMID:23403016 Ins2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO INS (Homo sapiens) 6480464 Exenatide inhibits the reaction [Tetrachlorodibenzodioxin inhibits the reaction [Glucose results in increased secretion of INS protein alternative form]] and Tetrachlorodibenzodioxin inhibits the reaction [Glucose results in increased secretion of INS protein alternative form] CTD PMID:31776611 Ins2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether multiple interactions ISO Ins2 (Mus musculus) 6480464 2 more ... CTD PMID:30903904 Ins2 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of INS2 mRNA CTD PMID:21346803 Ins2 Rat 2-amino-2-deoxy-D-glucopyranose multiple interactions ISO INS (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Glucosamine inhibits the reaction [INS results in increased uptake of Deoxyglucose]] more ... CTD PMID:20165829 and PMID:33812996 Ins2 Rat 2-arachidonoylglycerol multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [glyceryl 2-arachidonate promotes the reaction [CREB3L3 protein binds to CYP27A1 promoter]] more ... CTD PMID:23894352 Ins2 Rat 2-deoxy-D-glucose multiple interactions ISO INS (Homo sapiens) 6480464 3 more ... CTD PMID:16483873 more ... Ins2 Rat 2-deoxy-D-glucose multiple interactions ISO Ins2 (Mus musculus) 6480464 METRNL protein inhibits the reaction [INS protein results in increased uptake of Deoxyglucose] and PPARA protein promotes the reaction [GW 7647 promotes the reaction [INS protein results in increased uptake of Deoxyglucose]] CTD PMID:21324916 and PMID:30213948 Ins2 Rat 2-deoxy-D-glucose increases uptake ISO INS (Homo sapiens) 6480464 INS protein results in increased uptake of Deoxyglucose and INS results in increased uptake of Deoxyglucose CTD PMID:16483873 more ... Ins2 Rat 2-hydroxypropanoic acid increases secretion ISO INS (Homo sapiens) 6480464 INS protein results in increased secretion of Lactic Acid CTD PMID:25720493 Ins2 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO INS (Homo sapiens) 6480464 3 more ... CTD PMID:25734695 Ins2 Rat 3,3',4,4'-tetrachlorobiphenyl decreases response to substance ISO Ins2 (Mus musculus) 6480464 3 more ... CTD PMID:24231106 Ins2 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Ins2 (Mus musculus) 6480464 3 more ... CTD PMID:24231106 Ins2 Rat 3,3',5,5'-tetrabromobisphenol A multiple interactions ISO Ins2 (Mus musculus) 6480464 tetrabromobisphenol A inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] more ... CTD PMID:32473317 Ins2 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO Ins2 (Mus musculus) 6480464 [Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein co-treated with Indomethacin co-treated with Rosiglitazone co-treated with Triiodothyronine] results in increased expression of KCNMA1 mRNA more ... CTD PMID:27605626 Ins2 Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO INS (Homo sapiens) 6480464 [Orlistat co-treated with Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of NFE2L2 mRNA more ... CTD PMID:33476690 Ins2 Rat 3,7-dihydropurine-6-thione decreases expression EXP 6480464 Mercaptopurine results in decreased expression of INS2 mRNA CTD PMID:23358152 Ins2 Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO INS (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [INS protein results in increased expression of ATP1A1 protein] more ... CTD PMID:22162761 Ins2 Rat 3-aminobenzamide multiple interactions ISO INS (Homo sapiens) 6480464 3-aminobenzamide inhibits the reaction [Glucose inhibits the reaction [MAFA protein binds to INS promoter]] more ... CTD PMID:16505238 Ins2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO INS (Homo sapiens) 6480464 1-Methyl-3-isobutylxanthine promotes the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:20206132 more ... Ins2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Ins2 (Mus musculus) 6480464 2 more ... CTD PMID:10777552 more ... Ins2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] inhibits the reaction [TGFB1 protein results in decreased expression of SENP2 protein] more ... CTD PMID:21350315 more ... Ins2 Rat 3-methylcholanthrene multiple interactions ISO INS (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [Glucose results in increased secretion of INS protein alternative form] CTD PMID:31776611 Ins2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO INS (Homo sapiens) 6480464 [bisphenol S co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] affects the expression of PPARG protein more ... CTD PMID:28628672 and PMID:33865937 Ins2 Rat 4,4'-sulfonyldiphenol multiple interactions ISO Ins2 (Mus musculus) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [[bisphenol S co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 mRNA] more ... CTD PMID:27273607 Ins2 Rat 4-phenylbutyric acid multiple interactions ISO INS (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Glucosamine inhibits the reaction [INS results in increased uptake of Deoxyglucose]] and 4-phenylbutyric acid inhibits the reaction [Palmitic Acid inhibits the reaction [INS protein results in increased phosphorylation of AKT1 protein]] CTD PMID:20165829 and PMID:32283200 Ins2 Rat 4-phenylbutyric acid multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [[INS co-treated with Acrylamide] results in increased expression of HSPA5 protein] more ... CTD PMID:38604440 Ins2 Rat 5-aza-2'-deoxycytidine multiple interactions ISO Ins2 (Mus musculus) 6480464 Decitabine inhibits the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased expression of ST6GAL1 mRNA] CTD PMID:28031460 Ins2 Rat 5-fluorouracil decreases expression ISO Ins2 (Mus musculus) 6480464 Fluorouracil results in decreased expression of INS2 protein CTD PMID:21296659 Ins2 Rat 5-iodotubercidin increases secretion ISO INS (Homo sapiens) 6480464 5-iodotubercidin results in increased secretion of INS protein CTD PMID:26953159 Ins2 Rat 5-iodotubercidin affects secretion ISO INS (Homo sapiens) 6480464 5-iodotubercidin affects the secretion of INS protein CTD PMID:26953159 Ins2 Rat 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid decreases expression ISO INS (Homo sapiens) 6480464 acipimox results in decreased expression of INS protein CTD PMID:8923850 Ins2 Rat 5-oxo-L-proline multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Pyrrolidonecarboxylic Acid analog CTD PMID:26820058 Ins2 Rat 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions ISO INS (Homo sapiens) 6480464 6-chloro-2 more ... CTD PMID:21163946 Ins2 Rat 6-Hydroxychlorzoxazone multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [stearic acid results in increased chemical synthesis of 6-hydroxychlorzoxazone] CTD PMID:26739624 Ins2 Rat 9-cis-retinoic acid multiple interactions ISO INS (Homo sapiens) 6480464 Alitretinoin inhibits the reaction [[[PDGFB protein binds to PDGFB protein] which co-treated with INS protein] results in decreased expression of CDKN1B protein] more ... CTD PMID:11348869 Ins2 Rat 9-cis-retinoic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [[Dexamethasone co-treated with INS protein co-treated with 1-Methyl-3-isobutylxanthine] co-treated with Alitretinoin] results in increased expression of SLC27A1 mRNA more ... CTD PMID:10777552 Ins2 Rat AACOCF3 increases secretion ISO INS (Homo sapiens) 6480464 arachidonyltrifluoromethane results in increased secretion of INS protein CTD PMID:17192482 Ins2 Rat AACOCF3 multiple interactions ISO INS (Homo sapiens) 6480464 arachidonyltrifluoromethane inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:17192482 Ins2 Rat acetaminophen O-beta-D-glucosiduronic acid increases abundance ISO INS (Homo sapiens) 6480464 INS protein results in increased abundance of acetaminophen glucuronide CTD PMID:26739624 Ins2 Rat acetic acid decreases expression ISO Ins2 (Mus musculus) 6480464 Acetic Acid results in decreased expression of INS2 protein CTD PMID:21296659 Ins2 Rat acrolein multiple interactions ISO Ins2 (Mus musculus) 6480464 Acrolein inhibits the reaction [INS protein results in increased phosphorylation of AKT1 protein] CTD PMID:24812010 Ins2 Rat acrylamide multiple interactions EXP 6480464 4-phenylbutyric acid inhibits the reaction [[INS co-treated with Acrylamide] results in increased expression of HSPA5 protein] more ... CTD PMID:38604440 Ins2 Rat actinomycin D multiple interactions ISO Ins2 (Mus musculus) 6480464 Dactinomycin inhibits the reaction [[[Dexamethasone co-treated with INS protein co-treated with 1-Methyl-3-isobutylxanthine] co-treated with alitretinoin] results in increased expression of SLC27A1 mRNA] CTD PMID:10777552 Ins2 Rat albuterol increases expression ISO INS (Homo sapiens) 6480464 Albuterol results in increased expression of INS and Albuterol results in increased expression of INS protein CTD PMID:8098220 and PMID:9088585 Ins2 Rat aldehydo-D-glucosamine multiple interactions ISO INS (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Glucosamine inhibits the reaction [INS results in increased uptake of Deoxyglucose]] more ... CTD PMID:20165829 and PMID:33812996 Ins2 Rat aldehydo-D-glucose increases uptake EXP 6480464 INS protein results in increased uptake of Glucose CTD PMID:18266981 more ... Ins2 Rat aldehydo-D-glucose affects response to substance ISO INS (Homo sapiens) 6480464 Glucose affects the susceptibility to INS protein CTD PMID:30914352 Ins2 Rat aldehydo-D-glucose increases uptake ISO INS (Homo sapiens) 6480464 INS protein results in increased uptake of Glucose CTD PMID:15277403 more ... Ins2 Rat aldehydo-D-glucose increases expression ISO Ins2 (Mus musculus) 6480464 Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 Ins2 Rat aldehydo-D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of INS2 mRNA CTD PMID:12914525 Ins2 Rat aldehydo-D-glucose increases secretion ISO Ins2 (Mus musculus) 6480464 Glucose results in increased secretion of INS protein and Glucose results in increased secretion of INS2 protein CTD PMID:10967106 more ... Ins2 Rat aldehydo-D-glucose multiple interactions ISO Ins2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose]] more ... CTD PMID:10967106 more ... Ins2 Rat aldehydo-D-glucose increases uptake ISO Ins2 (Mus musculus) 6480464 INS protein results in increased uptake of Glucose CTD PMID:24231106 Ins2 Rat aldehydo-D-glucose increases expression EXP 6480464 Glucose results in increased expression of INS mRNA and Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 and PMID:9142872 Ins2 Rat aldehydo-D-glucose increases secretion ISO INS (Homo sapiens) 6480464 Glucose results in increased secretion of INS protein more ... CTD PMID:10430617 more ... Ins2 Rat aldehydo-D-glucose decreases secretion ISO INS (Homo sapiens) 6480464 Glucose results in decreased secretion of INS protein CTD PMID:15642492 and PMID:16452552 Ins2 Rat aldehydo-D-glucose decreases chemical synthesis ISO INS (Homo sapiens) 6480464 Glucose results in decreased chemical synthesis of INS protein CTD PMID:20520763 Ins2 Rat aldehydo-D-glucose increases activity ISO INS (Homo sapiens) 6480464 Glucose results in increased activity of INS promoter CTD PMID:16489446 Ins2 Rat aldehydo-D-glucose multiple interactions ISO INS (Homo sapiens) 6480464 (R)-2-(3-((benzoxazol-2-yl-d4 (3-(4-methoxyphenoxy-d7)propyl)amino)methyl)phenoxy) butanoic acid affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:10430617 more ... Ins2 Rat aldehydo-D-glucose multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased secretion of INS protein]] more ... CTD PMID:21888768 more ... Ins2 Rat all-trans-retinoic acid increases expression ISO INS (Homo sapiens) 6480464 Tretinoin results in increased expression of INS protein CTD PMID:16473924 Ins2 Rat all-trans-retinoic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 Tretinoin inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA] more ... CTD PMID:32473317 Ins2 Rat all-trans-retinoic acid multiple interactions ISO INS (Homo sapiens) 6480464 Tretinoin inhibits the reaction [[[PDGFB protein binds to PDGFB protein] which co-treated with INS protein] results in decreased expression of CDKN1B protein] more ... CTD PMID:11348869 Ins2 Rat all-trans-retinoic acid increases secretion ISO INS (Homo sapiens) 6480464 Tretinoin results in increased secretion of INS protein CTD PMID:16473924 Ins2 Rat all-trans-retinol multiple interactions ISO Ins2 (Mus musculus) 6480464 [Vitamin A co-treated with INHBA protein] results in increased expression of INS2 mRNA CTD PMID:17244017 Ins2 Rat allethrin multiple interactions ISO Ins2 (Mus musculus) 6480464 Allethrins inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA] and Allethrins inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Ins2 Rat amino acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in decreased abundance of Amino Acids analog CTD PMID:26820058 Ins2 Rat amiodarone multiple interactions ISO Ins2 (Mus musculus) 6480464 INS inhibits the reaction [Amiodarone results in increased phosphorylation of LIPE protein] CTD PMID:28962527 Ins2 Rat amlodipine decreases expression ISO INS (Homo sapiens) 6480464 Amlodipine results in decreased expression of INS protein CTD PMID:19651449 Ins2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of INS2 mRNA CTD PMID:16483693 Ins2 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [Paroxetine affects the reaction [INS protein affects the phosphorylation of IRS1 protein]] CTD PMID:17728140 Ins2 Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO Ins2 (Mus musculus) 6480464 pyrazolanthrone inhibits the reaction [GW8510 results in increased expression of INS2 mRNA] CTD PMID:22242153 Ins2 Rat arachidonic acid multiple interactions ISO INS (Homo sapiens) 6480464 Arachidonic Acid promotes the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:17192482 Ins2 Rat arachidonic acid increases secretion ISO INS (Homo sapiens) 6480464 Arachidonic Acid results in increased secretion of INS protein CTD PMID:17192482 Ins2 Rat arotinoid acid multiple interactions ISO INS (Homo sapiens) 6480464 4-(2-(5 more ... CTD PMID:11348869 Ins2 Rat arsane multiple interactions ISO Ins2 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of INS2 protein CTD PMID:32226249 Ins2 Rat arsenic atom multiple interactions ISO Ins2 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of INS2 protein CTD PMID:32226249 Ins2 Rat arsenite(3-) multiple interactions ISO INS (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of arsenite] inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:31555879 Ins2 Rat arsenite(3-) multiple interactions ISO Ins2 (Mus musculus) 6480464 arsenite inhibits the reaction [INS protein results in decreased activity of PYGL protein] and arsenite inhibits the reaction [INS protein results in increased activity of GYS2 protein] CTD PMID:28952001 Ins2 Rat arsenous acid multiple interactions ISO Ins2 (Mus musculus) 6480464 Arsenic Trioxide inhibits the reaction [INS protein results in increased phosphorylation of GSK3B protein] and Plant Extracts inhibits the reaction [[sodium arsenite results in increased abundance of Arsenic Trioxide] which results in decreased expression of INS2 protein] CTD PMID:32226249 and PMID:35226250 Ins2 Rat arsenous acid multiple interactions ISO INS (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [INS protein results in increased phosphorylation of GSK3B protein] more ... CTD PMID:35226250 Ins2 Rat aspartame increases expression ISO INS (Homo sapiens) 6480464 Aspartame results in increased expression of INS protein CTD PMID:1805284 Ins2 Rat aspartame multiple interactions ISO Ins2 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ins2 Rat atenolol multiple interactions ISO INS (Homo sapiens) 6480464 Atenolol inhibits the reaction [Terbutaline results in increased expression of INS protein] CTD PMID:12795776 Ins2 Rat atorvastatin calcium increases expression ISO INS (Homo sapiens) 6480464 Atorvastatin results in increased expression of INS protein CTD PMID:19651449 Ins2 Rat ATP multiple interactions ISO INS (Homo sapiens) 6480464 [ammonium ferrous sulfate results in increased activity of INS protein modified form] which results in increased secretion of Adenosine Triphosphate more ... CTD PMID:17965850 and PMID:26739624 Ins2 Rat atrazine increases expression ISO INS (Homo sapiens) 6480464 Atrazine results in increased expression of INS mRNA CTD PMID:22378314 Ins2 Rat avobenzone multiple interactions ISO INS (Homo sapiens) 6480464 [avobenzone co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of PPARA mRNA more ... CTD PMID:31016361 Ins2 Rat bafilomycin A1 multiple interactions EXP 6480464 bafilomycin A1 inhibits the reaction [INS protein results in increased phosphorylation of EIF4EBP1 protein] and bafilomycin A1 inhibits the reaction [INS protein results in increased phosphorylation of RPS6KB1 protein] CTD PMID:22689575 Ins2 Rat baicalein multiple interactions ISO INS (Homo sapiens) 6480464 baicalein promotes the reaction [Glucose results in increased secretion of INS protein] CTD PMID:17192482 Ins2 Rat baicalein increases secretion ISO INS (Homo sapiens) 6480464 baicalein results in increased secretion of INS protein CTD PMID:17192482 Ins2 Rat Bardoxolone methyl multiple interactions ISO INS (Homo sapiens) 6480464 bardoxolone methyl inhibits the reaction [INS protein results in increased phosphorylation of RPS6 protein] CTD PMID:28790194 Ins2 Rat benzene multiple interactions ISO Ins2 (Mus musculus) 6480464 Benzene inhibits the reaction [INS results in increased phosphorylation of AKT1 protein] CTD PMID:30346588 Ins2 Rat benzo[a]pyrene increases expression ISO Ins2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of INS2 mRNA CTD PMID:27195522 Ins2 Rat benzo[a]pyrene affects methylation ISO INS (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of INS promoter CTD PMID:27901495 Ins2 Rat berberine multiple interactions EXP 6480464 [Berberine co-treated with Streptozocin] results in increased secretion of INS protein CTD PMID:15066220 Ins2 Rat beta-D-glucosamine multiple interactions ISO INS (Homo sapiens) 6480464 4-phenylbutyric acid inhibits the reaction [Glucosamine inhibits the reaction [INS results in increased uptake of Deoxyglucose]] more ... CTD PMID:20165829 and PMID:33812996 Ins2 Rat bexarotene multiple interactions ISO INS (Homo sapiens) 6480464 [bexarotene co-treated with [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein]] results in increased expression of ABCA1 protein more ... CTD PMID:25932594 Ins2 Rat bexarotene multiple interactions ISO Ins2 (Mus musculus) 6480464 [[Dexamethasone co-treated with INS protein co-treated with 1-Methyl-3-isobutylxanthine] co-treated with bexarotene] results in increased expression of SLC27A1 mRNA and [Dexamethasone co-treated with INS protein co-treated with 1-Methyl-3-isobutylxanthine] results in increased susceptibility to bexarotene CTD PMID:10777552 Ins2 Rat bezafibrate multiple interactions ISO INS (Homo sapiens) 6480464 [Bezafibrate binds to and results in increased activity of PPARA protein] which results in decreased expression of INS protein more ... CTD PMID:11292061 more ... Ins2 Rat bezafibrate decreases expression ISO INS (Homo sapiens) 6480464 Bezafibrate results in decreased expression of INS protein CTD PMID:2209320 Ins2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Ins2 (Mus musculus) 6480464 [Diethylhexyl Phthalate co-treated with Streptozocin co-treated with Dietary Fats] results in increased expression of INS2 mRNA more ... CTD PMID:22197818 and PMID:33484791 Ins2 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO INS (Homo sapiens) 6480464 Diethylhexyl Phthalate affects the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:31016361 more ... Ins2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO INS (Homo sapiens) 6480464 Diethylhexyl Phthalate results in decreased expression of INS mRNA and Diethylhexyl Phthalate results in decreased expression of INS protein CTD PMID:31163220 and PMID:35457000 Ins2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Ins2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of INS2 mRNA CTD PMID:33484791 Ins2 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of INS2 mRNA CTD PMID:25280772 Ins2 Rat bismuth atom multiple interactions ISO INS (Homo sapiens) 6480464 [Bismuth affects the susceptibility to [INS protein co-treated with Dexamethasone co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine]] which results in decreased expression of CEBPA mRNA more ... CTD PMID:34560244 Ins2 Rat bismuthane multiple interactions ISO INS (Homo sapiens) 6480464 [Bismuth affects the susceptibility to [INS protein co-treated with Dexamethasone co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine]] which results in decreased expression of CEBPA mRNA more ... CTD PMID:34560244 Ins2 Rat bisoprolol multiple interactions ISO INS (Homo sapiens) 6480464 Bisoprolol inhibits the reaction [Terbutaline results in increased expression of INS protein] CTD PMID:12795776 Ins2 Rat bisphenol A increases secretion ISO INS (Homo sapiens) 6480464 bisphenol A results in increased secretion of INS protein CTD PMID:22347437 and PMID:35457000 Ins2 Rat bisphenol A increases secretion ISO Ins2 (Mus musculus) 6480464 bisphenol A results in increased secretion of INS protein CTD PMID:38042274 Ins2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of INS2 mRNA CTD PMID:32145629 Ins2 Rat bisphenol A decreases response to substance EXP 6480464 bisphenol A results in decreased susceptibility to INS protein CTD PMID:36328215 Ins2 Rat bisphenol A increases expression ISO Ins2 (Mus musculus) 6480464 bisphenol A results in increased expression of INS protein and bisphenol A results in increased expression of INS2 protein CTD PMID:18446233 and PMID:28774890 Ins2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of INS2 mRNA CTD PMID:23328667 Ins2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with INS protein] results in decreased phosphorylation of AKT1 protein more ... CTD PMID:26496021 and PMID:36328215 Ins2 Rat bisphenol A multiple interactions ISO INS (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of INS gene more ... CTD PMID:28628672 more ... Ins2 Rat bisphenol A decreases secretion ISO INS (Homo sapiens) 6480464 bisphenol A results in decreased secretion of INS protein CTD PMID:25878060 Ins2 Rat bisphenol A multiple interactions ISO Ins2 (Mus musculus) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [[bisphenol A co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 mRNA] more ... CTD PMID:18446233 more ... Ins2 Rat bisphenol AF multiple interactions ISO INS (Homo sapiens) 6480464 [IFNG protein co-treated with bisphenol AF] inhibits the reaction [[INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Rosiglitazone] results in increased expression of CYCS protein] more ... CTD PMID:31596606 Ins2 Rat bisphenol F multiple interactions ISO INS (Homo sapiens) 6480464 [bisphenol F co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] affects the expression of FABP4 protein more ... CTD PMID:28628672 and PMID:33865937 Ins2 Rat bisphenol F increases secretion ISO INS (Homo sapiens) 6480464 bisphenol F results in increased secretion of INS protein CTD PMID:35457000 Ins2 Rat boric acid multiple interactions ISO Ins2 (Mus musculus) 6480464 boric acid inhibits the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased expression of CCND1 protein] more ... CTD PMID:28285642 Ins2 Rat boric acid increases expression ISO Ins2 (Mus musculus) 6480464 boric acid results in increased expression of INS2 mRNA CTD PMID:31368021 Ins2 Rat bromochloroacetic acid decreases expression ISO Ins2 (Mus musculus) 6480464 bromochloroacetic acid results in decreased expression of INS2 protein CTD PMID:21296659 Ins2 Rat bromocriptine decreases expression ISO INS (Homo sapiens) 6480464 Bromocriptine results in decreased expression of INS protein CTD PMID:16803851 Ins2 Rat butan-1-amine multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of n-butylamine analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of n-butylamine analog CTD PMID:26820058 Ins2 Rat Butylbenzyl phthalate multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] affects the abundance of diphosphoric acid analog more ... CTD PMID:26820058 and PMID:28595985 Ins2 Rat Butylbenzyl phthalate multiple interactions ISO INS (Homo sapiens) 6480464 butylbenzyl phthalate promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] more ... CTD PMID:31016361 and PMID:34864131 Ins2 Rat Butylparaben multiple interactions ISO INS (Homo sapiens) 6480464 butylparaben promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in decreased secretion of TNFRSF11B protein] and butylparaben promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased secretion of ADIPOQ protein] CTD PMID:31016361 Ins2 Rat cadmium atom decreases expression ISO INS (Homo sapiens) 6480464 Cadmium results in decreased expression of INS protein CTD PMID:17303580 Ins2 Rat cadmium atom multiple interactions ISO INS (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:31555879 Ins2 Rat cadmium dichloride multiple interactions ISO INS (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] inhibits the reaction [Glucose results in increased secretion of INS protein] and Cadmium Chloride promotes the reaction [Glucose results in increased secretion of INS protein] CTD PMID:31555879 and PMID:35457000 Ins2 Rat cadmium dichloride increases expression ISO Ins2 (Mus musculus) 6480464 Cadmium Chloride results in increased expression of INS2 mRNA CTD PMID:35457000 Ins2 Rat caffeine multiple interactions ISO INS (Homo sapiens) 6480464 Caffeine inhibits the reaction [INS protein results in increased phosphorylation of AKT1 protein] CTD PMID:21081844 Ins2 Rat calcidiol affects secretion ISO INS (Homo sapiens) 6480464 Calcifediol affects the secretion of INS protein CTD PMID:24401716 Ins2 Rat cannabidiolic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 cannabidiolic acid promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of CEBPA mRNA] more ... CTD PMID:30611848 Ins2 Rat cannabigerol multiple interactions ISO Ins2 (Mus musculus) 6480464 cannabigerol promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of FABP4 mRNA] and cannabigerol promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of PPARG mRNA] CTD PMID:30611848 Ins2 Rat cannabigerolic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 cannabigerolic acid promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of FABP4 mRNA] and cannabigerolic acid promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased expression of PPARG mRNA] CTD PMID:30611848 Ins2 Rat capsaicin multiple interactions EXP 6480464 [INS protein co-treated with Capsaicin] promotes the reaction [Capsaicin results in increased uptake of cobaltous chloride] CTD PMID:14622148 Ins2 Rat capsazepine multiple interactions EXP 6480464 capsazepine inhibits the reaction [INS protein results in increased uptake of cobaltous chloride] CTD PMID:14622148 Ins2 Rat carbamic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of carbamic acid analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of carbamic acid analog CTD PMID:26820058 Ins2 Rat carvedilol decreases expression ISO INS (Homo sapiens) 6480464 carvedilol results in decreased expression of INS protein alternative form CTD PMID:16598518 Ins2 Rat chlorpropamide decreases expression ISO INS (Homo sapiens) 6480464 Chlorpropamide results in decreased expression of INS protein CTD PMID:15642492 Ins2 Rat chlorpropamide increases expression ISO INS (Homo sapiens) 6480464 Chlorpropamide results in increased expression of INS mRNA CTD PMID:15642492 Ins2 Rat chlorpropamide multiple interactions ISO INS (Homo sapiens) 6480464 Chlorpropamide inhibits the reaction [Glucose results in decreased secretion of INS protein] CTD PMID:15642492 Ins2 Rat chlorpyrifos decreases expression EXP 6480464 Chlorpyrifos results in decreased expression of INS2 protein CTD PMID:29109040 Ins2 Rat chlorzoxazone multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [stearic acid results in increased hydroxylation of Chlorzoxazone] CTD PMID:26739624 Ins2 Rat cholesterol multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Cholesterol analog CTD PMID:26820058 Ins2 Rat chromium atom multiple interactions EXP 6480464 INS protein affects the reaction [TF protein affects the transport of Chromium] CTD PMID:14987854 Ins2 Rat chromium(3+) trichloride multiple interactions ISO INS (Homo sapiens) 6480464 [chromic chloride results in increased activity of INS protein modified form] which results in increased import of Glucose more ... CTD PMID:17965850 Ins2 Rat chromium(3+) trichloride increases activity ISO INS (Homo sapiens) 6480464 chromic chloride results in increased activity of INS protein modified form CTD PMID:17965850 Ins2 Rat ciprofibrate multiple interactions EXP 6480464 INS protein affects the reaction [ciprofibrate results in increased expression of CYP3A23-3A1 mRNA] CTD PMID:10215695 Ins2 Rat clofibrate affects secretion ISO INS (Homo sapiens) 6480464 Clofibrate affects the secretion of INS protein CTD PMID:1143089 Ins2 Rat clofibrate decreases secretion ISO INS (Homo sapiens) 6480464 Clofibrate results in decreased secretion of INS protein CTD PMID:417937 Ins2 Rat clonidine decreases secretion ISO INS (Homo sapiens) 6480464 Clonidine results in decreased secretion of INS protein CTD PMID:707001 Ins2 Rat clonidine (amino form) decreases secretion ISO INS (Homo sapiens) 6480464 Clonidine results in decreased secretion of INS protein CTD PMID:707001 Ins2 Rat clonidine (imino form) decreases secretion ISO INS (Homo sapiens) 6480464 Clonidine results in decreased secretion of INS protein CTD PMID:707001 Ins2 Rat clozapine affects secretion ISO INS (Homo sapiens) 6480464 Clozapine affects the secretion of INS protein CTD PMID:11769361 Ins2 Rat clozapine increases expression ISO INS (Homo sapiens) 6480464 Clozapine results in increased expression of INS protein CTD PMID:16601995 Ins2 Rat co-trimoxazole increases secretion ISO INS (Homo sapiens) 6480464 Trimethoprim and Sulfamethoxazole Drug Combination results in increased secretion of INS protein modified form CTD PMID:14714756 Ins2 Rat cobalt dichloride multiple interactions EXP 6480464 [INS protein co-treated with Capsaicin] promotes the reaction [Capsaicin results in increased uptake of cobaltous chloride] more ... CTD PMID:14622148 Ins2 Rat cobalt dichloride increases uptake EXP 6480464 INS protein results in increased uptake of cobaltous chloride CTD PMID:14622148 Ins2 Rat cocaine decreases expression ISO INS (Homo sapiens) 6480464 Cocaine results in decreased expression of INS protein CTD PMID:18346162 Ins2 Rat conjugated linoleic acid decreases expression ISO INS (Homo sapiens) 6480464 Linoleic Acids and Conjugated results in decreased expression of INS protein CTD PMID:23073171 Ins2 Rat conjugated linoleic acid increases response to substance ISO INS (Homo sapiens) 6480464 Linoleic Acids and Conjugated results in increased susceptibility to INS protein CTD PMID:23073171 Ins2 Rat copper atom multiple interactions ISO INS (Homo sapiens) 6480464 [Copper co-treated with Ascorbic Acid] results in increased oxidation of and affects the folding of INS protein more ... CTD PMID:17109627 and PMID:23403016 Ins2 Rat copper atom affects transport ISO INS (Homo sapiens) 6480464 INS protein affects the transport of Copper CTD PMID:17109627 Ins2 Rat copper(0) affects transport ISO INS (Homo sapiens) 6480464 INS protein affects the transport of Copper CTD PMID:17109627 Ins2 Rat copper(0) multiple interactions ISO INS (Homo sapiens) 6480464 [Copper co-treated with Ascorbic Acid] results in increased oxidation of and affects the folding of INS protein more ... CTD PMID:17109627 and PMID:23403016 Ins2 Rat corticosterone multiple interactions ISO INS (Homo sapiens) 6480464 [Corticosterone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein more ... CTD PMID:29782964 Ins2 Rat corticotropin multiple interactions ISO INS (Homo sapiens) 6480464 Adrenocorticotropic Hormone inhibits the reaction [INS protein results in increased secretion of GH1 protein] CTD PMID:3008584 Ins2 Rat cortisol multiple interactions ISO INS (Homo sapiens) 6480464 [Orlistat co-treated with Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of NFE2L2 mRNA more ... CTD PMID:33476690 more ... Ins2 Rat cortisol increases expression ISO INS (Homo sapiens) 6480464 Hydrocortisone results in increased expression of INS protein CTD PMID:7473517 more ... Ins2 Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Fructose results in increased expression of INS protein] CTD PMID:25268984 and PMID:26713546 Ins2 Rat curcumin multiple interactions ISO Ins2 (Mus musculus) 6480464 Curcumin inhibits the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased abundance of Triglycerides] more ... CTD PMID:28595985 Ins2 Rat cycloheximide multiple interactions ISO INS (Homo sapiens) 6480464 [Cycloheximide co-treated with INS protein] results in decreased expression of HIF1A protein and L-4F peptide promotes the reaction [[Cycloheximide co-treated with INS protein] results in decreased expression of HIF1A protein] CTD PMID:22537771 Ins2 Rat cyproterone acetate multiple interactions ISO INS (Homo sapiens) 6480464 [Cyproterone Acetate co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein more ... CTD PMID:29782964 Ins2 Rat D-glucose multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased secretion of INS protein]] more ... CTD PMID:21888768 more ... Ins2 Rat D-glucose affects response to substance ISO INS (Homo sapiens) 6480464 Glucose affects the susceptibility to INS protein CTD PMID:30914352 Ins2 Rat D-glucose increases uptake ISO INS (Homo sapiens) 6480464 INS protein results in increased uptake of Glucose CTD PMID:15277403 more ... Ins2 Rat D-glucose increases expression ISO Ins2 (Mus musculus) 6480464 Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 Ins2 Rat D-glucose decreases expression EXP 6480464 Glucose results in decreased expression of INS2 mRNA CTD PMID:12914525 Ins2 Rat D-glucose increases secretion ISO Ins2 (Mus musculus) 6480464 Glucose results in increased secretion of INS protein and Glucose results in increased secretion of INS2 protein CTD PMID:10967106 more ... Ins2 Rat D-glucose increases uptake ISO Ins2 (Mus musculus) 6480464 INS protein results in increased uptake of Glucose CTD PMID:24231106 Ins2 Rat D-glucose increases expression EXP 6480464 Glucose results in increased expression of INS mRNA and Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 and PMID:9142872 Ins2 Rat D-glucose multiple interactions ISO Ins2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose]] more ... CTD PMID:10967106 more ... Ins2 Rat D-glucose decreases chemical synthesis ISO INS (Homo sapiens) 6480464 Glucose results in decreased chemical synthesis of INS protein CTD PMID:20520763 Ins2 Rat D-glucose decreases secretion ISO INS (Homo sapiens) 6480464 Glucose results in decreased secretion of INS protein CTD PMID:15642492 and PMID:16452552 Ins2 Rat D-glucose increases secretion ISO INS (Homo sapiens) 6480464 Glucose results in increased secretion of INS protein more ... CTD PMID:10430617 more ... Ins2 Rat D-glucose increases activity ISO INS (Homo sapiens) 6480464 Glucose results in increased activity of INS promoter CTD PMID:16489446 Ins2 Rat D-glucose multiple interactions ISO INS (Homo sapiens) 6480464 (R)-2-(3-((benzoxazol-2-yl-d4 (3-(4-methoxyphenoxy-d7)propyl)amino)methyl)phenoxy) butanoic acid affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:10430617 more ... Ins2 Rat D-glucose increases uptake EXP 6480464 INS protein results in increased uptake of Glucose CTD PMID:18266981 more ... Ins2 Rat D-mannopyranose multiple interactions ISO INS (Homo sapiens) 6480464 Mannose inhibits the reaction [[chromic chloride results in increased activity of INS protein modified form] which results in increased secretion of Adenosine Triphosphate] CTD PMID:17965850 Ins2 Rat DDE multiple interactions ISO INS (Homo sapiens) 6480464 [Dichlorodiphenyl Dichloroethylene co-treated with [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein]] results in increased expression of PPARG mRNA more ... CTD PMID:26200599 and PMID:35563431 Ins2 Rat DDE decreases expression ISO Ins2 (Mus musculus) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of INS2 mRNA CTD PMID:35457000 Ins2 Rat decabromodiphenyl ether multiple interactions ISO Ins2 (Mus musculus) 6480464 [decabromobiphenyl ether co-treated with Dietary Fats] results in increased secretion of INS protein CTD PMID:30468867 Ins2 Rat demethoxycurcumin increases secretion ISO INS (Homo sapiens) 6480464 demethoxycurcumin results in increased secretion of INS protein CTD PMID:19188863 Ins2 Rat desmosterol multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Desmosterol analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of Desmosterol analog CTD PMID:26820058 Ins2 Rat dexamethasone multiple interactions ISO INS (Homo sapiens) 6480464 17 alpha-Hydroxyprogesterone Caproate inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] more ... CTD PMID:17290005 more ... Ins2 Rat dexamethasone multiple interactions EXP 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] inhibits the reaction [TGFB1 protein results in decreased expression of SENP2 protein] more ... CTD PMID:18972406 more ... Ins2 Rat dexamethasone multiple interactions ISO Ins2 (Mus musculus) 6480464 2 more ... CTD PMID:10777552 more ... Ins2 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of INS2 mRNA CTD PMID:32791177 Ins2 Rat dexamethasone increases secretion ISO INS (Homo sapiens) 6480464 Dexamethasone results in increased secretion of INS protein CTD PMID:8436259 Ins2 Rat dexamethasone decreases response to substance ISO INS (Homo sapiens) 6480464 Dexamethasone results in decreased susceptibility to INS protein CTD PMID:8436259 Ins2 Rat dexamethasone phosphate multiple interactions ISO INS (Homo sapiens) 6480464 [dexamethasone 21-phosphate co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein and [dexamethasone 21-phosphate co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein CTD PMID:29782964 Ins2 Rat diarsenic trioxide multiple interactions ISO Ins2 (Mus musculus) 6480464 Arsenic Trioxide inhibits the reaction [INS protein results in increased phosphorylation of GSK3B protein] and Plant Extracts inhibits the reaction [[sodium arsenite results in increased abundance of Arsenic Trioxide] which results in decreased expression of INS2 protein] CTD PMID:32226249 and PMID:35226250 Ins2 Rat diarsenic trioxide multiple interactions ISO INS (Homo sapiens) 6480464 Arsenic Trioxide inhibits the reaction [INS protein results in increased phosphorylation of GSK3B protein] more ... CTD PMID:35226250 Ins2 Rat diazinon increases methylation ISO INS (Homo sapiens) 6480464 Diazinon results in increased methylation of INS gene CTD PMID:22964155 Ins2 Rat diazinon multiple interactions ISO INS (Homo sapiens) 6480464 [Selenium analog co-treated with Magnesium Oxide analog] inhibits the reaction [Diazinon results in decreased secretion of INS protein alternative form] more ... CTD PMID:27920530 Ins2 Rat diazinon decreases secretion ISO INS (Homo sapiens) 6480464 Diazinon results in decreased secretion of INS protein and Diazinon results in decreased secretion of INS protein alternative form CTD PMID:27920530 Ins2 Rat diazoxide multiple interactions ISO INS (Homo sapiens) 6480464 Diazoxide inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:35457000 Ins2 Rat dibenziodolium multiple interactions ISO INS (Homo sapiens) 6480464 diphenyleneiodonium inhibits the reaction [INS protein results in increased expression of TRPC6 protein] CTD PMID:22031853 Ins2 Rat dicamba multiple interactions ISO INS (Homo sapiens) 6480464 Dicamba inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] CTD PMID:29782964 Ins2 Rat Didymin multiple interactions ISO INS (Homo sapiens) 6480464 didymin inhibits the reaction [INS protein results in decreased phosphorylation of AKT1 protein] more ... CTD PMID:30928401 Ins2 Rat diethyl maleate multiple interactions ISO INS (Homo sapiens) 6480464 diethyl maleate inhibits the reaction [INS protein affects the localization of and results in increased phosphorylation of FOXO1 protein] CTD PMID:30261343 Ins2 Rat diethyl sulfate multiple interactions ISO INS (Homo sapiens) 6480464 diethyl sulfate inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and diethyl sulfate inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein] CTD PMID:29782964 Ins2 Rat diethylstilbestrol multiple interactions ISO Ins2 (Mus musculus) 6480464 [[INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone] co-treated with Diethylstilbestrol] results in decreased activity of ESR1 protein more ... CTD PMID:26944108 Ins2 Rat digoxin decreases response to substance ISO INS (Homo sapiens) 6480464 INS protein results in decreased susceptibility to Digoxin CTD PMID:22562035 Ins2 Rat digoxin decreases response to substance EXP 6480464 INS protein results in decreased susceptibility to Digoxin CTD PMID:22562035 Ins2 Rat dimercaprol multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [oxophenylarsine inhibits the reaction [INS protein results in decreased phosphorylation of SLC2A4 protein]] CTD PMID:8048502 Ins2 Rat diphosphoric acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] affects the abundance of diphosphoric acid analog CTD PMID:26820058 Ins2 Rat disodium selenite multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [Sodium Selenite results in increased secretion of SELENOP protein] CTD PMID:18972406 Ins2 Rat disodium selenite multiple interactions ISO Ins2 (Mus musculus) 6480464 [Dexamethasone co-treated with INS protein co-treated with TF protein co-treated with Sodium Selenite] results in decreased expression of RUNX2 protein more ... CTD PMID:32324263 Ins2 Rat disodium selenite decreases expression ISO Ins2 (Mus musculus) 6480464 Sodium Selenite results in decreased expression of INS2 mRNA CTD PMID:23274088 Ins2 Rat dopamine multiple interactions ISO INS (Homo sapiens) 6480464 Dopamine promotes the reaction [Metoclopramide results in increased expression of INS protein] CTD PMID:18645345 Ins2 Rat dopamine increases secretion ISO INS (Homo sapiens) 6480464 Dopamine results in increased secretion of INS protein CTD PMID:18645345 Ins2 Rat dopamine increases expression ISO INS (Homo sapiens) 6480464 Dopamine results in increased expression of INS protein CTD PMID:18645345 Ins2 Rat elemental selenium multiple interactions ISO INS (Homo sapiens) 6480464 [Selenium analog co-treated with Magnesium Oxide analog] inhibits the reaction [Diazinon results in decreased secretion of INS protein alternative form] more ... CTD PMID:27920530 Ins2 Rat enalaprilat dihydrate multiple interactions ISO INS (Homo sapiens) 6480464 Enalaprilat inhibits the reaction [Glucose results in decreased secretion of INS protein] CTD PMID:16452552 Ins2 Rat equilin multiple interactions ISO INS (Homo sapiens) 6480464 Equilin inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and Equilin inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein] CTD PMID:29782964 Ins2 Rat ethanol multiple interactions ISO Ins2 (Mus musculus) 6480464 [[INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone] affects the susceptibility to Ethanol] which results in increased secretion of CCL2 protein more ... CTD PMID:32171850 Ins2 Rat ethyl dihydrogen phosphate multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of monoethyl phosphate analog CTD PMID:26820058 Ins2 Rat ethylamine multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of ethylamine analog CTD PMID:26820058 Ins2 Rat farnesol multiple interactions ISO INS (Homo sapiens) 6480464 Farnesol analog results in decreased susceptibility to [INS protein co-treated with EGF protein] CTD PMID:24587105 Ins2 Rat fenofibrate multiple interactions ISO INS (Homo sapiens) 6480464 Fenofibrate affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:32613381 Ins2 Rat fentin hydroxide multiple interactions ISO Ins2 (Mus musculus) 6480464 triphenyltin hydroxide inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA] more ... CTD PMID:32473317 Ins2 Rat ferric ammonium citrate multiple interactions ISO INS (Homo sapiens) 6480464 ferric ammonium citrate inhibits the reaction [Palmitic Acid inhibits the reaction [INS protein results in increased phosphorylation of AKT1 protein]] CTD PMID:32283200 Ins2 Rat fipronil multiple interactions ISO INS (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in decreased expression of INS mRNA CTD PMID:27091632 Ins2 Rat fipronil decreases expression ISO INS (Homo sapiens) 6480464 fipronil results in decreased expression of INS mRNA CTD PMID:27091632 Ins2 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of INS2 mRNA CTD PMID:18035473 Ins2 Rat folic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [Folic Acid co-treated with INS protein co-treated with TF protein co-treated with Sodium Selenite] results in increased expression of RUNX2 mRNA more ... CTD PMID:32324263 Ins2 Rat folic acid multiple interactions ISO INS (Homo sapiens) 6480464 Folic Acid inhibits the reaction [INS protein results in decreased secretion of IL10 protein] more ... CTD PMID:26974319 Ins2 Rat fructose decreases response to substance ISO INS (Homo sapiens) 6480464 Fructose results in decreased susceptibility to INS protein CTD PMID:12010179 Ins2 Rat fructose increases secretion ISO INS (Homo sapiens) 6480464 Fructose results in increased secretion of INS protein CTD PMID:23533474 Ins2 Rat fructose increases expression EXP 6480464 Fructose results in increased expression of INS protein and Fructose results in increased expression of INS2 mRNA CTD PMID:23533474 more ... Ins2 Rat fructose multiple interactions EXP 6480464 Curcumin inhibits the reaction [Fructose results in increased expression of INS protein] more ... CTD PMID:18360027 more ... Ins2 Rat fulvestrant multiple interactions ISO INS (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of INS gene more ... CTD PMID:28180948 more ... Ins2 Rat fulvestrant multiple interactions ISO Ins2 (Mus musculus) 6480464 fulvestrant inhibits the reaction [4 more ... CTD PMID:18446233 and PMID:26944108 Ins2 Rat furan decreases expression EXP 6480464 furan results in decreased expression of INS2 mRNA CTD PMID:25539665 Ins2 Rat gatifloxacin decreases expression EXP 6480464 gatifloxacin results in decreased expression of INS2 mRNA CTD PMID:23200776 Ins2 Rat gatifloxacin multiple interactions EXP 6480464 GCG protein affects the reaction [gatifloxacin results in decreased expression of INS2 mRNA] CTD PMID:23200776 Ins2 Rat gemcitabine increases expression ISO INS (Homo sapiens) 6480464 Gemcitabine results in increased expression of INS protein CTD PMID:20531411 Ins2 Rat genistein increases expression ISO Ins2 (Mus musculus) 6480464 Genistein results in increased expression of INS2 mRNA CTD PMID:24967385 Ins2 Rat Gingerenone A multiple interactions ISO Ins2 (Mus musculus) 6480464 gingerenone A affects the reaction [INS protein results in increased phosphorylation of RPS6KB1 protein] more ... CTD PMID:28556482 and PMID:30296358 Ins2 Rat Gingerenone A multiple interactions EXP 6480464 gingerenone A inhibits the reaction [INS protein results in increased phosphorylation of RPS6 protein] more ... CTD PMID:30296358 Ins2 Rat glimepiride decreases expression ISO INS (Homo sapiens) 6480464 glimepiride results in decreased expression of INS protein CTD PMID:15642492 Ins2 Rat glucose multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [Dexamethasone inhibits the reaction [Glucose results in increased secretion of INS protein]] more ... CTD PMID:21888768 more ... Ins2 Rat glucose affects response to substance ISO INS (Homo sapiens) 6480464 Glucose affects the susceptibility to INS protein CTD PMID:30914352 Ins2 Rat glucose increases uptake ISO INS (Homo sapiens) 6480464 INS protein results in increased uptake of Glucose CTD PMID:15277403 more ... Ins2 Rat glucose increases expression ISO Ins2 (Mus musculus) 6480464 Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 Ins2 Rat glucose decreases expression EXP 6480464 Glucose results in decreased expression of INS2 mRNA CTD PMID:12914525 Ins2 Rat glucose increases secretion ISO Ins2 (Mus musculus) 6480464 Glucose results in increased secretion of INS protein and Glucose results in increased secretion of INS2 protein CTD PMID:10967106 more ... Ins2 Rat glucose multiple interactions ISO Ins2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose]] more ... CTD PMID:10967106 more ... Ins2 Rat glucose increases uptake ISO Ins2 (Mus musculus) 6480464 INS protein results in increased uptake of Glucose CTD PMID:24231106 Ins2 Rat glucose increases expression EXP 6480464 Glucose results in increased expression of INS mRNA and Glucose results in increased expression of INS2 mRNA alternative form CTD PMID:22558381 and PMID:9142872 Ins2 Rat glucose decreases chemical synthesis ISO INS (Homo sapiens) 6480464 Glucose results in decreased chemical synthesis of INS protein CTD PMID:20520763 Ins2 Rat glucose decreases secretion ISO INS (Homo sapiens) 6480464 Glucose results in decreased secretion of INS protein CTD PMID:15642492 and PMID:16452552 Ins2 Rat glucose increases secretion ISO INS (Homo sapiens) 6480464 Glucose results in increased secretion of INS protein more ... CTD PMID:10430617 more ... Ins2 Rat glucose increases activity ISO INS (Homo sapiens) 6480464 Glucose results in increased activity of INS promoter CTD PMID:16489446 Ins2 Rat glucose multiple interactions ISO INS (Homo sapiens) 6480464 (R)-2-(3-((benzoxazol-2-yl-d4 (3-(4-methoxyphenoxy-d7)propyl)amino)methyl)phenoxy) butanoic acid affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:10430617 more ... Ins2 Rat glucose increases uptake EXP 6480464 INS protein results in increased uptake of Glucose CTD PMID:18266981 more ... Ins2 Rat glutathione multiple interactions ISO INS (Homo sapiens) 6480464 INS protein affects the reaction [Acetaminophen results in decreased abundance of Glutathione] CTD PMID:26739624 Ins2 Rat glyburide multiple interactions ISO INS (Homo sapiens) 6480464 [Glyburide co-treated with Glucose] results in increased expression of INS protein more ... CTD PMID:10430617 more ... Ins2 Rat glyburide multiple interactions ISO Ins2 (Mus musculus) 6480464 [Glyburide co-treated with Streptozocin] results in increased secretion of INS protein CTD PMID:15066220 Ins2 Rat glyburide increases response to substance EXP 6480464 Glyburide results in increased susceptibility to INS protein CTD PMID:3116364 Ins2 Rat glyburide increases secretion ISO INS (Homo sapiens) 6480464 Glyburide results in increased secretion of INS protein CTD PMID:10430617 Ins2 Rat glyburide increases expression ISO INS (Homo sapiens) 6480464 Glyburide results in increased expression of INS mRNA CTD PMID:15642492 Ins2 Rat glyburide decreases expression ISO INS (Homo sapiens) 6480464 Glyburide results in decreased expression of INS protein CTD PMID:15642492 Ins2 Rat glycerol 2-phosphate multiple interactions ISO INS (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of ABCA1 mRNA more ... CTD PMID:25932594 Ins2 Rat glycerol 2-phosphate multiple interactions ISO Ins2 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA more ... CTD PMID:32473317 Ins2 Rat glycine multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Glycine analog CTD PMID:26820058 Ins2 Rat glycogen multiple interactions ISO INS (Homo sapiens) 6480464 Estradiol promotes the reaction [INS protein results in increased chemical synthesis of Glycogen] more ... CTD PMID:15864539 more ... Ins2 Rat glycogen increases abundance ISO INS (Homo sapiens) 6480464 INS protein results in increased abundance of Glycogen CTD PMID:31228551 Ins2 Rat glycogen increases chemical synthesis ISO INS (Homo sapiens) 6480464 INS protein results in increased chemical synthesis of Glycogen CTD PMID:15864539 and PMID:21632903 Ins2 Rat glyoxylic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in decreased abundance of glyoxylic acid analog CTD PMID:26820058 Ins2 Rat glyphosate increases expression ISO INS (Homo sapiens) 6480464 Glyphosate results in increased expression of INS mRNA CTD PMID:31874349 Ins2 Rat GSK2656157 multiple interactions EXP 6480464 GSK2656157 inhibits the reaction [[INS co-treated with Acrylamide] results in increased expression of ATF4 protein] more ... CTD PMID:38604440 Ins2 Rat GW 7647 multiple interactions ISO INS (Homo sapiens) 6480464 GW 7647 promotes the reaction [INS protein results in increased uptake of Deoxyglucose] CTD PMID:21324916 Ins2 Rat GW 7647 multiple interactions ISO Ins2 (Mus musculus) 6480464 PPARA protein promotes the reaction [GW 7647 promotes the reaction [INS protein results in increased uptake of Deoxyglucose]] CTD PMID:21324916 Ins2 Rat harmine increases expression ISO INS (Homo sapiens) 6480464 Harmine results in increased expression of INS mRNA CTD PMID:25751815 Ins2 Rat hemin multiple interactions EXP 6480464 Hemin inhibits the reaction [Fructose results in increased expression of INS protein] CTD PMID:25268984 Ins2 Rat heptadecanoic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of margaric acid analog CTD PMID:26820058 Ins2 Rat hexadecanoic acid multiple interactions ISO INS (Homo sapiens) 6480464 (R)-2-(3-((benzoxazol-2-yl-d4 (3-(4-methoxyphenoxy-d7)propyl)amino)methyl)phenoxy) butanoic acid affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:18155663 more ... Ins2 Rat hexadecanoic acid multiple interactions EXP 6480464 4-hydroxyisoleucine inhibits the reaction [Palmitic Acid inhibits the reaction [INS protein affects the localization of SLC2A4 protein]] more ... CTD PMID:25109277 and PMID:35577173 Ins2 Rat hexadecanoic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Palmitic Acid analog more ... CTD PMID:22558381 and PMID:26820058 Ins2 Rat hexadecanoic acid decreases expression ISO INS (Homo sapiens) 6480464 Palmitic Acid results in decreased expression of INS protein CTD PMID:18155663 Ins2 Rat hispidulin multiple interactions ISO Ins2 (Mus musculus) 6480464 hispidulin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein co-treated with Indomethacin] results in increased expression of ADIPOQ mRNA] more ... CTD PMID:30055130 Ins2 Rat hydrogen peroxide increases chemical synthesis ISO INS (Homo sapiens) 6480464 INS protein results in increased chemical synthesis of Hydrogen Peroxide CTD PMID:22031853 Ins2 Rat hydrogen peroxide multiple interactions ISO INS (Homo sapiens) 6480464 manganese(III)-tetrakis(4-benzoic acid)porphyrin inhibits the reaction [INS protein results in increased chemical synthesis of Hydrogen Peroxide] CTD PMID:22031853 Ins2 Rat indometacin multiple interactions ISO INS (Homo sapiens) 6480464 [Bismuth affects the susceptibility to [INS protein co-treated with Dexamethasone co-treated with Indomethacin co-treated with 1-Methyl-3-isobutylxanthine]] which results in decreased expression of CEBPA mRNA more ... CTD PMID:20206132 more ... Ins2 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of INS2 mRNA CTD PMID:32128977 Ins2 Rat indometacin multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein co-treated with Indomethacin] results in increased expression of ADIPOQ mRNA more ... CTD PMID:27605626 more ... Ins2 Rat indometacin decreases secretion ISO INS (Homo sapiens) 6480464 Indomethacin results in decreased secretion of INS protein CTD PMID:10909992 Ins2 Rat inositol multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Inositol analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of Inositol analog CTD PMID:26820058 Ins2 Rat isoflavones affects expression EXP 6480464 Isoflavones affects the expression of INS2 mRNA CTD PMID:18522411 Ins2 Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of INS protein CTD PMID:1129332 Ins2 Rat isoprenaline affects expression EXP 6480464 Isoproterenol affects the expression of INS protein CTD PMID:1170870 Ins2 Rat isoprenaline multiple interactions EXP 6480464 INS protein inhibits the reaction [Isoproterenol results in increased phosphorylation of PRKAA1 protein] and OPC 3911 inhibits the reaction [INS protein inhibits the reaction [Isoproterenol results in increased phosphorylation of PRKAA1 protein]] CTD PMID:19167487 Ins2 Rat isopropyl palmitate multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of isopropyl palmitate analog CTD PMID:26820058 Ins2 Rat kynurenic acid multiple interactions ISO INS (Homo sapiens) 6480464 Kynurenic Acid inhibits the reaction [[INS protein co-treated with Glucose] results in decreased chemical synthesis of Nitric Oxide] and Kynurenic Acid inhibits the reaction [[INS protein co-treated with Glucose] results in decreased expression of SLC2A3 protein] CTD PMID:28951307 Ins2 Rat L-ascorbic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of ABCA1 mRNA more ... CTD PMID:23403016 and PMID:25932594 Ins2 Rat L-ascorbic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA more ... CTD PMID:32473317 Ins2 Rat L-cystathionine multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of Cystathionine analog CTD PMID:26820058 Ins2 Rat lanthanum atom decreases response to substance ISO INS (Homo sapiens) 6480464 Lanthanum results in decreased susceptibility to INS protein CTD PMID:22031853 Ins2 Rat lercanidipine decreases expression ISO INS (Homo sapiens) 6480464 lercanidipine results in decreased expression of INS protein CTD PMID:17220028 Ins2 Rat Licarin A multiple interactions ISO Ins2 (Mus musculus) 6480464 [licarin A affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in decreased expression of DNM1L mRNA more ... CTD PMID:29288687 Ins2 Rat lipoic acid multiple interactions ISO INS (Homo sapiens) 6480464 Thioctic Acid inhibits the reaction [Glucose results in increased expression of INS protein] CTD PMID:16505238 Ins2 Rat lipopolysaccharide multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [Lipopolysaccharides results in increased abundance of Fatty Acids more ... CTD PMID:20699433 Ins2 Rat lithocholic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Lithocholic Acid co-treated with Glucose] results in increased secretion of INS protein CTD PMID:23022524 Ins2 Rat lovastatin multiple interactions EXP 6480464 Lovastatin promotes the reaction [INS protein results in increased phosphorylation of IGF1R protein] and Lovastatin promotes the reaction [INS protein results in increased phosphorylation of INSR protein] CTD PMID:19741129 Ins2 Rat LY294002 multiple interactions ISO INS (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [INS protein results in decreased susceptibility to sodium arsenite] more ... CTD PMID:17550345 more ... Ins2 Rat LY294002 multiple interactions ISO Ins2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose]] CTD PMID:28163246 Ins2 Rat magnesium atom multiple interactions ISO INS (Homo sapiens) 6480464 [Magnesium co-treated with INS protein] results in increased phosphorylation of and results in increased activity of INSR protein more ... CTD PMID:2542339 Ins2 Rat magnesium oxide multiple interactions ISO INS (Homo sapiens) 6480464 [Selenium analog co-treated with Magnesium Oxide analog] inhibits the reaction [Diazinon results in decreased secretion of INS protein alternative form] more ... CTD PMID:27920530 Ins2 Rat Magnolol multiple interactions EXP 6480464 magnolol inhibits the reaction [Pyruvaldehyde results in decreased expression of INS2 mRNA] CTD PMID:28919305 Ins2 Rat manganese atom multiple interactions ISO INS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] inhibits the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:2542339 and PMID:31555879 Ins2 Rat manganese(0) multiple interactions ISO INS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] inhibits the reaction [Glucose results in increased secretion of INS protein] more ... CTD PMID:2542339 and PMID:31555879 Ins2 Rat manganese(II) chloride multiple interactions ISO INS (Homo sapiens) 6480464 [manganese chloride results in increased abundance of Manganese] inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:31555879 Ins2 Rat Melengestrol acetate multiple interactions ISO INS (Homo sapiens) 6480464 [Melengestrol Acetate co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein more ... CTD PMID:29782964 Ins2 Rat mercaptopurine decreases expression EXP 6480464 Mercaptopurine results in decreased expression of INS2 mRNA CTD PMID:23358152 Ins2 Rat metformin multiple interactions ISO INS (Homo sapiens) 6480464 [Metformin co-treated with INS protein] results in decreased expression of IGF1R mRNA more ... CTD PMID:15531508 more ... Ins2 Rat metformin increases expression ISO INS (Homo sapiens) 6480464 Metformin results in increased expression of INS mRNA CTD PMID:15531508 Ins2 Rat metformin decreases expression ISO INS (Homo sapiens) 6480464 Metformin results in decreased expression of INS protein CTD PMID:1900072 and PMID:21779873 Ins2 Rat methadone decreases response to substance ISO INS (Homo sapiens) 6480464 Methadone results in decreased susceptibility to INS protein CTD PMID:2554359 Ins2 Rat methotrexate decreases expression ISO INS (Homo sapiens) 6480464 Methotrexate results in decreased expression of INS mRNA CTD PMID:17400583 Ins2 Rat methyl dihydrogen phosphate multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of methylphosphate analog CTD PMID:26820058 Ins2 Rat methylarsonite multiple interactions ISO Ins2 (Mus musculus) 6480464 methylarsonite inhibits the reaction [INS protein results in decreased activity of PYGL protein] and methylarsonite inhibits the reaction [INS protein results in increased activity of GYS2 protein] CTD PMID:28952001 Ins2 Rat methylglyoxal multiple interactions EXP 6480464 magnolol inhibits the reaction [Pyruvaldehyde results in decreased expression of INS2 mRNA] CTD PMID:28919305 Ins2 Rat methylglyoxal decreases expression EXP 6480464 Pyruvaldehyde results in decreased expression of INS2 mRNA CTD PMID:28919305 Ins2 Rat metoclopramide multiple interactions ISO INS (Homo sapiens) 6480464 Dopamine promotes the reaction [Metoclopramide results in increased expression of INS protein] CTD PMID:18645345 Ins2 Rat metoclopramide increases expression ISO INS (Homo sapiens) 6480464 Metoclopramide results in increased expression of INS protein CTD PMID:18645345 Ins2 Rat microcystin-LR multiple interactions ISO INS (Homo sapiens) 6480464 cyanoginosin LR inhibits the reaction [INS protein results in decreased phosphorylation of and results in increased activity of GYS1 protein] more ... CTD PMID:28984034 Ins2 Rat mifepristone multiple interactions ISO INS (Homo sapiens) 6480464 [Mifepristone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein more ... CTD PMID:29782964 Ins2 Rat miquelianin multiple interactions ISO INS (Homo sapiens) 6480464 quercetin 3-O-glucuronide inhibits the reaction [Palmitates inhibits the reaction [INS protein results in increased chemical synthesis of Nitric Oxide]] more ... CTD PMID:23504962 Ins2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO INS (Homo sapiens) 6480464 [mono-(2-ethylhexyl)phthalate results in decreased activity of INS protein] which results in decreased phosphorylation of GSK3B protein more ... CTD PMID:31228551 Ins2 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Ins2 (Mus musculus) 6480464 mono-(2-ethylhexyl)phthalate inhibits the reaction [INS protein results in increased expression of and results in increased phosphorylation of AKT1 protein] more ... CTD PMID:31009676 Ins2 Rat mono(2-ethylhexyl) phthalate decreases activity ISO INS (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased activity of INS protein CTD PMID:31228551 Ins2 Rat monosodium L-glutamate multiple interactions ISO Ins2 (Mus musculus) 6480464 [Fats more ... CTD PMID:23783067 Ins2 Rat Moxonidine decreases expression ISO INS (Homo sapiens) 6480464 moxonidine results in decreased expression of INS protein CTD PMID:16700870 Ins2 Rat Moxonidine decreases secretion EXP 6480464 moxonidine results in decreased secretion of INS protein CTD PMID:15071362 Ins2 Rat N,N-diethyl-m-toluamide multiple interactions ISO INS (Homo sapiens) 6480464 [fipronil co-treated with DEET] results in decreased expression of INS mRNA CTD PMID:27091632 Ins2 Rat N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide multiple interactions ISO Ins2 (Mus musculus) 6480464 [N-(2-(4-bromocinnamylamino)ethyl)-5-isoquinolinesulfonamide affects the susceptibility to [INS protein co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone]] which results in decreased expression of PLIN2 protein more ... CTD PMID:29288687 Ins2 Rat N-acetyl-L-cysteine multiple interactions ISO INS (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Glucose results in increased expression of INS protein] and Acetylcysteine inhibits the reaction [tributyltin promotes the reaction [Glucose results in increased secretion of INS protein]] CTD PMID:16505238 and PMID:28180948 Ins2 Rat N-acetyl-L-cysteine multiple interactions EXP 6480464 Acetylcysteine inhibits the reaction [[INS co-treated with Acrylamide] results in increased expression of HSPA5 protein] more ... CTD PMID:21888768 and PMID:38604440 Ins2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO INS (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [L-4F peptide inhibits the reaction [INS protein results in increased expression of HIF1A protein]] CTD PMID:22537771 Ins2 Rat N-ethyl-N-nitrosourea increases mutagenesis ISO Ins2 (Mus musculus) 6480464 Ethylnitrosourea results in increased mutagenesis of INS2 gene CTD PMID:18056790 Ins2 Rat N-methyl-4-phenylpyridinium multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of BCL2 protein] more ... CTD PMID:26364587 Ins2 Rat N-methylnicotinate multiple interactions ISO Ins2 (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE mRNA]] more ... CTD PMID:29211853 Ins2 Rat N-Phenylmaleimide multiple interactions ISO INS (Homo sapiens) 6480464 N-phenylmaleimide analog inhibits the reaction [P4HB protein results in increased reduction of INS protein] CTD PMID:23384038 Ins2 Rat nateglinide increases secretion ISO INS (Homo sapiens) 6480464 nateglinide results in increased secretion of INS protein CTD PMID:16403453 Ins2 Rat neomycin multiple interactions EXP 6480464 Neomycin inhibits the reaction [INS protein results in increased uptake of cobaltous chloride] CTD PMID:14622148 Ins2 Rat nicotinamide multiple interactions ISO INS (Homo sapiens) 6480464 Niacinamide inhibits the reaction [Glucose inhibits the reaction [MAFA protein binds to INS promoter]] more ... CTD PMID:16505238 Ins2 Rat nicotine increases expression EXP 6480464 Nicotine results in increased expression of INS2 mRNA CTD PMID:20426880 Ins2 Rat nitric oxide increases chemical synthesis ISO INS (Homo sapiens) 6480464 INS protein results in increased chemical synthesis of Nitric Oxide CTD PMID:23504962 Ins2 Rat nitric oxide decreases secretion ISO INS (Homo sapiens) 6480464 INS protein results in decreased secretion of Nitric Oxide CTD PMID:26364587 Ins2 Rat nitric oxide increases secretion ISO INS (Homo sapiens) 6480464 INS protein results in increased secretion of Nitric Oxide CTD PMID:20960276 Ins2 Rat nitric oxide multiple interactions ISO INS (Homo sapiens) 6480464 [INS protein co-treated with Glucose] results in decreased chemical synthesis of Nitric Oxide more ... CTD PMID:20960276 more ... Ins2 Rat norethisterone multiple interactions ISO INS (Homo sapiens) 6480464 Norethindrone inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and Norethindrone inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein] CTD PMID:29782964 Ins2 Rat norgestrel multiple interactions ISO INS (Homo sapiens) 6480464 [Norgestrel co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein more ... CTD PMID:29782964 Ins2 Rat norwogonin increases response to substance ISO INS (Homo sapiens) 6480464 norwogonin results in increased susceptibility to INS protein CTD PMID:28854906 Ins2 Rat NS-398 multiple interactions ISO INS (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide promotes the reaction [Arachidonic Acid results in increased secretion of INS protein] and N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide promotes the reaction [Glucose results in increased secretion of INS protein] CTD PMID:17192482 Ins2 Rat NS-398 increases secretion ISO INS (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide results in increased secretion of INS protein CTD PMID:17192482 Ins2 Rat ochratoxin A multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [ochratoxin A results in decreased phosphorylation of AKT1 protein] and INS protein inhibits the reaction [ochratoxin A results in decreased phosphorylation of MTOR protein] CTD PMID:30287338 Ins2 Rat octadecanoic acid multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [stearic acid results in decreased expression of CYP3A4 mRNA] more ... CTD PMID:26739624 Ins2 Rat octadecanoic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of stearic acid analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of stearic acid analog CTD PMID:26820058 Ins2 Rat octocrylene multiple interactions ISO INS (Homo sapiens) 6480464 octocrylene inhibits the reaction [Pioglitazone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased secretion of ADIPOQ protein]] more ... CTD PMID:34864131 Ins2 Rat octreotide affects secretion ISO INS (Homo sapiens) 6480464 Octreotide affects the secretion of INS protein CTD PMID:2111918 Ins2 Rat octreotide decreases secretion EXP 6480464 Octreotide results in decreased secretion of INS protein CTD PMID:8261660 Ins2 Rat octreotide multiple interactions ISO INS (Homo sapiens) 6480464 Octreotide inhibits the reaction [Hydrocortisone results in increased expression of INS protein] CTD PMID:7792821 and PMID:7917157 Ins2 Rat octreotide decreases secretion ISO INS (Homo sapiens) 6480464 Octreotide results in decreased secretion of INS protein CTD PMID:8422773 Ins2 Rat octreotide decreases expression ISO INS (Homo sapiens) 6480464 Octreotide results in decreased expression of INS protein CTD PMID:7493436 and PMID:7917157 Ins2 Rat olanzapine increases secretion ISO INS (Homo sapiens) 6480464 olanzapine results in increased secretion of INS protein CTD PMID:11769361 Ins2 Rat olanzapine increases expression ISO INS (Homo sapiens) 6480464 olanzapine results in increased expression of INS protein CTD PMID:11927762 more ... Ins2 Rat oleanolic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Oleanolic Acid co-treated with Glucose] results in increased secretion of INS protein CTD PMID:23022524 Ins2 Rat oleic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Oleic Acid co-treated with INS protein] results in increased expression of SERPINE1 mRNA more ... CTD PMID:11292061 Ins2 Rat oleic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [[Dexamethasone co-treated with INS protein co-treated with 1-Methyl-3-isobutylxanthine] co-treated with alitretinoin] results in increased uptake of Oleic Acid CTD PMID:10777552 Ins2 Rat oltipraz multiple interactions ISO Ins2 (Mus musculus) 6480464 oltipraz affects the reaction [trigonelline affects the reaction [INS2 protein affects the expression of ACE mRNA]] more ... CTD PMID:29211853 Ins2 Rat orlistat multiple interactions ISO INS (Homo sapiens) 6480464 [Orlistat co-treated with Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of NFE2L2 mRNA more ... CTD PMID:33476690 Ins2 Rat orlistat affects expression ISO INS (Homo sapiens) 6480464 orlistat affects the expression of INS protein CTD PMID:10095983 Ins2 Rat orlistat increases expression ISO INS (Homo sapiens) 6480464 orlistat results in increased expression of INS protein CTD PMID:12915676 Ins2 Rat orlistat decreases expression ISO INS (Homo sapiens) 6480464 orlistat results in decreased expression of INS protein CTD PMID:11274935 Ins2 Rat orotic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Orotic Acid inhibits the reaction [INS protein results in increased phosphorylation of NOS3 protein]] which results in decreased abundance of Nitric Oxide more ... CTD PMID:25601987 Ins2 Rat oxybenzone multiple interactions ISO INS (Homo sapiens) 6480464 oxybenzone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of ADIPOQ mRNA] more ... CTD PMID:34864131 Ins2 Rat palmitoleic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of palmitoleic acid analog CTD PMID:26820058 Ins2 Rat paracetamol multiple interactions ISO INS (Homo sapiens) 6480464 INS protein affects the reaction [Acetaminophen results in decreased abundance of Glutathione] and INS protein inhibits the reaction [Acetaminophen results in decreased abundance of Adenosine Triphosphate] CTD PMID:26739624 Ins2 Rat paroxetine multiple interactions EXP 6480464 Paroxetine affects the reaction [INS protein affects the phosphorylation of IRS1 protein] and pyrazolanthrone inhibits the reaction [Paroxetine affects the reaction [INS protein affects the phosphorylation of IRS1 protein]] CTD PMID:17728140 Ins2 Rat Pentagastrin increases secretion ISO INS (Homo sapiens) 6480464 Pentagastrin results in increased secretion of INS protein alternative form CTD PMID:12073167 Ins2 Rat pentolinium tartrate multiple interactions ISO INS (Homo sapiens) 6480464 Pentolinium Tartrate inhibits the reaction [Epinephrine results in decreased secretion of INS protein] CTD PMID:1218171 Ins2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 perfluorooctane sulfonic acid promotes the reaction [INS protein results in increased uptake of Glucose] CTD PMID:26548598 Ins2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO INS (Homo sapiens) 6480464 perfluorooctane sulfonic acid promotes the reaction [Glucose results in increased secretion of INS protein] and perfluorooctane sulfonic acid results in increased expression of and results in increased secretion of INS protein CTD PMID:35457000 Ins2 Rat perfluorooctane-1-sulfonic acid increases expression ISO Ins2 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of INS2 mRNA CTD PMID:35457000 Ins2 Rat perfluorooctanoic acid decreases secretion ISO INS (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased secretion of INS protein CTD PMID:35563431 Ins2 Rat perfluorooctanoic acid multiple interactions ISO INS (Homo sapiens) 6480464 perfluorooctanoic acid inhibits the reaction [Glucose results in increased secretion of INS protein] CTD PMID:35563431 Ins2 Rat permethrin multiple interactions ISO INS (Homo sapiens) 6480464 [Permethrin co-treated with INS protein] results in increased phosphorylation of IRS1 protein more ... CTD PMID:28866332 Ins2 Rat phenobarbital multiple interactions EXP 6480464 INS protein affects the reaction [Phenobarbital results in increased expression of CYP2B1 mRNA] and INS protein affects the reaction [Phenobarbital results in increased expression of CYP3A23-3A1 mRNA] CTD PMID:10215695 Ins2 Rat phenylarsine oxide multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [oxophenylarsine inhibits the reaction [INS protein results in decreased phosphorylation of SLC2A4 protein]] more ... CTD PMID:8048502 Ins2 Rat phenylarsonous acid multiple interactions ISO INS (Homo sapiens) 6480464 phenylarsonous acid analog inhibits the reaction [P4HB protein results in increased reduction of INS protein] CTD PMID:23384038 Ins2 Rat PhIP multiple interactions ISO Ins2 (Mus musculus) 6480464 [2-amino-1-methyl-6-phenylimidazo(4 more ... CTD PMID:11751460 Ins2 Rat phloretin multiple interactions ISO INS (Homo sapiens) 6480464 Phloretin inhibits the reaction [[chromic chloride results in increased activity of INS protein modified form] which results in increased secretion of Adenosine Triphosphate] CTD PMID:17965850 Ins2 Rat phosphoric acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of phosphoric acid analog more ... CTD PMID:26820058 Ins2 Rat pioglitazone multiple interactions ISO Ins2 (Mus musculus) 6480464 [Dexamethasone co-treated with INS protein co-treated with Pioglitazone] results in increased expression of PPARG protein more ... CTD PMID:15273253 more ... Ins2 Rat pioglitazone multiple interactions ISO INS (Homo sapiens) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [Pioglitazone promotes the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased secretion of ADIPOQ protein]] more ... CTD PMID:17290005 more ... Ins2 Rat potassium chloride multiple interactions ISO INS (Homo sapiens) 6480464 sodium arsenite promotes the reaction [Potassium Chloride results in increased secretion of INS protein] CTD PMID:20100676 Ins2 Rat prallethrin multiple interactions ISO Ins2 (Mus musculus) 6480464 d more ... CTD PMID:32473317 Ins2 Rat prednisone multiple interactions ISO INS (Homo sapiens) 6480464 [Prednisone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein and [Prednisone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein CTD PMID:29782964 Ins2 Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of INS2 mRNA CTD PMID:21770760 Ins2 Rat propranolol multiple interactions ISO INS (Homo sapiens) 6480464 Propranolol inhibits the reaction [Epinephrine results in decreased expression of INS protein] CTD PMID:6018752 Ins2 Rat propranolol decreases expression ISO INS (Homo sapiens) 6480464 Propranolol results in decreased expression of INS protein CTD PMID:3019152 Ins2 Rat Ptaquiloside decreases expression ISO Ins2 (Mus musculus) 6480464 ptaquiloside results in decreased expression of INS2 mRNA CTD PMID:23274088 Ins2 Rat purine-6-thiol decreases expression EXP 6480464 Mercaptopurine results in decreased expression of INS2 mRNA CTD PMID:23358152 Ins2 Rat pyridine multiple interactions EXP 6480464 INS protein affects the reaction [pyridine results in increased expression of CYP2B1 mRNA] more ... CTD PMID:10215695 Ins2 Rat pyruvic acid multiple interactions EXP 6480464 INS protein inhibits the reaction [Pyruvic Acid results in increased secretion of GCG protein] CTD PMID:15919803 Ins2 Rat quercetin multiple interactions ISO INS (Homo sapiens) 6480464 [2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one co-treated with Quercetin] inhibits the reaction [INS protein results in increased phosphorylation of AKT1 protein] more ... CTD PMID:16505238 more ... Ins2 Rat quercetin increases response to substance ISO INS (Homo sapiens) 6480464 INS protein results in increased susceptibility to Quercetin CTD PMID:28854906 Ins2 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Fructose results in increased expression of INS2 mRNA] and Quercetin inhibits the reaction [INS protein results in increased uptake of Glucose] CTD PMID:23533474 and PMID:8725009 Ins2 Rat quinoxyfen multiple interactions ISO Ins2 (Mus musculus) 6480464 quinoxyfen inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of BGLAP mRNA] and quinoxyfen inhibits the reaction [[Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein] results in increased expression of SP7 mRNA] CTD PMID:32473317 Ins2 Rat rac-lactic acid increases secretion ISO INS (Homo sapiens) 6480464 INS protein results in increased secretion of Lactic Acid CTD PMID:25720493 Ins2 Rat RES-701-1 multiple interactions ISO INS (Homo sapiens) 6480464 RES 701-1 affects the reaction [sodium arsenite inhibits the reaction [[Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of ADIPOQ mRNA]] CTD PMID:23152186 Ins2 Rat resveratrol multiple interactions ISO INS (Homo sapiens) 6480464 6-chloro-2 more ... CTD PMID:15297429 more ... Ins2 Rat resveratrol decreases expression ISO Ins2 (Mus musculus) 6480464 resveratrol results in decreased expression of INS protein CTD PMID:21945106 Ins2 Rat resveratrol increases response to substance ISO Ins2 (Mus musculus) 6480464 resveratrol results in increased susceptibility to INS protein CTD PMID:21945106 Ins2 Rat resveratrol multiple interactions ISO Ins2 (Mus musculus) 6480464 resveratrol inhibits the reaction [3 more ... CTD PMID:24231106 Ins2 Rat resveratrol increases expression ISO INS (Homo sapiens) 6480464 resveratrol results in increased expression of INS protein CTD PMID:23536519 Ins2 Rat resveratrol decreases response to substance ISO INS (Homo sapiens) 6480464 INS protein results in decreased susceptibility to resveratrol and resveratrol results in decreased susceptibility to INS protein CTD PMID:15297429 and PMID:20015842 Ins2 Rat rifampicin multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [[Rifampin co-treated with NR1I2 protein] results in increased expression of G6PC1 mRNA] CTD PMID:24204015 Ins2 Rat rifampicin multiple interactions ISO Ins2 (Mus musculus) 6480464 Rifampin inhibits the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Rosiglitazone co-treated with Indomethacin] results in increased expression of CEBPA mRNA] more ... CTD PMID:33412187 Ins2 Rat rimonabant decreases expression ISO Ins2 (Mus musculus) 6480464 Rimonabant results in decreased expression of INS protein CTD PMID:20110567 Ins2 Rat risperidone increases expression ISO INS (Homo sapiens) 6480464 Risperidone results in increased expression of INS protein CTD PMID:11927762 and PMID:16601995 Ins2 Rat ritodrine increases expression ISO INS (Homo sapiens) 6480464 Ritodrine results in increased expression of INS protein CTD PMID:356601 more ... Ins2 Rat Ro 41-5253 multiple interactions ISO INS (Homo sapiens) 6480464 [Dexamethasone co-treated with INS protein co-treated with Ro 41-5253] results in increased expression of PPARG protein CTD PMID:17290005 Ins2 Rat Ro 41-5253 multiple interactions ISO Ins2 (Mus musculus) 6480464 [Dexamethasone co-treated with INS protein co-treated with Ro 41-5253] results in increased expression of PPARG protein CTD PMID:17290005 Ins2 Rat rosmarinic acid multiple interactions ISO INS (Homo sapiens) 6480464 [Rosmarinic Acid co-treated with Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of NFE2L2 mRNA more ... CTD PMID:33476690 Ins2 Rat Rutamarin multiple interactions ISO Ins2 (Mus musculus) 6480464 rutamarin promotes the reaction [INS protein results in increased phosphorylation of AKT1 protein] and rutamarin promotes the reaction [INS protein results in increased phosphorylation of INSR protein] CTD PMID:22384078 Ins2 Rat ruthenium red multiple interactions EXP 6480464 Ruthenium Red inhibits the reaction [INS protein results in increased uptake of cobaltous chloride] CTD PMID:14622148 Ins2 Rat saquinavir multiple interactions ISO INS (Homo sapiens) 6480464 Saquinavir inhibits the reaction [INS protein results in increased import of Glucose] CTD PMID:11786383 Ins2 Rat saroglitazar multiple interactions ISO INS (Homo sapiens) 6480464 saroglitazar affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:32613381 Ins2 Rat SB 203580 multiple interactions ISO INS (Homo sapiens) 6480464 [SB 203580 co-treated with INS protein] inhibits the reaction [Glucose affects the localization of PDX1 protein] CTD PMID:11574405 Ins2 Rat SB 203580 multiple interactions EXP 6480464 SB 203580 inhibits the reaction [conophylline results in increased expression of INS protein] CTD PMID:14568228 Ins2 Rat sebacic acid multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of sebacic acid analog and [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] results in increased abundance of sebacic acid analog CTD PMID:26820058 Ins2 Rat selenium atom multiple interactions ISO INS (Homo sapiens) 6480464 [Selenium analog co-treated with Magnesium Oxide analog] inhibits the reaction [Diazinon results in decreased secretion of INS protein alternative form] more ... CTD PMID:27920530 Ins2 Rat sertraline multiple interactions EXP 6480464 Sertraline affects the reaction [INS protein affects the phosphorylation of IRS1 protein] and Sertraline inhibits the reaction [INS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] CTD PMID:17728140 Ins2 Rat sirolimus multiple interactions ISO INS (Homo sapiens) 6480464 Sirolimus inhibits the reaction [cyanoginosin LR promotes the reaction [INS protein results in increased expression of RPS6KB1 protein modified form]] more ... CTD PMID:20936651 more ... Ins2 Rat SKF-96365 hydrochloride decreases response to substance ISO INS (Homo sapiens) 6480464 1-(2-(3-(4-methoxyphenyl)propoxy)-4-methoxyphenylethyl)-1H-imidazole results in decreased susceptibility to INS protein CTD PMID:22031853 Ins2 Rat sodium arsenite multiple interactions ISO INS (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [INS protein results in decreased susceptibility to sodium arsenite] more ... CTD PMID:20100676 more ... Ins2 Rat sodium arsenite decreases expression ISO Ins2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of INS2 mRNA CTD PMID:37682722 Ins2 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of INS2 mRNA and sodium arsenite results in decreased expression of INS2 protein CTD PMID:32531573 Ins2 Rat sodium arsenite decreases activity ISO INS (Homo sapiens) 6480464 sodium arsenite results in decreased activity of INS protein CTD PMID:29526746 Ins2 Rat sodium arsenite multiple interactions ISO Ins2 (Mus musculus) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of INS2 protein more ... CTD PMID:21396911 and PMID:32226249 Ins2 Rat sodium arsenite decreases response to substance ISO INS (Homo sapiens) 6480464 INS protein results in decreased susceptibility to sodium arsenite and sodium arsenite results in decreased susceptibility to INS protein CTD PMID:25982963 and PMID:37956786 Ins2 Rat sodium dichromate increases expression ISO Ins2 (Mus musculus) 6480464 sodium bichromate results in increased expression of INS2 mRNA CTD PMID:22155349 Ins2 Rat Sodium oleate multiple interactions ISO INS (Homo sapiens) 6480464 (R)-2-(3-((benzoxazol-2-yl-d4 (3-(4-methoxyphenoxy-d7)propyl)amino)methyl)phenoxy) butanoic acid affects the reaction [[osteum co-treated with Palmitic Acid co-treated with Glucose co-treated with INS protein co-treated with TNF protein co-treated with IL1B protein co-treated with TNF protein] affects the expression of CPT1A mRNA] more ... CTD PMID:32613381 Ins2 Rat Sodium salicylate multiple interactions ISO INS (Homo sapiens) 6480464 Sodium Salicylate inhibits the reaction [Palmitates inhibits the reaction [INS protein results in increased chemical synthesis of Nitric Oxide]] more ... CTD PMID:23504962 Ins2 Rat spironolactone multiple interactions ISO INS (Homo sapiens) 6480464 Spironolactone inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and Spironolactone inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein] CTD PMID:29782964 Ins2 Rat staurosporine multiple interactions EXP 6480464 Staurosporine inhibits the reaction [INS protein results in increased uptake of cobaltous chloride] CTD PMID:14622148 Ins2 Rat streptozocin multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [Streptozocin results in decreased expression of NES mRNA] more ... CTD PMID:19388005 and PMID:25808216 Ins2 Rat streptozocin multiple interactions ISO Ins2 (Mus musculus) 6480464 [Dietary Fats co-treated with Streptozocin] results in decreased expression of INS2 mRNA more ... CTD PMID:15066220 more ... Ins2 Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of INS protein CTD PMID:11216864 Ins2 Rat streptozocin multiple interactions EXP 6480464 [Berberine co-treated with Streptozocin] results in increased secretion of INS protein more ... CTD PMID:15066220 more ... Ins2 Rat sucrose increases expression ISO INS (Homo sapiens) 6480464 Sucrose results in increased expression of INS protein CTD PMID:1805284 Ins2 Rat sulforaphane multiple interactions ISO INS (Homo sapiens) 6480464 sulforaphane inhibits the reaction [INS protein results in increased phosphorylation of RPS6 protein] CTD PMID:28790194 Ins2 Rat sulpiride increases expression ISO INS (Homo sapiens) 6480464 Sulpiride results in increased expression of INS protein CTD PMID:16601995 Ins2 Rat tacrolimus hydrate decreases expression ISO INS (Homo sapiens) 6480464 Tacrolimus results in decreased expression of INS protein CTD PMID:17391142 Ins2 Rat tauroursodeoxycholic acid multiple interactions ISO INS (Homo sapiens) 6480464 ursodoxicoltaurine inhibits the reaction [Glucosamine inhibits the reaction [INS results in increased uptake of Deoxyglucose]] CTD PMID:20165829 Ins2 Rat telmisartan decreases expression ISO INS (Homo sapiens) 6480464 telmisartan results in decreased expression of INS protein CTD PMID:15892894 Ins2 Rat terbutaline multiple interactions ISO INS (Homo sapiens) 6480464 Atenolol inhibits the reaction [Terbutaline results in increased expression of INS protein] more ... CTD PMID:12795776 and PMID:2563217 Ins2 Rat terbutaline increases expression ISO INS (Homo sapiens) 6480464 Terbutaline results in increased expression of INS protein CTD PMID:12795776 more ... Ins2 Rat testosterone multiple interactions ISO INS (Homo sapiens) 6480464 Testosterone promotes the reaction [INS protein results in decreased oxidation of Palmitates] and Testosterone promotes the reaction [INS protein results in increased chemical synthesis of Glycogen] CTD PMID:21632903 Ins2 Rat testosterone decreases abundance EXP 6480464 INS protein results in decreased abundance of Testosterone CTD PMID:28300557 Ins2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of INS2 mRNA and NR0B1 protein promotes the reaction [INS protein results in decreased abundance of Testosterone] CTD PMID:26496021 and PMID:28300557 Ins2 Rat testosterone increases expression ISO INS (Homo sapiens) 6480464 Testosterone results in increased expression of INS protein CTD PMID:9851674 Ins2 Rat thapsigargin multiple interactions ISO INS (Homo sapiens) 6480464 Thapsigargin inhibits the reaction [Glucose results in increased secretion of INS protein alternative form] CTD PMID:31776611 Ins2 Rat Thiocarbohydrazide multiple interactions ISO INS (Homo sapiens) 6480464 thiocarbohydrazide inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein] and thiocarbohydrazide inhibits the reaction [[Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein] CTD PMID:29782964 Ins2 Rat tolbutamide multiple interactions ISO INS (Homo sapiens) 6480464 ABCC8 gene SNP inhibits the reaction [Tolbutamide results in increased secretion of INS protein] CTD PMID:9568693 Ins2 Rat tolbutamide increases secretion ISO INS (Homo sapiens) 6480464 Tolbutamide results in increased secretion of INS protein CTD PMID:9032110 and PMID:9568693 Ins2 Rat tolylfluanid multiple interactions ISO INS (Homo sapiens) 6480464 N-dichlorofluoromethylthio-N' more ... CTD PMID:29782964 Ins2 Rat triamcinolone multiple interactions ISO INS (Homo sapiens) 6480464 [Triamcinolone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of and results in increased secretion of ADIPOQ protein and [Triamcinolone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS protein] results in increased expression of FABP4 protein CTD PMID:29782964 Ins2 Rat tributylstannane multiple interactions ISO Ins2 (Mus musculus) 6480464 tributyltin promotes the reaction [[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine] results in increased abundance of Triglycerides] more ... CTD PMID:22197818 Ins2 Rat tributylstannane increases expression ISO Ins2 (Mus musculus) 6480464 tributyltin results in increased expression of INS2 mRNA CTD PMID:31306684 Ins2 Rat tributylstannane multiple interactions ISO INS (Homo sapiens) 6480464 [tributyltin co-treated with [Ascorbic Acid co-treated with beta-glycerophosphoric acid co-treated with Dexamethasone co-treated with INS protein]] results in increased expression of ABCA1 mRNA more ... CTD PMID:25932594 more ... Ins2 Rat triciribine multiple interactions ISO INS (Homo sapiens) 6480464 triciribine inhibits the reaction [INS protein results in decreased susceptibility to sodium arsenite] CTD PMID:25982963 Ins2 Rat triclosan increases expression EXP 6480464 Triclosan results in increased expression of INS2 mRNA CTD PMID:30447264 Ins2 Rat triflumizole multiple interactions ISO INS (Homo sapiens) 6480464 [triflumizol co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with Indomethacin co-treated with INS protein] results in increased expression of ADIPOQ mRNA more ... CTD PMID:23086663 Ins2 Rat trimethyltin multiple interactions EXP 6480464 [trimethyltin chloride results in increased abundance of trimethyltin] promotes the reaction [INS protein affects the expression of NEFH mRNA] and INS protein affects the reaction [[trimethyltin chloride results in increased abundance of trimethyltin] which results in increased expression of HSD11B1 mRNA] CTD PMID:30993381 Ins2 Rat triphenyl phosphate multiple interactions ISO Ins2 (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose]] and triphenyl phosphate promotes the reaction [INS protein results in increased import of Glucose] CTD PMID:28163246 Ins2 Rat triphenyl phosphate affects expression ISO INS (Homo sapiens) 6480464 triphenyl phosphate affects the expression of INS protein CTD PMID:35563431 Ins2 Rat triphenyl phosphate increases secretion ISO INS (Homo sapiens) 6480464 triphenyl phosphate results in increased secretion of INS protein CTD PMID:35563431 Ins2 Rat triphenyl phosphate multiple interactions ISO INS (Homo sapiens) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with INS protein co-treated with triphenyl phosphate analog] results in increased expression of FABP4 mRNA] more ... CTD PMID:28437481 and PMID:35563431 Ins2 Rat troglitazone multiple interactions ISO INS (Homo sapiens) 6480464 2-chloro-5-nitrobenzanilide inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with INS protein co-treated with Troglitazone] results in increased expression of FABP4 mRNA] more ... CTD PMID:11292061 more ... Ins2 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of INS2 mRNA CTD PMID:12914525 Ins2 Rat troglitazone decreases expression ISO INS (Homo sapiens) 6480464 troglitazone results in decreased expression of INS protein CTD PMID:10406828 more ... Ins2 Rat troglitazone increases response to substance ISO INS (Homo sapiens) 6480464 troglitazone results in increased susceptibility to INS protein CTD PMID:8772734 Ins2 Rat undecane multiple interactions ISO Ins2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with butylbenzyl phthalate co-treated with INS protein] results in increased abundance of undecane analog CTD PMID:26820058 Ins2 Rat valproic acid increases methylation ISO INS (Homo sapiens) 6480464 Valproic Acid results in increased methylation of INS gene CTD PMID:29154799 Ins2 Rat vandetanib multiple interactions ISO INS (Homo sapiens) 6480464 INS protein inhibits the reaction [vandetanib results in decreased phosphorylation of AKT1 protein] and INS protein inhibits the reaction [vandetanib results in decreased phosphorylation of RPS6 protein] CTD PMID:23799852 Ins2 Rat vanillic acid multiple interactions ISO INS (Homo sapiens) 6480464 Vanillic Acid affects the reaction [INS protein results in increased expression of PRKCB protein] more ... CTD PMID:33651899 and PMID:36764371 Ins2 Rat vitamin D multiple interactions ISO INS (Homo sapiens) 6480464 [Vitamin D co-treated with bisphenol A co-treated with 1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS protein] affects the expression of CEBPA mRNA more ... CTD PMID:33836827 Ins2 Rat wogonin increases response to substance ISO INS (Homo sapiens) 6480464 wogonin results in increased susceptibility to INS protein CTD PMID:28854906 Ins2 Rat wortmannin multiple interactions ISO INS (Homo sapiens) 6480464 [Wortmannin co-treated with INS protein] inhibits the reaction [Glucose affects the localization of PDX1 protein] more ... CTD PMID:11574405 more ... Ins2 Rat wortmannin multiple interactions EXP 6480464 wortmannin inhibits the reaction [INS protein results in increased phosphorylation of and results in increased activity of AKT1 protein] CTD PMID:17728140 Ins2 Rat zinc atom affects binding ISO INS (Homo sapiens) 6480464 Zinc binds to INS protein and Zinc binds to INS protein binds to INS protein CTD PMID:16362452 and PMID:16969698 Ins2 Rat zinc(0) affects binding ISO INS (Homo sapiens) 6480464 Zinc binds to INS protein and Zinc binds to INS protein binds to INS protein CTD PMID:16362452 and PMID:16969698
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
acute kidney failure (ISO) Acute Liver Failure (ISO) adenoma (ISO) Albuminuria (ISO) Alzheimer's disease (IEP,ISO) Beckwith-Wiedemann syndrome (ISO) bipolar disorder (ISO) bladder disease (ISO) cardiac arrest (ISO) cholangiocarcinoma (ISO) cognitive disorder (ISO) congestive heart failure (ISO) cystic kidney disease (ISO) delta beta-thalassemia (ISO) developmental and epileptic encephalopathy (ISO) diabetes mellitus (ISO) Diabetic Cardiomyopathies (ISO) diabetic ketoacidosis (ISO) Diabetic Nephropathies (IDA,ISO) diabetic retinopathy (ISO) disease of metabolism (ISO) early infantile epileptic encephalopathy (ISO) Edema (ISO) Experimental Liver Cirrhosis (ISO) generalized dystonia (ISO) genetic disease (ISO) gestational diabetes (ISO) glucose intolerance (ISO) hepatitis (ISO) hepatocellular carcinoma (ISO) hyperglycemia (ISO) hyperinsulinism (ISO) Hyperkalemia (ISO) Hyperproinsulinemia (ISO) hypertension (IDA,ISO) Hypertriglyceridemia (ISO) hypertrophic cardiomyopathy (ISO) hyperuricemia (ISO) hypoglycemia (ISO) Hypoinsulinemia (ISO) hypokalemia (ISO) Hypotension (ISO) immunodeficiency 39 (ISO) Insulin Resistance (ISO) insulinoma (ISO) kidney disease (ISO) kidney failure (ISO) Lewy body dementia (ISO) liver disease (ISO) maturity-onset diabetes of the young (ISO,ISS) maturity-onset diabetes of the young type 1 (ISO) maturity-onset diabetes of the young type 10 (ISO) Memory Disorders (ISO) metabolic dysfunction-associated steatotic liver disease (ISO) Metabolic Syndrome (ISO) Micronuclei, Chromosome-Defective (ISO) MPTP Poisoning (ISO) muscular disease (ISO) neonatal diabetes mellitus (ISO,ISS) Neoplasm Invasiveness (ISO) neural tube defect (ISO) neuronal ceroid lipofuscinosis (ISO) obesity (ISO) osteoarthritis (ISO) pancreatic cancer (ISO) pancreatic ductal carcinoma (ISO) pancreatitis (ISO) panic disorder (ISO) Paralysis (ISO) Paresthesia (ISO) Parkinson's disease (ISO) permanent neonatal diabetes mellitus (ISO,ISS) Permanent Neonatal Diabetes Mellitus 4 (ISO) Phelan-McDermid syndrome (ISO) polycystic ovary syndrome (ISO) prostate cancer (ISO) Prostatic Neoplasms (ISO) Rhabdomyolysis (ISO) Segawa Syndrome, Autosomal Recessive (ISO) steatotic liver disease (ISO) Tachycardia (ISO) transient neonatal diabetes mellitus (ISO) type 1 diabetes mellitus (ISO,ISS) type 1 diabetes mellitus 2 (ISO) type 2 diabetes mellitus (ISO,ISS) Type 2 Diabetes Mellitus 1 (ISO) Ventricular Dysfunction, Left (ISO) Ventricular Fibrillation (ISO) Ventricular Outflow Obstruction (ISO) Weight Loss (ISO)
(R)-adrenaline (ISO) (R)-lipoic acid (ISO) (S)-nicotine (EXP) 1-Oleoyl-2-acetyl-sn-glycerol (ISO) 15-deoxy-Delta(12,14)-prostaglandin J2 (ISO) 17alpha-hydroxyprogesterone (ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,2',5,5'-tetrachlorobiphenyl (EXP) 2,2,2-tetramine (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dinitrotoluene (EXP) 2-amino-2-deoxy-D-glucopyranose (ISO) 2-arachidonoylglycerol (ISO) 2-deoxy-D-glucose (ISO) 2-hydroxypropanoic acid (ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3,7-dihydropurine-6-thione (EXP) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-aminobenzamide (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP,ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-phenylbutyric acid (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 5-iodotubercidin (ISO) 5-methyl-4-oxido-2-pyrazin-4-iumcarboxylic acid (ISO) 5-oxo-L-proline (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO) 6-Hydroxychlorzoxazone (ISO) 9-cis-retinoic acid (ISO) AACOCF3 (ISO) acetaminophen O-beta-D-glucosiduronic acid (ISO) acetic acid (ISO) acrolein (ISO) acrylamide (EXP) actinomycin D (ISO) albuterol (ISO) aldehydo-D-glucosamine (ISO) aldehydo-D-glucose (EXP,ISO) all-trans-retinoic acid (ISO) all-trans-retinol (ISO) allethrin (ISO) amino acid (ISO) amiodarone (ISO) amlodipine (ISO) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO) arachidonic acid (ISO) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) aspartame (ISO) atenolol (ISO) atorvastatin calcium (ISO) ATP (ISO) atrazine (ISO) avobenzone (ISO) bafilomycin A1 (EXP) baicalein (ISO) Bardoxolone methyl (ISO) benzene (ISO) benzo[a]pyrene (ISO) berberine (EXP) beta-D-glucosamine (ISO) bexarotene (ISO) bezafibrate (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bismuth atom (ISO) bismuthane (ISO) bisoprolol (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) boric acid (ISO) bromochloroacetic acid (ISO) bromocriptine (ISO) butan-1-amine (ISO) Butylbenzyl phthalate (ISO) Butylparaben (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) calcidiol (ISO) cannabidiolic acid (ISO) cannabigerol (ISO) cannabigerolic acid (ISO) capsaicin (EXP) capsazepine (EXP) carbamic acid (ISO) carvedilol (ISO) chlorpropamide (ISO) chlorpyrifos (EXP) chlorzoxazone (ISO) cholesterol (ISO) chromium atom (EXP) chromium(3+) trichloride (ISO) ciprofibrate (EXP) clofibrate (ISO) clonidine (ISO) clonidine (amino form) (ISO) clonidine (imino form) (ISO) clozapine (ISO) co-trimoxazole (ISO) cobalt dichloride (EXP) cocaine (ISO) conjugated linoleic acid (ISO) copper atom (ISO) copper(0) (ISO) corticosterone (ISO) corticotropin (ISO) cortisol (ISO) curcumin (EXP,ISO) cycloheximide (ISO) cyproterone acetate (ISO) D-glucose (EXP,ISO) D-mannopyranose (ISO) DDE (ISO) decabromodiphenyl ether (ISO) demethoxycurcumin (ISO) desmosterol (ISO) dexamethasone (EXP,ISO) dexamethasone phosphate (ISO) diarsenic trioxide (ISO) diazinon (ISO) diazoxide (ISO) dibenziodolium (ISO) dicamba (ISO) Didymin (ISO) diethyl maleate (ISO) diethyl sulfate (ISO) diethylstilbestrol (ISO) digoxin (EXP,ISO) dimercaprol (EXP) diphosphoric acid (ISO) disodium selenite (ISO) dopamine (ISO) elemental selenium (ISO) enalaprilat dihydrate (ISO) equilin (ISO) ethanol (ISO) ethyl dihydrogen phosphate (ISO) ethylamine (ISO) farnesol (ISO) fenofibrate (ISO) fentin hydroxide (ISO) ferric ammonium citrate (ISO) fipronil (ISO) flavonoids (EXP) folic acid (ISO) fructose (EXP,ISO) fulvestrant (ISO) furan (EXP) gatifloxacin (EXP) gemcitabine (ISO) genistein (ISO) Gingerenone A (EXP,ISO) glimepiride (ISO) glucose (EXP,ISO) glutathione (ISO) glyburide (EXP,ISO) glycerol 2-phosphate (ISO) glycine (ISO) glycogen (ISO) glyoxylic acid (ISO) glyphosate (ISO) GSK2656157 (EXP) GW 7647 (ISO) harmine (ISO) hemin (EXP) heptadecanoic acid (ISO) hexadecanoic acid (EXP,ISO) hispidulin (ISO) hydrogen peroxide (ISO) indometacin (EXP,ISO) inositol (ISO) isoflavones (EXP) isoprenaline (EXP) isopropyl palmitate (ISO) kynurenic acid (ISO) L-ascorbic acid (ISO) L-cystathionine (ISO) lanthanum atom (ISO) lercanidipine (ISO) Licarin A (ISO) lipoic acid (ISO) lipopolysaccharide (ISO) lithocholic acid (ISO) lovastatin (EXP) LY294002 (ISO) magnesium atom (ISO) magnesium oxide (ISO) Magnolol (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) Melengestrol acetate (ISO) mercaptopurine (EXP) metformin (ISO) methadone (ISO) methotrexate (ISO) methyl dihydrogen phosphate (ISO) methylarsonite (ISO) methylglyoxal (EXP) metoclopramide (ISO) microcystin-LR (ISO) mifepristone (ISO) miquelianin (ISO) mono(2-ethylhexyl) phthalate (ISO) monosodium L-glutamate (ISO) Moxonidine (EXP,ISO) N,N-diethyl-m-toluamide (ISO) N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (ISO) N-acetyl-L-cysteine (EXP,ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-ethyl-N-nitrosourea (ISO) N-methyl-4-phenylpyridinium (ISO) N-methylnicotinate (ISO) N-Phenylmaleimide (ISO) nateglinide (ISO) neomycin (EXP) nicotinamide (ISO) nicotine (EXP) nitric oxide (ISO) norethisterone (ISO) norgestrel (ISO) norwogonin (ISO) NS-398 (ISO) ochratoxin A (ISO) octadecanoic acid (ISO) octocrylene (ISO) octreotide (EXP,ISO) olanzapine (ISO) oleanolic acid (ISO) oleic acid (ISO) oltipraz (ISO) orlistat (ISO) orotic acid (ISO) oxybenzone (ISO) palmitoleic acid (ISO) paracetamol (ISO) paroxetine (EXP) Pentagastrin (ISO) pentolinium tartrate (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) permethrin (ISO) phenobarbital (EXP) phenylarsine oxide (EXP) phenylarsonous acid (ISO) PhIP (ISO) phloretin (ISO) phosphoric acid (ISO) pioglitazone (ISO) potassium chloride (ISO) prallethrin (ISO) prednisone (ISO) progesterone (EXP) propranolol (ISO) Ptaquiloside (ISO) purine-6-thiol (EXP) pyridine (EXP) pyruvic acid (EXP) quercetin (EXP,ISO) quinoxyfen (ISO) rac-lactic acid (ISO) RES-701-1 (ISO) resveratrol (ISO) rifampicin (ISO) rimonabant (ISO) risperidone (ISO) ritodrine (ISO) Ro 41-5253 (ISO) rosmarinic acid (ISO) Rutamarin (ISO) ruthenium red (EXP) saquinavir (ISO) saroglitazar (ISO) SB 203580 (EXP,ISO) sebacic acid (ISO) selenium atom (ISO) sertraline (EXP) sirolimus (ISO) SKF-96365 hydrochloride (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) Sodium oleate (ISO) Sodium salicylate (ISO) spironolactone (ISO) staurosporine (EXP) streptozocin (EXP,ISO) sucrose (ISO) sulforaphane (ISO) sulpiride (ISO) tacrolimus hydrate (ISO) tauroursodeoxycholic acid (ISO) telmisartan (ISO) terbutaline (ISO) testosterone (EXP,ISO) thapsigargin (ISO) Thiocarbohydrazide (ISO) tolbutamide (ISO) tolylfluanid (ISO) triamcinolone (ISO) tributylstannane (ISO) triciribine (ISO) triclosan (EXP) triflumizole (ISO) trimethyltin (EXP) triphenyl phosphate (ISO) troglitazone (EXP,ISO) undecane (ISO) valproic acid (ISO) vandetanib (ISO) vanillic acid (ISO) vitamin D (ISO) wogonin (ISO) wortmannin (EXP,ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
acute-phase response (ISO) alpha-beta T cell activation (ISO) biological_process (ND) ER overload response (IEA,ISO) fatty acid homeostasis (ISO) G protein-coupled receptor signaling pathway (ISO) glucose homeostasis (IBA,IEA,ISO) glucose metabolic process (IEA,ISO) glycoprotein biosynthetic process (ISO) insulin processing (IEA,ISO) insulin receptor signaling pathway (IEA,ISO) intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress (IEA,ISO) lactate biosynthetic process (ISO) lipid biosynthetic process (ISO) lipid catabolic process (IEA,ISO) lipoprotein biosynthetic process (ISO) myoblast fusion (IEA,ISO) myotube differentiation (IEA,ISO) negative regulation of acute inflammatory response (ISO) negative regulation of fatty acid metabolic process (ISO) negative regulation of feeding behavior (ISO) negative regulation of gene expression (ISO) negative regulation of gluconeogenesis (ISO) negative regulation of glycogen catabolic process (ISO) negative regulation of lipid catabolic process (ISO) negative regulation of protein catabolic process (ISO) negative regulation of protein secretion (ISO) negative regulation of reactive oxygen species biosynthetic process (ISO) negative regulation of respiratory burst involved in inflammatory response (ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) neuron projection maintenance (ISO) nitric oxide-cGMP-mediated signaling (ISO) positive regulation of canonical NF-kappaB signal transduction (ISO) positive regulation of cell migration (ISO) positive regulation of cell population proliferation (ISO) positive regulation of cytokine production (ISO) positive regulation of D-glucose import (ISO) positive regulation of dendritic spine maintenance (ISO) positive regulation of DNA replication (ISO) positive regulation of ERK1 and ERK2 cascade (IEA,ISO) positive regulation of fatty acid biosynthetic process (ISO) positive regulation of gene expression (ISO) positive regulation of glucose metabolic process (ISO) positive regulation of glycogen biosynthetic process (ISO) positive regulation of glycolytic process (ISO) positive regulation of insulin receptor signaling pathway (ISO) positive regulation of lipid kinase activity (ISO) positive regulation of lipoprotein lipase activity (ISO) positive regulation of MAPK cascade (ISO) positive regulation of mitotic nuclear division (ISO) positive regulation of nitric oxide mediated signal transduction (ISO) positive regulation of peptidyl-tyrosine phosphorylation (ISO) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO) positive regulation of protein localization to nucleus (ISO) positive regulation of protein secretion (IBA) positive regulation of respiratory burst (ISO) protein hexamerization (ISO) receptor internalization (IEA,ISO) regulation of gene expression (IEA,ISO) regulation of phosphorylation (ISO) regulation of protein localization (ISO) regulation of protein localization to plasma membrane (ISO) regulation of protein secretion (ISO) signal transduction (IEA) vasodilation (ISO) wound healing (ISO)
1.
The role of the IDDM2 locus in the susceptibility of UK APS1 subjects to type 1 diabetes mellitus.
Adamson KA, etal., Int J Immunogenet. 2007 Feb;34(1):17-21. doi: 10.1111/j.1744-313X.2006.00643.x.
2.
Colocalization of chaperone Cpn60, proinsulin and convertase PC1 within immature secretory granules of insulin-secreting cells suggests a role for Cpn60 in insulin processing.
Arias AE, etal., J Cell Sci. 2000 Jun;113 ( Pt 11):2075-83.
3.
Insulin-induced hypertension in rats depends on an intact renin-angiotensin system.
Brands MW, etal., Hypertension. 1997 Apr;29(4):1014-9.
4.
Effects of human immunodeficiency virus and metabolic complications on myocardial nutrient metabolism, blood flow, and oxygen consumption: a cross-sectional analysis.
Cade WT, etal., Cardiovasc Diabetol. 2011 Dec 8;10:111. doi: 10.1186/1475-2840-10-111.
5.
Bacterial and plant enterotoxin B subunit-autoantigen fusion proteins suppress diabetes insulitis.
Carter JE, etal., Mol Biotechnol. 2006 Jan;32(1):1-15. doi: 10.1385/MB:32:1:001.
6.
Construction and selection of recombinant plasmids containing full-length complementary DNAs corresponding to rat insulins I and II.
Chan SJ, etal., Proc Natl Acad Sci U S A 1979 Oct;76(10):5036-40.
7.
Familial hyperproinsulinaemia due to a mutation substituting histidine for arginine at position 65 in proinsulin: identification of the mutation by restriction enzyme mapping.
Collinet M, etal., Eur J Pediatr. 1998 Jun;157(6):456-60.
8.
Seven mutations in the human insulin gene linked to permanent neonatal/infancy-onset diabetes mellitus.
Colombo C, etal., J Clin Invest. 2008 Jun;118(6):2148-56.
9.
Of mice and MEN1: Insulinomas in a conditional mouse knockout.
Crabtree JS, etal., Mol Cell Biol. 2003 Sep;23(17):6075-85.
10.
The influence of glucose-lowering therapies on cancer risk in type 2 diabetes.
Currie CJ, etal., Diabetologia. 2009 Sep;52(9):1766-77. Epub 2009 Jul 2.
11.
The combination of serum insulin, osteopontin, and hepatocyte growth factor predicts time to castration-resistant progression in androgen dependent metastatic prostate cancer- an exploratory study.
Dayyani F, etal., BMC Cancer. 2016 Sep 6;16:721. doi: 10.1186/s12885-016-2723-1.
12.
Protection of NOD mice from type 1 diabetes after oral inoculation with vaccinia viruses expressing adjuvanted islet autoantigens.
Denes B, etal., J Immunother. 2005 Sep-Oct;28(5):438-48. doi: 10.1097/01.cji.0000171315.82997.9a.
13.
Growth promoting peptides in osteoarthritis: insulin, insulin-like growth factor-1, growth hormone.
Denko CW, etal., J Rheumatol. 1990 Sep;17(9):1217-21.
14.
Differential immune response to B:9-23 insulin 1 and insulin 2 peptides in animal models of type 1 diabetes.
Devendra D, etal., J Autoimmun. 2004 Aug;23(1):17-26. doi: 10.1016/j.jaut.2004.03.008.
15.
Suppression of hyperglycemia in NOD mice after inoculation with recombinant vaccinia viruses.
Dénes B, etal., Mol Biotechnol. 2006 Nov;34(3):317-27. doi: 10.1385/MB:34:3:317.
16.
Early intensive insulin therapy attenuates the p38 pathway in the renal cortex and indices of nephropathy in diabetic rats.
Fang D, etal., Endocr J. 2012;59(1):81-90. Epub 2011 Nov 9.
17.
Differential roles of hyperglycemia and hypoinsulinemia in diabetes induced retinal cell death: evidence for retinal insulin resistance.
Fort PE, etal., PLoS One. 2011;6(10):e26498. Epub 2011 Oct 26.
18.
Loss of cholinergic and dopaminergic amacrine cells in streptozotocin-diabetic rat and Ins2Akita-diabetic mouse retinas.
Gastinger MJ, etal., Invest Ophthalmol Vis Sci. 2006 Jul;47(7):3143-50.
19.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
20.
Brain insulin system dysfunction in streptozotocin intracerebroventricularly treated rats generates hyperphosphorylated tau protein.
Grunblatt E, etal., J Neurochem. 2007 May;101(3):757-70.
21.
Proinsulin processing in the diabetic Goto-Kakizaki rat.
Guest PC, etal., J Endocrinol. 2002 Dec;175(3):637-47.
22.
The type 2 diabetes associated minor allele of rs2237895 KCNQ1 associates with reduced insulin release following an oral glucose load.
Holmkvist J, etal., PLoS One. 2009 Jun 11;4(6):e5872.
23.
Glycemic exposure is affected favorably by inhaled human insulin (Exubera) as compared with subcutaneous insulin glargine (Lantus) in patients with type 2 diabetes.
Hompesch M, etal., Diabetes Technol Ther. 2009 May;11(5):307-13.
24.
Nonobese, insulin-deficient Ins2Akita mice develop type 2 diabetes phenotypes including insulin resistance and cardiac remodeling.
Hong EG, etal., Am J Physiol Endocrinol Metab. 2007 Dec;293(6):E1687-96. doi: 10.1152/ajpendo.00256.2007. Epub 2007 Oct 2.
25.
Insulin action and insulin resistance: diseases involving defects in insulin receptors, signal transduction, and the glucose transport effector system.
Hunter SJ and Garvey WT, Am J Med. 1998 Oct;105(4):331-45.
26.
Proinsulin by immunochemiluminometric assay for the diagnosis of insulinoma.
Kao PC, etal., J Clin Endocrinol Metab. 1994 May;78(5):1048-51.
27.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
28.
Glucagon/insulin ratio as a potential biomarker for pancreatic cancer in patients with new-onset diabetes mellitus.
Kolb A, etal., Cancer Biol Ther. 2009 Aug;8(16):1527-33. Epub 2009 Aug 13.
29.
Point mutations close to the AUG initiator codon affect the efficiency of translation of rat preproinsulin in vivo.
Kozak M Nature 1984 Mar 15-21;308(5956):241-6.
30.
Polymorphism -23HPhI in the promoter of insulin gene and pancreatic cancer: a pilot study.
Krechler T, etal., Neoplasma. 2009;56(1):26-32.
31.
The insulin gene VNTR is associated with fasting insulin levels and development of juvenile obesity.
Le Stunff C, etal., Nat Genet. 2000 Dec;26(4):444-6.
32.
Antidiabetic therapies affect risk of pancreatic cancer.
Li D, etal., Gastroenterology. 2009 Aug;137(2):482-8. Epub 2009 Apr 16.
33.
Oral Administration of Silkworm-Produced GAD65 and Insulin Bi-Autoantigens against Type 1 Diabetes.
Liu B, etal., PLoS One. 2016 Jan 19;11(1):e0147260. doi: 10.1371/journal.pone.0147260. eCollection 2016.
34.
The structure and evolution of the two nonallelic rat preproinsulin genes.
Lomedico P, etal., Cell 1979 Oct;18(2):545-58.
35.
The structure of rat preproinsulin genes.
Lomedico PT, etal., Ann N Y Acad Sci 1980;343:425-32.
36.
Polymorphism of human leptin receptor gene is associated with type 2 diabetic patients complicated with non-alcoholic fatty liver disease in China.
Lu H, etal., J Gastroenterol Hepatol. 2009 Feb;24(2):228-32. Epub 2008 Aug 17.
37.
Electron microscopic immunocytochemical evidence for the involvement of the convertases PC1 and PC2 in the processing of proinsulin in pancreatic beta-cells.
Malide D, etal., J Histochem Cytochem. 1995 Jan;43(1):11-9.
38.
Protection against autoimmune diabetes by silkworm-produced GFP-tagged CTB-insulin fusion protein.
Meng Q, etal., Clin Dev Immunol. 2011;2011:831704. doi: 10.1155/2011/831704. Epub 2011 Jun 6.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Associations of serum uric acid with cardiovascular events and mortality in moderate chronic kidney disease.
Navaneethan SD and Beddhu S, Nephrol Dial Transplant. 2009 Apr;24(4):1260-6. Epub 2008 Nov 25.
41.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
42.
A variant insulin promoter in non-insulin-dependent diabetes mellitus.
Olansky L, etal., J Clin Invest. 1992 May;89(5):1596-602.
43.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
44.
Risk of autoimmune diabetes in APECED: association with short alleles of the 5'insulin VNTR.
Paquette J, etal., Genes Immun. 2010 Oct;11(7):590-7. doi: 10.1038/gene.2010.33. Epub 2010 Jun 10.
45.
Mutant proinsulin proteins associated with neonatal diabetes are retained in the endoplasmic reticulum and not efficiently secreted.
Park SY, etal., Biochem Biophys Res Commun. 2010 Jan 15;391(3):1449-54. Epub 2009 Dec 23.
46.
Parallel signaling pathways of melatonin in the pancreatic beta-cell.
Peschke E, etal., J Pineal Res. 2006 Mar;40(2):184-91.
47.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
48.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
49.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
50.
GOA pipeline
RGD automated data pipeline
51.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
52.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
53.
Comprehensive gene review and curation
RGD comprehensive gene curation
54.
Localization of proinsulin and insulin in human insulinoma: preliminary immunohistochemical results.
Roth J, etal., Virchows Arch B Cell Pathol Incl Mol Pathol. 1989;56(5):287-92.
55.
Safety and efficacy of inhaled human insulin (Exubera) during discontinuation and readministration of therapy in adults with type 1 diabetes: A 3-year randomized controlled trial.
Skyler JS, etal., Diabetes Res Clin Pract. 2008 Nov;82(2):238-46. Epub 2008 Sep 27.
56.
RNA-mediated gene duplication: the rat preproinsulin I gene is a functional retroposon.
Soares MB, etal., Mol Cell Biol 1985 Aug;5(8):2090-103.
57.
Insulin gene mutations as a cause of permanent neonatal diabetes.
Stoy J, etal., Proc Natl Acad Sci U S A. 2007 Sep 18;104(38):15040-4. Epub 2007 Sep 12.
58.
Association analysis of the AIRE and insulin genes in Finnish type 1 diabetic patients.
Turunen JA, etal., Immunogenetics. 2006 Jun;58(5-6):331-8. doi: 10.1007/s00251-006-0088-3. Epub 2006 Mar 22.
59.
Disproportionate elevation of immunoreactive proinsulin in type 2 (non-insulin-dependent) diabetes mellitus and in experimental insulin resistance.
Ward WK, etal., Diabetologia. 1987 Sep;30(9):698-702.
60.
Assessment of insulin sensitivity/resistance and their relations with leptin concentrations and anthropometric measures in a pregnant population with and without gestational diabetes mellitus.
Yilmaz O, etal., J Diabetes Complications. 2009 Mar 6.
61.
Regulation of insulin receptor function.
Youngren JF Cell Mol Life Sci. 2007 Apr;64(7-8):873-91.
62.
Obesity potentiates the growth and dissemination of pancreatic cancer.
Zyromski NJ, etal., Surgery. 2009 Aug;146(2):258-63.
Ins2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 207,272,738 - 207,421,998 (-) NCBI GRCr8 mRatBN7.2 1 197,843,277 - 197,992,522 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 197,843,281 - 197,864,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 206,216,147 - 206,217,214 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 213,302,063 - 213,303,130 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 205,976,222 - 205,977,289 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 215,856,967 - 215,858,034 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 215,856,971 - 215,858,034 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 222,751,786 - 222,756,821 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 202,935,548 - 202,936,379 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 203,123,613 - 203,124,445 (-) NCBI Celera 1 195,461,309 - 195,462,376 (-) NCBI Celera Cytogenetic Map 1 q41 NCBI
INS Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 2,159,779 - 2,161,209 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 2,159,779 - 2,161,221 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 2,181,009 - 2,182,439 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 2,137,585 - 2,139,015 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 2,137,584 - 2,139,000 NCBI Celera 11 2,217,516 - 2,218,946 (-) NCBI Celera Cytogenetic Map 11 p15.5 NCBI HuRef 11 1,971,272 - 1,972,702 (-) NCBI HuRef CHM1_1 11 2,179,957 - 2,181,387 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 2,247,427 - 2,248,857 (-) NCBI T2T-CHM13v2.0
Ins2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 142,232,393 - 142,233,463 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 142,232,393 - 142,297,118 (-) Ensembl GRCm39 Ensembl GRCm38 7 142,678,656 - 142,679,726 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 142,678,656 - 142,743,381 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 149,864,561 - 149,865,613 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 142,488,051 - 142,489,098 (-) NCBI MGSCv36 mm8 Celera 7 142,434,985 - 142,436,037 (-) NCBI Celera Cytogenetic Map 7 F5 NCBI cM Map 7 88.0 NCBI
Ins Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955422 13,909,407 - 13,910,419 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955422 13,909,408 - 13,910,419 (-) NCBI ChiLan1.0 ChiLan1.0
INS Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 4,586,153 - 4,587,845 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 3,797,924 - 3,799,616 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 2,200,785 - 2,202,579 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 2,230,309 - 2,231,666 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 2,218,117 - 2,231,666 (-) Ensembl panpan1.1 panPan2
INS Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 46,324,047 - 46,324,933 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 46,324,041 - 46,325,122 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 44,933,843 - 44,934,720 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 47,003,520 - 47,004,406 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 47,003,520 - 47,004,411 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 46,452,280 - 46,453,156 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 46,032,597 - 46,033,483 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 46,779,045 - 46,779,926 (-) NCBI UU_Cfam_GSD_1.0
Ins Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 1,748,017 - 1,749,237 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936816 1,002,137 - 1,003,357 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936816 1,002,137 - 1,003,357 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
INS
INS
Ins
.
Predicted Target Of
Count of predictions: 29 Count of miRNA genes: 29 Interacting mature miRNAs: 29 Transcripts: ENSRNOT00000027656 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1354636 Lmblg1 Limb length QTL 1 6.4 tibia length (VT:0004357) tibia length (CMO:0000450) 1 151162512 201278233 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1354634 Kidm12 Kidney mass QTL 12 3.9 kidney mass (VT:0002707) right kidney wet weight (CMO:0000082) 1 151162512 201278233 Rat 4889428 Stresp24 Stress response QTL 24 0.05 heart pumping trait (VT:2000009) absolute change in electrocardiographic low frequency R-R spectral component to high frequency R-R spectral component ratio (CMO:0002162) 1 155866514 200866514 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 61347 Bp197 Blood pressure QTL 197 4.2 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 1 158633083 203633083 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 2303622 Vencon6 Ventilatory control QTL 6 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 1 154561505 199561505 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 631205 Bp196 Blood pressure QTL 196 4 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118944897 199050459 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1331749 Hrtrt11 Heart rate QTL 11 2.973 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 94494440 198211706 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1359018 Hrtrt20 Heart rate QTL 20 3.08 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 1 185356336 202902618 Rat 70209 Niddm23 Non-insulin dependent diabetes mellitus QTL 23 2.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 94494440 198324465 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 634314 Niddm44 Non-insulin dependent diabetes mellitus QTL 44 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 49393289 199050459 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 1354591 Cm36 Cardiac mass QTL 36 4.1 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 102813953 201278233 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 10059597 Bp377 Blood pressure QTL 377 3.42 0.025 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 32737458 199368955 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 631260 Tcas2 Tongue tumor susceptibility QTL 2 4.93 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 1 192485903 199050587 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 1354615 Cm32 Cardiac mass QTL 32 5.2 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 1 102813953 201278233 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 1354620 Kidm19 Kidney mass QTL 19 4 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 201278233 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6480777 Insul17 Insulin level QTL 17 3.86 blood insulin amount (VT:0001560) blood insulin level area under curve (AUC) (CMO:0000351) 1 197260913 198211706 Rat 6480783 Insul19 Insulin level QTL 19 4.33 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 197489281 200611765 Rat 1354618 Kidm15 Kidney mass QTL 15 5 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 1 156677124 201278233 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 6480780 Insul18 Insulin level QTL 18 4.11 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 189607473 200611765 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 631549 Bp89 Blood pressure QTL 89 5.7 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 123350581 201284552 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 1354602 Bw35 Body weight QTL 35 12.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 201278233 Rat
AA986540
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 251,245,377 - 251,245,516 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,800,189 - 272,800,327 NCBI Rnor6.0 Rnor_5.0 1 280,214,020 - 280,214,158 UniSTS Rnor5.0 RGSC_v3.4 1 258,001,526 - 258,001,664 UniSTS RGSC3.4 Celera 1 246,946,819 - 246,946,957 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
PMC123023P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,426 - 197,844,133 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,183 - 251,245,392 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,799,995 - 272,800,203 NCBI Rnor6.0 Rnor_6.0 1 215,857,117 - 215,857,823 NCBI Rnor6.0 Rnor_5.0 1 280,213,826 - 280,214,034 UniSTS Rnor5.0 Rnor_5.0 1 222,751,936 - 222,752,642 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,638 - 202,936,344 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,332 - 258,001,540 UniSTS RGSC3.4 Celera 1 246,946,625 - 246,946,833 UniSTS Celera 1 195,461,459 - 195,462,165 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
PMC21231P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,360 - 197,844,160 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,156 - 251,245,457 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,799,968 - 272,800,268 NCBI Rnor6.0 Rnor_6.0 1 215,857,051 - 215,857,850 NCBI Rnor6.0 Rnor_5.0 1 280,213,799 - 280,214,099 UniSTS Rnor5.0 Rnor_5.0 1 222,751,870 - 222,752,669 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,572 - 202,936,371 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,305 - 258,001,605 UniSTS RGSC3.4 Celera 1 246,946,598 - 246,946,898 UniSTS Celera 1 195,461,393 - 195,462,192 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
PMC21334P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,378 - 197,844,106 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,210 - 251,245,439 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,800,022 - 272,800,250 NCBI Rnor6.0 Rnor_6.0 1 215,857,069 - 215,857,796 NCBI Rnor6.0 Rnor_5.0 1 280,213,853 - 280,214,081 UniSTS Rnor5.0 Rnor_5.0 1 222,751,888 - 222,752,615 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,590 - 202,936,317 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,359 - 258,001,587 UniSTS RGSC3.4 Celera 1 246,946,652 - 246,946,880 UniSTS Celera 1 195,461,411 - 195,462,138 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
RH94798
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,844,162 - 197,844,421 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,853 - 215,858,111 NCBI Rnor6.0 Rnor_5.0 1 222,752,672 - 222,752,930 UniSTS Rnor5.0 RGSC_v3.4 1 202,936,374 - 202,936,632 UniSTS RGSC3.4 Celera 1 195,462,195 - 195,462,453 UniSTS Cytogenetic Map 1 q41 UniSTS
RH94799
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,380 - 197,844,179 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,137 - 251,245,437 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,799,949 - 272,800,248 NCBI Rnor6.0 Rnor_6.0 1 215,857,071 - 215,857,869 NCBI Rnor6.0 Rnor_5.0 1 280,213,780 - 280,214,079 UniSTS Rnor5.0 Rnor_5.0 1 222,751,890 - 222,752,688 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,592 - 202,936,390 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,286 - 258,001,585 UniSTS RGSC3.4 Celera 1 246,946,579 - 246,946,878 UniSTS Celera 1 195,461,413 - 195,462,211 UniSTS RH 3.4 Map 1 1654.9 UniSTS Cytogenetic Map 1 q54-q55 UniSTS Cytogenetic Map 1 q41 UniSTS
D1Bda44
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,811 - 197,844,346 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,502 - 215,858,036 NCBI Rnor6.0 Rnor_5.0 1 222,752,321 - 222,752,855 UniSTS Rnor5.0 RGSC_v3.4 1 202,936,023 - 202,936,557 UniSTS RGSC3.4 Celera 1 195,461,844 - 195,462,378 UniSTS Cytogenetic Map 1 q41 UniSTS
PMC123023P3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 251,245,148 - 251,245,480 (+) MAPPER mRatBN7.2 mRatBN7.2 1 197,843,337 - 197,844,168 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,028 - 215,857,858 NCBI Rnor6.0 Rnor_6.0 1 272,799,960 - 272,800,291 NCBI Rnor6.0 Rnor_5.0 1 280,213,791 - 280,214,122 UniSTS Rnor5.0 Rnor_5.0 1 222,751,847 - 222,752,677 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,549 - 202,936,379 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,297 - 258,001,628 UniSTS RGSC3.4 Celera 1 246,946,590 - 246,946,921 UniSTS Celera 1 195,461,370 - 195,462,200 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
PMC153767P2
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 1 207,272,892 - 207,273,604 (+) Marker Load Pipeline mRatBN7.2 1 197,843,431 - 197,844,143 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,122 - 215,857,833 NCBI Rnor6.0 Rnor_5.0 1 222,751,941 - 222,752,652 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,643 - 202,936,354 UniSTS RGSC3.4 Celera 1 195,461,464 - 195,462,175 UniSTS Cytogenetic Map 1 q41 UniSTS
PMC24644P6
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,343 - 197,844,030 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,286 - 251,245,474 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,800,098 - 272,800,285 NCBI Rnor6.0 Rnor_6.0 1 215,857,034 - 215,857,720 NCBI Rnor6.0 Rnor_5.0 1 280,213,929 - 280,214,116 UniSTS Rnor5.0 Rnor_5.0 1 222,751,853 - 222,752,539 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,555 - 202,936,241 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,435 - 258,001,622 UniSTS RGSC3.4 Celera 1 246,946,728 - 246,946,915 UniSTS Celera 1 195,461,376 - 195,462,062 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
UniSTS:267003
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,338 - 197,844,055 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,261 - 251,245,479 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,800,073 - 272,800,290 NCBI Rnor6.0 Rnor_6.0 1 215,857,029 - 215,857,745 NCBI Rnor6.0 Rnor_5.0 1 280,213,904 - 280,214,121 UniSTS Rnor5.0 Rnor_5.0 1 222,751,848 - 222,752,564 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,550 - 202,936,266 UniSTS RGSC3.4 RGSC_v3.4 1 258,001,410 - 258,001,627 UniSTS RGSC3.4 Celera 1 246,946,703 - 246,946,920 UniSTS Celera 1 195,461,371 - 195,462,087 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
UniSTS:462687
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,339 - 197,844,092 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,030 - 215,857,782 NCBI Rnor6.0 Rnor_5.0 1 222,751,849 - 222,752,601 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,551 - 202,936,303 UniSTS RGSC3.4 Celera 1 195,461,372 - 195,462,124 UniSTS Cytogenetic Map 1 q41 UniSTS
Ins1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,338 - 197,844,149 (+) MAPPER mRatBN7.2 mRatBN7.2 1 251,245,167 - 251,245,479 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,799,979 - 272,800,290 NCBI Rnor6.0 Rnor_6.0 1 215,857,029 - 215,857,839 NCBI Rnor6.0 Rnor_5.0 1 280,213,810 - 280,214,121 UniSTS Rnor5.0 Rnor_5.0 1 222,751,848 - 222,752,658 UniSTS Rnor5.0 RGSC_v3.4 1 258,001,316 - 258,001,627 UniSTS RGSC3.4 RGSC_v3.4 1 202,935,550 - 202,936,360 UniSTS RGSC3.4 Celera 1 246,946,609 - 246,946,920 UniSTS Celera 1 195,461,371 - 195,462,181 UniSTS Cytogenetic Map 1 q54-q55 UniSTS Cytogenetic Map 1 q41 UniSTS
Ins2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,329 - 197,843,453 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,020 - 215,857,143 NCBI Rnor6.0 Rnor_5.0 1 222,751,839 - 222,751,962 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,541 - 202,935,664 UniSTS RGSC3.4 Celera 1 195,461,362 - 195,461,485 UniSTS Cytogenetic Map 1 q41 UniSTS
Ins2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 251,245,333 - 251,245,517 (+) MAPPER mRatBN7.2 Rnor_6.0 1 272,800,145 - 272,800,328 NCBI Rnor6.0 Rnor_5.0 1 280,213,976 - 280,214,159 UniSTS Rnor5.0 RGSC_v3.4 1 258,001,482 - 258,001,665 UniSTS RGSC3.4 Celera 1 246,946,775 - 246,946,958 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 q54-q55 UniSTS
Ins1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 197,843,373 - 197,844,345 (+) MAPPER mRatBN7.2 Rnor_6.0 1 215,857,064 - 215,858,035 NCBI Rnor6.0 Rnor_5.0 1 222,751,883 - 222,752,854 UniSTS Rnor5.0 RGSC_v3.4 1 202,935,585 - 202,936,556 UniSTS RGSC3.4 Celera 1 195,461,406 - 195,462,377 UniSTS Cytogenetic Map 1 q41 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
5
2
32
55
54
41
16
41
3
81
23
24
12
34
13
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000027656 ⟹ ENSRNOP00000027656
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 197,843,281 - 197,844,344 (-) Ensembl Rnor_6.0 Ensembl 1 215,856,971 - 215,858,034 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105489 ⟹ ENSRNOP00000080277
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 197,843,281 - 197,864,775 (-) Ensembl
RefSeq Acc Id:
NM_019130 ⟹ NP_062003
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,272,738 - 207,273,805 (-) NCBI mRatBN7.2 1 197,843,277 - 197,844,344 (-) NCBI Rnor_6.0 1 215,856,967 - 215,858,034 (-) NCBI Rnor_5.0 1 222,751,786 - 222,756,821 (-) NCBI RGSC_v3.4 1 202,935,548 - 202,936,379 (-) RGD Celera 1 195,461,309 - 195,462,376 (-) NCBI
Sequence:
AGCCCTAAGTGACCAGCTACAGTCGGAAACCATCAGCAAGCAGGTCATTGTTCCAACATGGCCCTGTGGATCCGCTTCCTGCCCCTGCTGGCCCTGCTCATCCTCTGGGAGCCCCGCCCTGCCCAGGC
hide sequence
RefSeq Acc Id:
XM_063280751 ⟹ XP_063136821
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,272,744 - 207,403,024 (-) NCBI
RefSeq Acc Id:
XR_010062665
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062666
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062667
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062668
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,577 (-) NCBI
RefSeq Acc Id:
XR_010062669
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062670
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,421,998 (-) NCBI
RefSeq Acc Id:
XR_010062671
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062672
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,421,998 (-) NCBI
RefSeq Acc Id:
XR_010062673
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062674
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,421,998 (-) NCBI
RefSeq Acc Id:
XR_010062675
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062676
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,577 (-) NCBI
RefSeq Acc Id:
XR_010062678
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062679
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062680
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062681
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062682
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062684
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062685
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062686
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,569 (-) NCBI
RefSeq Acc Id:
XR_010062689
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062692
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062695
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062697
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062699
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062701
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,421,869 (-) NCBI
RefSeq Acc Id:
XR_010062703
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062704
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,577 (-) NCBI
RefSeq Acc Id:
XR_010062705
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062709
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,414,581 (-) NCBI
RefSeq Acc Id:
XR_010062710
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,380,546 (-) NCBI
RefSeq Acc Id:
XR_010062712
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,384,050 (-) NCBI
RefSeq Acc Id:
XR_010062714
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,377,963 (-) NCBI
RefSeq Acc Id:
XR_010062715
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 207,296,780 - 207,382,726 (-) NCBI
RefSeq Acc Id:
NP_062003 ⟸ NM_019130
- Peptide Label:
preproprotein
- UniProtKB:
P01323 (UniProtKB/Swiss-Prot), A6HY81 (UniProtKB/TrEMBL), A6JHT1 (UniProtKB/TrEMBL)
- Sequence:
MALWIRFLPLLALLILWEPRPAQAFVKQHLCGSHLVEALYLVCGERGFFYTPMSRREVEDPQVAQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN
hide sequence
Ensembl Acc Id:
ENSRNOP00000027656 ⟸ ENSRNOT00000027656
Ensembl Acc Id:
ENSRNOP00000080277 ⟸ ENSRNOT00000105489
RefSeq Acc Id:
XP_063136821 ⟸ XM_063280751
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G4B8 (UniProtKB/TrEMBL), A6JHT1 (UniProtKB/TrEMBL)
RGD ID: 6850050 Promoter ID: EP17070 Type: single initiation site Name: RN_INS2 Description: Insulin II, INS2 or INS-2 gene. SO ACC ID: SO:0000170 Source: EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Notes: homology_group=Homology group 45; Mammalian insulin. Experiment Methods: Nuclease protection; experiments performed with closely related; gene; Primer extension; experiments performed with closely related; gene; Nuclease protection; transfected or transformed cells; experiments; performed with closely related gene; Primer extension; transfected or transformed cells; experiments; performed with closely related gene Regulation: pancreas islet b' (repressed by or weakly expressed in) cells; (induced by or strongly expressed in) glucose Position: Rat Assembly Chr Position (strand) Source RGSC_v3.4 1 202,936,557 - 202,936,617 EPD
RGD ID: 13690567 Promoter ID: EPDNEW_R1092 Type: single initiation site Name: Ins2_1 Description: insulin 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 215,858,034 - 215,858,094 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2021-03-09
Ins2
insulin 2
LOC102549619
uncharacterized LOC102549619
Data merged from RGD:7640573
737654 PROVISIONAL
2013-12-18
LOC102549619
uncharacterized LOC102549619
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-11-06
Ins2
insulin 2
Insulin 2
Name updated
625702 APPROVED
2002-06-10
Ins2
Insulin 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_transcript
contains two introns
729274
