Symbol:
Pdgfrb
Name:
platelet derived growth factor receptor beta
RGD ID:
3285
Description:
Enables phosphatidylinositol 3-kinase binding activity and platelet-derived growth factor receptor activity. Involved in several processes, including metanephros development; positive regulation of Rho protein signal transduction; and regulation of apoptotic process. Located in several cellular components, including apical plasma membrane; cell surface; and nucleus. Used to study extrahepatic cholestasis; middle cerebral artery infarction; and prostate cancer. Biomarker of hypertension; metabolic dysfunction-associated steatohepatitis; oligohydramnios; and sciatic neuropathy. Human ortholog(s) of this gene implicated in basal ganglia calcification; glioblastoma; infantile myofibromatosis; myeloproliferative neoplasm; and renal cell carcinoma. Orthologous to human PDGFRB (platelet derived growth factor receptor beta); PARTICIPATES IN platelet-derived growth factor signaling pathway; sphingosine 1-phosphate signaling pathway; calcium/calcium-mediated signaling pathway; INTERACTS WITH (+)-dihydromyricetin; (-)-epigallocatechin 3-gallate; (R,R,R)-alpha-tocopherol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
beta platelet-derived growth factor receptor; beta-type platelet-derived growth factor receptor; CD140 antigen-like family member B; PDGF-R-beta; PDGFR-1; PDGFR-beta; platelet derived growth factor receptor, beta polypeptide; platelet-derived growth factor receptor 1; Platelet-derived growth factor receptor beta; platelet-derived growth factor receptor beta variant 1; Platelet-derived growth factor receptor, beta
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDGFRB (platelet derived growth factor receptor beta) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):
Pdgfrb (platelet derived growth factor receptor, beta polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdgfrb (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDGFRB (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDGFRB (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdgfrb (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDGFRB (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDGFRB (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdgfrb (platelet derived growth factor receptor beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
NEDD8 (NEDD8 ubiquitin like modifier) HGNC
OMA
Homo sapiens (human):
NEDD8-MDP1 (NEDD8-MDP1 readthrough) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Pdgfrb (platelet derived growth factor receptor, beta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PDGFRB (platelet derived growth factor receptor beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdgfrb (platelet-derived growth factor receptor, beta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
tor
Alliance
DIOPT (Ensembl Compara|PANTHER)
Caenorhabditis elegans (roundworm):
ver-1
Alliance
DIOPT (Ensembl Compara|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
CG3277
Alliance
DIOPT (Ensembl Compara|PANTHER)
Candidate Gene For:
Cia4
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 56,770,348 - 56,809,228 (+) NCBI GRCr8 mRatBN7.2 18 54,499,962 - 54,538,840 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 54,499,964 - 54,538,843 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 56,587,978 - 56,626,738 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 57,302,576 - 57,341,334 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 55,123,817 - 55,162,705 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 56,364,586 - 56,406,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 56,364,620 - 56,406,381 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 55,596,682 - 55,637,692 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 57,014,475 - 57,053,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 57,086,706 - 57,125,813 (+) NCBI Celera 18 52,652,411 - 52,691,218 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdgfrb Rat (+)-dihydromyricetin multiple interactions EXP 6480464 ampelopsin analog inhibits the reaction [[PDGFB protein binds to PDGFB protein] which results in increased phosphorylation of PDGFRB protein] CTD PMID:21871475 Pdgfrb Rat (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 epigallocatechin gallate inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA] and epigallocatechin gallate inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB protein] CTD PMID:19646978 Pdgfrb Rat (-)-epigallocatechin 3-gallate multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PDGFRB mRNA CTD PMID:22079256 Pdgfrb Rat (1->4)-beta-D-glucan multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PDGFRB mRNA CTD PMID:36331819 Pdgfrb Rat (R,R,R)-alpha-tocopherol multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat (S)-nicotine multiple interactions EXP 6480464 Nicotine results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:20447445 Pdgfrb Rat (S)-nicotine increases expression ISO PDGFRB (Homo sapiens) 6480464 Nicotine results in increased expression of PDGFRB protein CTD PMID:16149045 Pdgfrb Rat (S)-nicotine multiple interactions ISO PDGFRB (Homo sapiens) 6480464 6 and 7-dimethoxy-2-phenylquinoxaline inhibits the reaction [Nicotine results in increased expression of PDGFRB protein] CTD PMID:16149045 Pdgfrb Rat 1,8-cineole decreases expression ISO PDGFRB (Homo sapiens) 6480464 Eucalyptol results in decreased expression of PDGFRB mRNA CTD PMID:36331666 Pdgfrb Rat 1-naphthyl isothiocyanate multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [1-Naphthylisothiocyanate co-treated with Cholic Acids] affects the expression of PDGFRB mRNA CTD PMID:27344345 Pdgfrb Rat 1-nitropyrene decreases expression ISO PDGFRB (Homo sapiens) 6480464 1-nitropyrene results in decreased expression of PDGFRB mRNA CTD PMID:19041380 Pdgfrb Rat 17alpha-ethynylestradiol multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDGFRB mRNA CTD PMID:17942748 Pdgfrb Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of PDGFRB mRNA CTD PMID:17557909 Pdgfrb Rat 17beta-estradiol multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of PDGFRB mRNA CTD PMID:18692832 Pdgfrb Rat 17beta-estradiol increases expression ISO Pdgfrb (Mus musculus) 6480464 Estradiol results in increased expression of PDGFRB mRNA CTD PMID:39298647 Pdgfrb Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of PDGFRB mRNA CTD PMID:32145629 Pdgfrb Rat 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PDGFRB mRNA more ... CTD PMID:15034205 more ... Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDGFRB mRNA CTD PMID:34747641 Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Pdgfrb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDGFRB mRNA CTD PMID:18691609 more ... Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Pdgfrb (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PDGFRB mRNA CTD PMID:21570461 and PMID:26377647 Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO PDGFRB (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDGFRB mRNA CTD PMID:20106945 more ... Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Pdgfrb (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PDGFRB mRNA CTD PMID:15034205 and PMID:20819909 Pdgfrb Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO PDGFRB (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of PDGFRB mRNA CTD PMID:22298810 Pdgfrb Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pdgfrb (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pdgfrb Rat 2-methylcholine affects expression ISO PDGFRB (Homo sapiens) 6480464 beta-methylcholine affects the expression of PDGFRB mRNA CTD PMID:21179406 Pdgfrb Rat 3,4-methylenedioxymethamphetamine increases expression ISO Pdgfrb (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PDGFRB mRNA CTD PMID:20188158 Pdgfrb Rat 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione multiple interactions ISO PDGFRB (Homo sapiens) 6480464 bisindolylmaleimide I inhibits the reaction [Leukotriene D4 results in increased phosphorylation of and results in increased activity of PDGFRB protein] CTD PMID:12223454 Pdgfrb Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Dexamethasone co-treated with Rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PDGFRB mRNA more ... CTD PMID:16054899 Pdgfrb Rat 4,4'-sulfonyldiphenol increases expression ISO Pdgfrb (Mus musculus) 6480464 bisphenol S results in increased expression of PDGFRB mRNA CTD PMID:30951980 Pdgfrb Rat 4,4'-sulfonyldiphenol affects methylation ISO Pdgfrb (Mus musculus) 6480464 bisphenol S affects the methylation of PDGFRB gene CTD PMID:31683443 Pdgfrb Rat 4,4'-sulfonyldiphenol decreases methylation ISO Pdgfrb (Mus musculus) 6480464 bisphenol S results in decreased methylation of PDGFRB exon CTD PMID:33297965 Pdgfrb Rat 4,4'-sulfonyldiphenol decreases expression ISO Pdgfrb (Mus musculus) 6480464 bisphenol S results in decreased expression of PDGFRB mRNA CTD PMID:39298647 Pdgfrb Rat 5-aza-2'-deoxycytidine increases expression ISO PDGFRB (Homo sapiens) 6480464 Decitabine results in increased expression of PDGFRB mRNA CTD PMID:21856257 Pdgfrb Rat 6,7-dimethoxy-2-phenylquinoxaline multiple interactions ISO PDGFRB (Homo sapiens) 6480464 6 more ... CTD PMID:16149045 and PMID:25896968 Pdgfrb Rat 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide multiple interactions EXP 6480464 6-chloro-2 more ... CTD PMID:31981641 Pdgfrb Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PDGFRB mRNA CTD PMID:31881176 Pdgfrb Rat aldrin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 and PMID:28263720 Pdgfrb Rat all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of PDGFRB mRNA alternative form CTD PMID:17303670 Pdgfrb Rat all-trans-retinoic acid multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of PDGFRB mRNA CTD PMID:30951980 Pdgfrb Rat all-trans-retinoic acid increases expression ISO PDGFRB (Homo sapiens) 6480464 Tretinoin results in increased expression of PDGFRB mRNA CTD PMID:23724009 Pdgfrb Rat all-trans-retinoic acid increases expression ISO Pdgfrb (Mus musculus) 6480464 Tretinoin results in increased expression of PDGFRB mRNA and Tretinoin results in increased expression of PDGFRB protein CTD PMID:21295132 Pdgfrb Rat allyl isothiocyanate decreases expression ISO Pdgfrb (Mus musculus) 6480464 allyl isothiocyanate results in decreased expression of PDGFRB mRNA CTD PMID:24036144 Pdgfrb Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PDGFRB mRNA CTD PMID:16483693 Pdgfrb Rat anthra[1,9-cd]pyrazol-6(2H)-one decreases expression EXP 6480464 pyrazolanthrone results in decreased expression of PDGFRB mRNA and pyrazolanthrone results in decreased expression of PDGFRB protein CTD PMID:18332871 Pdgfrb Rat antirheumatic drug increases expression ISO PDGFRB (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of PDGFRB mRNA CTD PMID:24449571 Pdgfrb Rat apigenin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Apigenin co-treated with Oxygen deficiency] affects the phosphorylation of PDGFRB protein CTD PMID:35513012 Pdgfrb Rat arsane affects expression ISO PDGFRB (Homo sapiens) 6480464 Arsenic affects the expression of PDGFRB mRNA CTD PMID:30746931 Pdgfrb Rat arsane multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat arsenic atom affects expression ISO PDGFRB (Homo sapiens) 6480464 Arsenic affects the expression of PDGFRB mRNA CTD PMID:30746931 Pdgfrb Rat arsenic atom multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat arsenite(3-) increases expression ISO Pdgfrb (Mus musculus) 6480464 arsenite results in increased expression of PDGFRB mRNA CTD PMID:33053406 Pdgfrb Rat arsenous acid increases expression ISO PDGFRB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PDGFRB mRNA CTD PMID:29633893 Pdgfrb Rat atrazine increases expression ISO PDGFRB (Homo sapiens) 6480464 Atrazine results in increased expression of PDGFRB mRNA CTD PMID:22378314 Pdgfrb Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of PDGFRB mRNA CTD PMID:36841081 Pdgfrb Rat Azoxymethane multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRB mRNA CTD PMID:29950665 Pdgfrb Rat benzo[a]pyrene decreases expression ISO Pdgfrb (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PDGFRB mRNA CTD PMID:21569818 Pdgfrb Rat benzo[a]pyrene increases expression ISO PDGFRB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PDGFRB mRNA CTD PMID:32234424 Pdgfrb Rat benzo[a]pyrene affects methylation ISO PDGFRB (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of PDGFRB intron CTD PMID:30157460 Pdgfrb Rat benzo[a]pyrene decreases methylation ISO PDGFRB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of PDGFRB promoter CTD PMID:27901495 Pdgfrb Rat benzo[a]pyrene increases methylation ISO PDGFRB (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PDGFRB 5' UTR CTD PMID:27901495 Pdgfrb Rat benzo[a]pyrene decreases expression ISO PDGFRB (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of PDGFRB mRNA CTD PMID:22316170 and PMID:26238291 Pdgfrb Rat benzo[a]pyrene multiple interactions ISO Pdgfrb (Mus musculus) 6480464 AHR protein inhibits the reaction [Benzo(a)pyrene results in increased expression of PDGFRB mRNA] CTD PMID:15034205 Pdgfrb Rat benzo[a]pyrene increases expression ISO Pdgfrb (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PDGFRB mRNA CTD PMID:15034205 and PMID:22228805 Pdgfrb Rat benzoates decreases expression ISO PDGFRB (Homo sapiens) 6480464 Benzoates analog results in decreased expression of PDGFRB protein CTD PMID:29472718 Pdgfrb Rat beta-carotene multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat beta-hexachlorocyclohexane decreases expression ISO Pdgfrb (Mus musculus) 6480464 beta-hexachlorocyclohexane results in decreased expression of PDGFRB mRNA CTD PMID:25270620 Pdgfrb Rat bis(2-chloroethyl) sulfide multiple interactions ISO PDGFRB (Homo sapiens) 6480464 IL10 protein affects the reaction [Mustard Gas affects the expression of PDGFRB mRNA] CTD PMID:16173061 Pdgfrb Rat bis(2-ethylhexyl) phthalate increases expression ISO Pdgfrb (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of PDGFRB mRNA CTD PMID:33162236 Pdgfrb Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDGFRB mRNA and bisphenol A results in increased expression of PDGFRB protein CTD PMID:12604637 and PMID:29097150 Pdgfrb Rat bisphenol A decreases expression ISO PDGFRB (Homo sapiens) 6480464 bisphenol A results in decreased expression of PDGFRB protein CTD PMID:32981897 Pdgfrb Rat bisphenol A increases expression ISO Pdgfrb (Mus musculus) 6480464 bisphenol A results in increased expression of PDGFRB mRNA CTD PMID:30951980 Pdgfrb Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PDGFRB gene CTD PMID:28505145 Pdgfrb Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in decreased methylation of PDGFRB gene and [bisphenol A co-treated with Genistein] results in increased methylation of PDGFRB gene CTD PMID:28505145 Pdgfrb Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDGFRB mRNA CTD PMID:25181051 more ... Pdgfrb Rat bisphenol A decreases expression ISO Pdgfrb (Mus musculus) 6480464 bisphenol A results in decreased expression of PDGFRB mRNA CTD PMID:26063408 Pdgfrb Rat Bisphenol B increases expression ISO PDGFRB (Homo sapiens) 6480464 bisphenol B results in increased expression of PDGFRB protein CTD PMID:34186270 Pdgfrb Rat bisphenol F multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of PDGFRB mRNA CTD PMID:30951980 Pdgfrb Rat bisphenol F increases expression ISO Pdgfrb (Mus musculus) 6480464 bisphenol F results in increased expression of PDGFRB mRNA CTD PMID:30951980 Pdgfrb Rat bortezomib multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Bortezomib co-treated with sorafenib] results in decreased phosphorylation of PDGFRB protein CTD PMID:16985072 Pdgfrb Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of PDGFRB mRNA CTD PMID:32479839 Pdgfrb Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of PDGFRB mRNA CTD PMID:19167457 Pdgfrb Rat cadmium atom multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDGFRB mRNA CTD PMID:29741670 Pdgfrb Rat cadmium atom multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PDGFRB mRNA CTD PMID:37325564 Pdgfrb Rat cadmium dichloride multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of PDGFRB mRNA CTD PMID:29741670 Pdgfrb Rat cadmium dichloride multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PDGFRB mRNA CTD PMID:37325564 Pdgfrb Rat calciol increases expression ISO Pdgfrb (Mus musculus) 6480464 Cholecalciferol results in increased expression of PDGFRB mRNA CTD PMID:17170073 Pdgfrb Rat captan multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Ziram co-treated with Thiophanate co-treated with Captan co-treated with Chlorpyrifos co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with thiacloprid] results in increased expression of PDGFRB protein CTD PMID:32736067 Pdgfrb Rat carbon nanotube decreases expression ISO Pdgfrb (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of PDGFRB mRNA CTD PMID:25554681 Pdgfrb Rat carbon nanotube increases expression ISO Pdgfrb (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of PDGFRB mRNA CTD PMID:25926378 Pdgfrb Rat chlorpyrifos multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Ziram co-treated with Thiophanate co-treated with Captan co-treated with Chlorpyrifos co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with thiacloprid] results in increased expression of PDGFRB protein CTD PMID:32736067 Pdgfrb Rat chlorpyrifos increases expression ISO Pdgfrb (Mus musculus) 6480464 Chlorpyrifos results in increased expression of PDGFRB mRNA CTD PMID:37019170 Pdgfrb Rat choline multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PDGFRB mRNA CTD PMID:20938992 Pdgfrb Rat chondroitin sulfate multiple interactions ISO PDGFRB (Homo sapiens) 6480464 Chondroitin Sulfates promotes the reaction [PDGFB protein results in increased phosphorylation of and results in increased activity of PDGFRB protein] and Genistein inhibits the reaction [Chondroitin Sulfates promotes the reaction [PDGFB protein results in increased phosphorylation of and results in increased activity of PDGFRB protein]] CTD PMID:16945567 Pdgfrb Rat chromium(6+) multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PDGFRB mRNA and SHH protein affects the reaction [[Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PDGFRB mRNA] CTD PMID:31756458 Pdgfrb Rat cisplatin decreases expression ISO Pdgfrb (Mus musculus) 6480464 Cisplatin results in decreased expression of PDGFRB mRNA CTD PMID:21151649 Pdgfrb Rat clotrimazole increases expression EXP 6480464 Clotrimazole results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat copper atom multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PDGFRB mRNA and [Disulfiram binds to Copper] which results in increased expression of PDGFRB mRNA CTD PMID:24690739 and PMID:30911355 Pdgfrb Rat copper(0) multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of PDGFRB mRNA and [Disulfiram binds to Copper] which results in increased expression of PDGFRB mRNA CTD PMID:24690739 and PMID:30911355 Pdgfrb Rat copper(II) sulfate decreases expression ISO PDGFRB (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of PDGFRB mRNA CTD PMID:19549813 Pdgfrb Rat copper(II) sulfate multiple interactions ISO PDGFRB (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Copper Sulfate results in increased expression of PDGFRB mRNA] more ... CTD PMID:23392711 Pdgfrb Rat copper(II) sulfate increases expression ISO PDGFRB (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PDGFRB mRNA and Copper Sulfate results in increased expression of PDGFRB protein CTD PMID:23392711 Pdgfrb Rat corn oil increases expression EXP 6480464 Corn Oil results in increased expression of PDGFRB mRNA CTD PMID:22760963 Pdgfrb Rat coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of PDGFRB mRNA and Coumestrol results in increased expression of PDGFRB protein CTD PMID:12604637 Pdgfrb Rat crocidolite asbestos decreases expression ISO PDGFRB (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of PDGFRB mRNA CTD PMID:28056339 Pdgfrb Rat curcumin increases expression ISO PDGFRB (Homo sapiens) 6480464 Curcumin results in increased expression of PDGFRB mRNA CTD PMID:21594647 Pdgfrb Rat curcumin decreases phosphorylation EXP 6480464 Curcumin results in decreased phosphorylation of PDGFRB protein CTD PMID:17372590 and PMID:18332871 Pdgfrb Rat curcumin multiple interactions EXP 6480464 Curcumin inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA] CTD PMID:18006644 Pdgfrb Rat curcumin decreases expression EXP 6480464 Curcumin results in decreased expression of PDGFRB mRNA and Curcumin results in decreased expression of PDGFRB protein CTD PMID:18332871 Pdgfrb Rat cyclosporin A increases expression ISO PDGFRB (Homo sapiens) 6480464 Cyclosporine results in increased expression of PDGFRB mRNA CTD PMID:20106945 Pdgfrb Rat cyclosporin A decreases expression ISO PDGFRB (Homo sapiens) 6480464 Cyclosporine results in decreased expression of PDGFRB mRNA CTD PMID:25562108 Pdgfrb Rat cytarabine decreases expression ISO PDGFRB (Homo sapiens) 6480464 Cytarabine results in decreased expression of PDGFRB mRNA CTD PMID:21198554 Pdgfrb Rat DDD multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 and PMID:28263720 Pdgfrb Rat DDE multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 and PMID:28263720 Pdgfrb Rat DDT multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in increased expression of PDGFRB mRNA CTD PMID:28263720 Pdgfrb Rat dermatan sulfate decreases expression ISO PDGFRB (Homo sapiens) 6480464 Dermatan Sulfate results in decreased expression of PDGFRB mRNA CTD PMID:16945567 Pdgfrb Rat desferrioxamine B decreases expression EXP 6480464 Deferoxamine results in decreased expression of PDGFRB protein CTD PMID:18032466 Pdgfrb Rat dexamethasone multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of PDGFRB mRNA more ... CTD PMID:16054899 Pdgfrb Rat dexamethasone decreases expression ISO Pdgfrb (Mus musculus) 6480464 Dexamethasone results in decreased expression of PDGFRB mRNA CTD PMID:22733784 Pdgfrb Rat dextran sulfate multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRB mRNA CTD PMID:29950665 Pdgfrb Rat diallyl trisulfide decreases expression ISO PDGFRB (Homo sapiens) 6480464 diallyl trisulfide results in decreased expression of PDGFRB mRNA CTD PMID:34995734 Pdgfrb Rat diarsenic trioxide increases expression ISO PDGFRB (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PDGFRB mRNA CTD PMID:29633893 Pdgfrb Rat Dibutyl phosphate affects expression ISO PDGFRB (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of PDGFRB mRNA CTD PMID:37042841 Pdgfrb Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of PDGFRB mRNA CTD PMID:21266533 Pdgfrb Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PDGFRB mRNA CTD PMID:18636392 Pdgfrb Rat diclofenac decreases expression ISO Pdgfrb (Mus musculus) 6480464 Diclofenac results in decreased expression of PDGFRB mRNA CTD PMID:26934552 Pdgfrb Rat dicrotophos increases expression ISO PDGFRB (Homo sapiens) 6480464 dicrotophos results in increased expression of PDGFRB mRNA CTD PMID:28302478 Pdgfrb Rat dieldrin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Dichlorodiphenyldichloroethane co-treated with Dichlorodiphenyl Dichloroethylene co-treated with 2 more ... CTD PMID:19422813 and PMID:28263720 Pdgfrb Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of PDGFRB mRNA and Diethylstilbestrol results in increased expression of PDGFRB protein CTD PMID:12604637 Pdgfrb Rat Dimerumic acid decreases expression ISO Pdgfrb (Mus musculus) 6480464 dimerumic acid results in decreased expression of PDGFRB mRNA CTD PMID:24036144 Pdgfrb Rat Dimerumic acid multiple interactions ISO Pdgfrb (Mus musculus) 6480464 NFE2L2 protein affects the reaction [dimerumic acid results in decreased expression of PDGFRB mRNA] CTD PMID:24036144 Pdgfrb Rat dioxygen multiple interactions ISO Pdgfrb (Mus musculus) 6480464 Oxygen deficiency results in increased expression of and results in increased activity of PDGFRB protein and rosiglitazone inhibits the reaction [Oxygen deficiency results in increased expression of and results in increased activity of PDGFRB protein] CTD PMID:19520921 Pdgfrb Rat dioxygen multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Apigenin co-treated with Oxygen deficiency] affects the phosphorylation of PDGFRB protein CTD PMID:35513012 Pdgfrb Rat disodium selenite multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat disulfiram multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of PDGFRB mRNA CTD PMID:24690739 Pdgfrb Rat doxorubicin affects expression ISO PDGFRB (Homo sapiens) 6480464 Doxorubicin affects the expression of PDGFRB mRNA CTD PMID:29803840 Pdgfrb Rat emodin multiple interactions EXP 6480464 Emodin inhibits the reaction [PDGFB protein results in increased phosphorylation of PDGFRB protein] CTD PMID:15288473 Pdgfrb Rat emodin decreases expression EXP 6480464 Emodin results in decreased expression of PDGFRB protein CTD PMID:15288473 Pdgfrb Rat endrin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in increased expression of PDGFRB mRNA CTD PMID:28263720 Pdgfrb Rat entinostat decreases expression ISO Pdgfrb (Mus musculus) 6480464 entinostat results in decreased expression of PDGFRB protein CTD PMID:29845424 Pdgfrb Rat ethanol multiple interactions EXP 6480464 fomepizole inhibits the reaction [Ethanol results in increased expression of PDGFRB mRNA] CTD PMID:20116195 Pdgfrb Rat ethanol increases expression ISO Pdgfrb (Mus musculus) 6480464 Ethanol results in increased expression of PDGFRB mRNA CTD PMID:30319688 Pdgfrb Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PDGFRB mRNA CTD PMID:20116195 Pdgfrb Rat fenamidone increases expression ISO Pdgfrb (Mus musculus) 6480464 fenamidone results in increased expression of PDGFRB mRNA CTD PMID:27029645 Pdgfrb Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PDGFRB mRNA CTD PMID:20566332 Pdgfrb Rat folic acid multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PDGFRB mRNA CTD PMID:20938992 Pdgfrb Rat folic acid decreases expression ISO PDGFRB (Homo sapiens) 6480464 Folic Acid results in decreased expression of PDGFRB mRNA CTD PMID:21867686 Pdgfrb Rat fomepizole multiple interactions EXP 6480464 fomepizole inhibits the reaction [Ethanol results in increased expression of PDGFRB mRNA] CTD PMID:20116195 Pdgfrb Rat furan increases expression EXP 6480464 furan results in increased expression of PDGFRB mRNA CTD PMID:27387713 Pdgfrb Rat furosemide increases expression EXP 6480464 Furosemide results in increased expression of PDGFRB mRNA CTD PMID:16526316 Pdgfrb Rat gamma-hexachlorocyclohexane multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in increased expression of PDGFRB mRNA CTD PMID:28263720 Pdgfrb Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PDGFRB mRNA and Genistein results in increased expression of PDGFRB protein CTD PMID:12604637 Pdgfrb Rat genistein multiple interactions EXP 6480464 [bisphenol A co-treated with Genistein] results in decreased methylation of PDGFRB gene and [bisphenol A co-treated with Genistein] results in increased methylation of PDGFRB gene CTD PMID:28505145 Pdgfrb Rat genistein decreases expression ISO PDGFRB (Homo sapiens) 6480464 Genistein results in decreased expression of PDGFRB mRNA CTD PMID:22228119 Pdgfrb Rat genistein multiple interactions ISO PDGFRB (Homo sapiens) 6480464 Genistein inhibits the reaction [Chondroitin Sulfates promotes the reaction [PDGFB protein results in increased phosphorylation of and results in increased activity of PDGFRB protein]] CTD PMID:16945567 Pdgfrb Rat glutathione increases abundance ISO PDGFRB (Homo sapiens) 6480464 PDGFRB protein results in increased abundance of Glutathione CTD PMID:29857117 Pdgfrb Rat GW 4064 multiple interactions ISO Pdgfrb (Mus musculus) 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to PDGFRB gene] CTD PMID:20091679 Pdgfrb Rat hemin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [hydroquinone co-treated with Hemin] affects the expression of PDGFRB mRNA CTD PMID:32198055 Pdgfrb Rat hydralazine decreases expression EXP 407420266 hydralazine decreases expression of Pdgfrb protein in liver RGD Pdgfrb Rat hydrogen peroxide affects expression ISO PDGFRB (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of PDGFRB mRNA CTD PMID:20044591 Pdgfrb Rat hydrogen peroxide multiple interactions EXP 6480464 tetramethylpyrazine inhibits the reaction [Hydrogen Peroxide results in increased expression of PDGFRB mRNA] and tetramethylpyrazine inhibits the reaction [Hydrogen Peroxide results in increased expression of PDGFRB protein] CTD PMID:23022513 Pdgfrb Rat hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of PDGFRB mRNA and Hydrogen Peroxide results in increased expression of PDGFRB protein CTD PMID:23022513 Pdgfrb Rat hydrogen peroxide multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Hydrogen Peroxide affects the activity of PDGFRB protein] which results in increased activity of MAPK1 protein more ... CTD PMID:14975446 Pdgfrb Rat hydroquinone multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [hydroquinone co-treated with Hemin] affects the expression of PDGFRB mRNA CTD PMID:32198055 Pdgfrb Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of PDGFRB mRNA CTD PMID:17440234 Pdgfrb Rat inulin multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PDGFRB mRNA CTD PMID:36331819 Pdgfrb Rat isotretinoin increases expression ISO PDGFRB (Homo sapiens) 6480464 Isotretinoin results in increased expression of PDGFRB mRNA CTD PMID:20436886 Pdgfrb Rat kaempferol decreases phosphorylation EXP 6480464 kaempferol results in decreased phosphorylation of PDGFRB protein CTD PMID:16041643 Pdgfrb Rat L-ascorbic acid multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat L-cysteine multiple interactions EXP 6480464 Cysteine inhibits the reaction [PDGFB protein results in increased phosphorylation of PDGFRB protein] and Cysteine inhibits the reaction [Thioacetamide results in increased expression of PDGFRB protein] CTD PMID:15158331 Pdgfrb Rat L-cysteine decreases expression EXP 6480464 Cysteine results in decreased expression of PDGFRB protein CTD PMID:15158331 Pdgfrb Rat L-methionine multiple interactions EXP 6480464 Methionine inhibits the reaction [PDGFB protein results in increased phosphorylation of PDGFRB protein] and Methionine inhibits the reaction [Thioacetamide results in increased expression of PDGFRB protein] CTD PMID:15158331 Pdgfrb Rat L-methionine multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PDGFRB mRNA CTD PMID:20938992 Pdgfrb Rat L-methionine decreases expression EXP 6480464 Methionine results in decreased expression of PDGFRB protein CTD PMID:15158331 Pdgfrb Rat lercanidipine decreases phosphorylation EXP 6480464 lercanidipine results in decreased phosphorylation of PDGFRB protein CTD PMID:18973813 Pdgfrb Rat leukotriene D4 multiple interactions ISO PDGFRB (Homo sapiens) 6480464 6 more ... CTD PMID:12223454 Pdgfrb Rat lipopolysaccharide decreases expression ISO Pdgfrb (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of PDGFRB mRNA CTD PMID:12057914 Pdgfrb Rat lipopolysaccharide multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDGFRB mRNA CTD PMID:35811015 Pdgfrb Rat lipopolysaccharide increases expression ISO Pdgfrb (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of PDGFRB mRNA CTD PMID:27339419 Pdgfrb Rat lipoxin A4 multiple interactions ISO PDGFRB (Homo sapiens) 6480464 lipoxin A4 affects the reaction [PDGFB protein results in increased phosphorylation of PDGFRB protein] more ... CTD PMID:12223454 and PMID:20709806 Pdgfrb Rat lipoxin A4 decreases phosphorylation ISO PDGFRB (Homo sapiens) 6480464 lipoxin A4 results in decreased phosphorylation of PDGFRB protein CTD PMID:20709806 Pdgfrb Rat losartan multiple interactions EXP 6480464 Losartan inhibits the reaction [AGT protein results in increased expression of PDGFRB mRNA] CTD PMID:17043664 Pdgfrb Rat manganese atom multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat manganese(0) multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat manganese(II) chloride multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat masitinib decreases activity ISO PDGFRB (Homo sapiens) 6480464 masitinib results in decreased activity of PDGFRB protein CTD PMID:19789626 Pdgfrb Rat melittin multiple interactions EXP 6480464 Melitten results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:17654254 Pdgfrb Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of PDGFRB gene CTD PMID:35440735 Pdgfrb Rat methylisothiazolinone decreases expression ISO PDGFRB (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in decreased expression of PDGFRB mRNA CTD PMID:31629900 Pdgfrb Rat methylmercury chloride increases expression ISO PDGFRB (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PDGFRB mRNA CTD PMID:28001369 Pdgfrb Rat mifepristone decreases expression EXP 6480464 Mifepristone results in decreased expression of PDGFRB mRNA CTD PMID:25972201 Pdgfrb Rat mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of PDGFRB mRNA CTD PMID:32566080 Pdgfrb Rat Muraglitazar increases expression EXP 6480464 muraglitazar results in increased expression of PDGFRB mRNA CTD PMID:21515302 Pdgfrb Rat N-acetyl-L-cysteine multiple interactions ISO Pdgfrb (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [sodium arsenite results in increased expression of PDGFRB mRNA] CTD PMID:21134390 Pdgfrb Rat N-acetyl-L-cysteine multiple interactions ISO PDGFRB (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [Copper Sulfate results in increased expression of PDGFRB mRNA] more ... CTD PMID:23392711 Pdgfrb Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PDGFRB mRNA CTD PMID:20360939 Pdgfrb Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of PDGFRB mRNA and Diethylnitrosamine results in increased expression of PDGFRB protein CTD PMID:19638242 and PMID:26589970 Pdgfrb Rat niclosamide decreases expression ISO Pdgfrb (Mus musculus) 6480464 Niclosamide results in decreased expression of PDGFRB protein CTD PMID:34118929 Pdgfrb Rat niclosamide increases expression ISO PDGFRB (Homo sapiens) 6480464 Niclosamide results in increased expression of PDGFRB mRNA CTD PMID:36318118 Pdgfrb Rat nicotine multiple interactions ISO PDGFRB (Homo sapiens) 6480464 6 and 7-dimethoxy-2-phenylquinoxaline inhibits the reaction [Nicotine results in increased expression of PDGFRB protein] CTD PMID:16149045 Pdgfrb Rat nicotine increases expression ISO PDGFRB (Homo sapiens) 6480464 Nicotine results in increased expression of PDGFRB protein CTD PMID:16149045 Pdgfrb Rat nicotine multiple interactions EXP 6480464 Nicotine results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:20447445 Pdgfrb Rat nitrofen multiple interactions EXP 6480464 Imatinib Mesylate inhibits the reaction [nitrofen results in increased expression of PDGFRB protein] CTD PMID:22447953 Pdgfrb Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of PDGFRB protein CTD PMID:22447953 Pdgfrb Rat Nonylphenol decreases expression EXP 6480464 nonylphenol results in decreased expression of PDGFRB mRNA CTD PMID:15518916 Pdgfrb Rat olmesartan multiple interactions EXP 6480464 olmesartan inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB protein] and olmesartan inhibits the reaction [Fish Oils inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB protein]] CTD PMID:24144775 Pdgfrb Rat orantinib multiple interactions ISO PDGFRB (Homo sapiens) 6480464 orantinib results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:16144927 Pdgfrb Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PDGFRB mRNA CTD PMID:25729387 Pdgfrb Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PDGFRB mRNA CTD PMID:25729387 Pdgfrb Rat oxidopamine decreases expression EXP 6480464 Oxidopamine results in decreased expression of PDGFRB mRNA CTD PMID:15518916 Pdgfrb Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] affects the expression of PDGFRB mRNA CTD PMID:18636392 Pdgfrb Rat ozone multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of PDGFRB mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of PDGFRB mRNA CTD PMID:34911549 Pdgfrb Rat paracetamol affects expression ISO Pdgfrb (Mus musculus) 6480464 Acetaminophen affects the expression of PDGFRB mRNA CTD PMID:17562736 Pdgfrb Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of PDGFRB mRNA CTD PMID:33387578 Pdgfrb Rat paracetamol increases expression ISO Pdgfrb (Mus musculus) 6480464 Acetaminophen results in increased expression of PDGFRB mRNA CTD PMID:34724096 Pdgfrb Rat paracetamol increases expression ISO PDGFRB (Homo sapiens) 6480464 Acetaminophen results in increased expression of PDGFRB mRNA CTD PMID:29067470 Pdgfrb Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of PDGFRB mRNA CTD PMID:25710175 Pdgfrb Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PDGFRB mRNA and [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PDGFRB mRNA CTD PMID:36331819 Pdgfrb Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of PDGFRB mRNA CTD PMID:28511854 Pdgfrb Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of PDGFRB mRNA CTD PMID:20360939 Pdgfrb Rat phenobarbital affects expression ISO Pdgfrb (Mus musculus) 6480464 Phenobarbital affects the expression of PDGFRB mRNA CTD PMID:23091169 Pdgfrb Rat pirinixic acid decreases expression ISO Pdgfrb (Mus musculus) 6480464 pirinixic acid results in decreased expression of PDGFRB mRNA CTD PMID:18445702 Pdgfrb Rat pirinixic acid increases expression ISO Pdgfrb (Mus musculus) 6480464 pirinixic acid results in increased expression of PDGFRB mRNA CTD PMID:17426115 Pdgfrb Rat ponatinib decreases activity ISO PDGFRB (Homo sapiens) 6480464 ponatinib analog results in decreased activity of PDGFRB protein and ponatinib results in decreased activity of PDGFRB protein CTD PMID:19878872 and PMID:21561767 Pdgfrb Rat potassium chromate decreases expression ISO PDGFRB (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PDGFRB mRNA CTD PMID:22079256 Pdgfrb Rat potassium chromate multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PDGFRB mRNA CTD PMID:22079256 Pdgfrb Rat potassium dichromate multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PDGFRB mRNA and SHH protein affects the reaction [[Potassium Dichromate results in increased abundance of chromium hexavalent ion] which results in increased expression of PDGFRB mRNA] CTD PMID:31756458 Pdgfrb Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat progesterone multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in increased expression of PDGFRB mRNA CTD PMID:18692832 Pdgfrb Rat raloxifene affects expression ISO PDGFRB (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of PDGFRB mRNA CTD PMID:14699072 Pdgfrb Rat reactive oxygen species decreases abundance ISO PDGFRB (Homo sapiens) 6480464 PDGFRB protein results in decreased abundance of Reactive Oxygen Species CTD PMID:29857117 Pdgfrb Rat resveratrol multiple interactions ISO PDGFRB (Homo sapiens) 6480464 resveratrol inhibits the reaction [[PDGFB protein binds to PDGFB protein] which results in increased phosphorylation of PDGFRB protein] and resveratrol inhibits the reaction [PDGFB protein results in increased phosphorylation of PDGFRB protein] CTD PMID:16343977 and PMID:23457620 Pdgfrb Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of PDGFRB mRNA CTD PMID:28374803 Pdgfrb Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDGFRB mRNA CTD PMID:35811015 Pdgfrb Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO PDGFRB (Homo sapiens) 6480464 Buthionine Sulfoximine inhibits the reaction [Acetylcysteine inhibits the reaction [Copper Sulfate results in increased expression of PDGFRB mRNA]] and Buthionine Sulfoximine inhibits the reaction [Acetylcysteine inhibits the reaction [Copper Sulfate results in increased expression of PDGFRB protein]] CTD PMID:23392711 Pdgfrb Rat Salinomycin decreases expression ISO PDGFRB (Homo sapiens) 6480464 salinomycin results in decreased expression of PDGFRB mRNA CTD PMID:19682730 Pdgfrb Rat simvastatin decreases expression ISO Pdgfrb (Mus musculus) 6480464 Simvastatin results in decreased expression of PDGFRB mRNA CTD PMID:10412775 Pdgfrb Rat simvastatin multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Hexachlorocyclohexane co-treated with Aldrin co-treated with Dieldrin co-treated with Endrin co-treated with Dichlorodiphenyl Dichloroethylene co-treated with Dichlorodiphenyldichloroethane co-treated with DDT co-treated with Simvastatin] results in increased expression of PDGFRB mRNA CTD PMID:28263720 Pdgfrb Rat sodium arsenite multiple interactions ISO Pdgfrb (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [sodium arsenite results in increased expression of PDGFRB mRNA] CTD PMID:21134390 Pdgfrb Rat sodium arsenite multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of PDGFRB mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of PDGFRB mRNA CTD PMID:39836092 Pdgfrb Rat sodium arsenite increases expression ISO Pdgfrb (Mus musculus) 6480464 sodium arsenite results in increased expression of PDGFRB mRNA CTD PMID:21134390 Pdgfrb Rat sodium arsenite decreases expression ISO Pdgfrb (Mus musculus) 6480464 sodium arsenite results in decreased expression of PDGFRB mRNA CTD PMID:16014739 Pdgfrb Rat sodium chloride increases expression ISO PDGFRB (Homo sapiens) 6480464 Sodium Chloride results in increased expression of PDGFRB mRNA CTD PMID:23634900 Pdgfrb Rat sorafenib multiple interactions EXP 6480464 sorafenib results in decreased phosphorylation of and results in decreased activity of PDGFRB protein CTD PMID:19338580 Pdgfrb Rat sorafenib decreases expression EXP 6480464 sorafenib results in decreased expression of PDGFRB mRNA CTD PMID:19338580 Pdgfrb Rat sorafenib decreases phosphorylation ISO PDGFRB (Homo sapiens) 6480464 sorafenib results in decreased phosphorylation of PDGFRB protein CTD PMID:19139124 Pdgfrb Rat sorafenib decreases activity ISO PDGFRB (Homo sapiens) 6480464 sorafenib results in decreased activity of PDGFRB protein mutant form CTD PMID:17229632 Pdgfrb Rat sorafenib multiple interactions ISO PDGFRB (Homo sapiens) 6480464 [Bortezomib co-treated with sorafenib] results in decreased phosphorylation of PDGFRB protein CTD PMID:16985072 Pdgfrb Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of PDGFRB mRNA CTD PMID:30047161 Pdgfrb Rat sulforaphane decreases expression ISO PDGFRB (Homo sapiens) 6480464 sulforaphane results in decreased expression of PDGFRB mRNA CTD PMID:31838189 Pdgfrb Rat sunitinib decreases phosphorylation ISO PDGFRB (Homo sapiens) 6480464 Sunitinib results in decreased phosphorylation of PDGFRB protein CTD PMID:35443205 Pdgfrb Rat tanespimycin decreases expression ISO PDGFRB (Homo sapiens) 6480464 tanespimycin results in decreased expression of PDGFRB protein CTD PMID:22810956 Pdgfrb Rat tanespimycin decreases expression EXP 6480464 tanespimycin results in decreased expression of PDGFRB protein CTD PMID:22810956 Pdgfrb Rat temozolomide decreases expression ISO PDGFRB (Homo sapiens) 6480464 Temozolomide results in decreased expression of PDGFRB mRNA CTD PMID:31758290 Pdgfrb Rat Tesaglitazar increases expression EXP 6480464 tesaglitazar results in increased expression of PDGFRB mRNA CTD PMID:21515302 Pdgfrb Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of PDGFRB mRNA and Carbon Tetrachloride results in increased expression of PDGFRB protein CTD PMID:15623374 more ... Pdgfrb Rat tetrachloromethane multiple interactions ISO Pdgfrb (Mus musculus) 6480464 ESRRG protein affects the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA] more ... CTD PMID:17962354 more ... Pdgfrb Rat tetrachloromethane increases expression ISO Pdgfrb (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PDGFRB mRNA and Carbon Tetrachloride results in increased expression of PDGFRB protein CTD PMID:17962354 more ... Pdgfrb Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of PDGFRB protein CTD PMID:17069927 Pdgfrb Rat tetrachloromethane multiple interactions EXP 6480464 Curcumin inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA] more ... CTD PMID:18006644 more ... Pdgfrb Rat tetramethylpyrazine multiple interactions EXP 6480464 tetramethylpyrazine inhibits the reaction [Hydrogen Peroxide results in increased expression of PDGFRB mRNA] and tetramethylpyrazine inhibits the reaction [Hydrogen Peroxide results in increased expression of PDGFRB protein] CTD PMID:23022513 Pdgfrb Rat tetramethylpyrazine multiple interactions ISO Pdgfrb (Mus musculus) 6480464 NFE2L2 protein promotes the reaction [tetramethylpyrazine inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA]] more ... CTD PMID:27477297 Pdgfrb Rat tetraphene increases expression ISO Pdgfrb (Mus musculus) 6480464 benz(a)anthracene results in increased expression of PDGFRB mRNA CTD PMID:26377693 Pdgfrb Rat tetrathiomolybdate(2-) decreases expression ISO PDGFRB (Homo sapiens) 6480464 tetrathiomolybdate results in decreased expression of PDGFRB protein CTD PMID:18480265 Pdgfrb Rat Theaflavin 3,3'-digallate multiple interactions EXP 6480464 theaflavin-3 and 3'-digallate inhibits the reaction [PDGFBB protein results in increased phosphorylation of PDGFRB protein] CTD PMID:35903325 Pdgfrb Rat thiacloprid multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Ziram co-treated with Thiophanate co-treated with Captan co-treated with Chlorpyrifos co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with thiacloprid] results in increased expression of PDGFRB protein CTD PMID:32736067 Pdgfrb Rat thioacetamide multiple interactions EXP 6480464 Cysteine inhibits the reaction [Thioacetamide results in increased expression of PDGFRB protein] more ... CTD PMID:15158331 more ... Pdgfrb Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PDGFRB protein CTD PMID:15158331 and PMID:15288473 Pdgfrb Rat thiophanate-methyl multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Ziram co-treated with Thiophanate co-treated with Captan co-treated with Chlorpyrifos co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with thiacloprid] results in increased expression of PDGFRB protein CTD PMID:32736067 Pdgfrb Rat titanium dioxide multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDGFRB mRNA CTD PMID:29950665 Pdgfrb Rat toluene increases expression EXP 6480464 Toluene results in increased expression of PDGFRB mRNA CTD PMID:22967744 Pdgfrb Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of PDGFRB mRNA CTD PMID:25729387 Pdgfrb Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PDGFRB mRNA CTD PMID:25729387 Pdgfrb Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of PDGFRB mRNA CTD PMID:33387578 Pdgfrb Rat triphenyl phosphate decreases expression EXP 6480464 triphenyl phosphate results in decreased expression of PDGFRB mRNA CTD PMID:30589522 Pdgfrb Rat triphenyl phosphate affects expression ISO PDGFRB (Homo sapiens) 6480464 triphenyl phosphate affects the expression of PDGFRB mRNA CTD PMID:37042841 Pdgfrb Rat tris(2-butoxyethyl) phosphate affects expression ISO PDGFRB (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate affects the expression of PDGFRB mRNA CTD PMID:29024780 Pdgfrb Rat troglitazone decreases expression ISO Pdgfrb (Mus musculus) 6480464 troglitazone results in decreased expression of PDGFRB mRNA CTD PMID:28973697 Pdgfrb Rat tunicamycin decreases expression ISO PDGFRB (Homo sapiens) 6480464 Tunicamycin results in decreased expression of PDGFRB mRNA CTD PMID:22378314 Pdgfrb Rat valproic acid increases methylation ISO PDGFRB (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PDGFRB gene CTD PMID:29154799 Pdgfrb Rat valproic acid decreases expression ISO Pdgfrb (Mus musculus) 6480464 Valproic Acid results in decreased expression of PDGFRB protein CTD PMID:29845424 Pdgfrb Rat valproic acid increases expression ISO Pdgfrb (Mus musculus) 6480464 Valproic Acid results in increased expression of PDGFRB mRNA CTD PMID:24896083 Pdgfrb Rat valproic acid decreases expression ISO PDGFRB (Homo sapiens) 6480464 Valproic Acid results in decreased expression of PDGFRB mRNA CTD PMID:29154799 Pdgfrb Rat vancomycin decreases expression ISO Pdgfrb (Mus musculus) 6480464 Vancomycin results in decreased expression of PDGFRB mRNA CTD PMID:18930951 Pdgfrb Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of PDGFRB mRNA CTD PMID:20566332 Pdgfrb Rat vitamin E increases expression ISO PDGFRB (Homo sapiens) 6480464 Vitamin E results in increased expression of PDGFRB mRNA CTD PMID:19244175 Pdgfrb Rat Vitisin A multiple interactions EXP 6480464 vitisin A inhibits the reaction [[PDGFB protein binds to PDGFB protein] which results in increased phosphorylation of PDGFRB protein] CTD PMID:21871475 Pdgfrb Rat Y-27632 multiple interactions EXP 6480464 Y 27632 inhibits the reaction [Carbon Tetrachloride results in increased expression of PDGFRB mRNA] CTD PMID:30783172 Pdgfrb Rat zinc atom multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat zinc(0) multiple interactions EXP 6480464 [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB mRNA and [alpha-Tocopherol co-treated with beta Carotene co-treated with Ascorbic Acid co-treated with Zinc co-treated with Sodium Selenite] results in decreased expression of PDGFRB protein CTD PMID:23859036 Pdgfrb Rat ziram multiple interactions ISO Pdgfrb (Mus musculus) 6480464 [Ziram co-treated with Thiophanate co-treated with Captan co-treated with Chlorpyrifos co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with thiacloprid] results in increased expression of PDGFRB protein CTD PMID:32736067
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-dihydromyricetin (EXP) (-)-epigallocatechin 3-gallate (EXP,ISO) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (EXP) (S)-nicotine (EXP,ISO) 1,8-cineole (ISO) 1-naphthyl isothiocyanate (ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2-(2-Chlorophenyl-4'-chlorophenyl)-1,1-dichloroethene (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 6,7-dimethoxy-2-phenylquinoxaline (ISO) 6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (EXP) 6-propyl-2-thiouracil (EXP) acetamide (EXP) aldrin (ISO) all-trans-retinoic acid (EXP,ISO) allyl isothiocyanate (ISO) amitrole (EXP) ammonium chloride (EXP) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antirheumatic drug (ISO) apigenin (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP,ISO) Azoxymethane (ISO) benzo[a]pyrene (ISO) benzoates (ISO) beta-carotene (EXP) beta-hexachlorocyclohexane (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) bromobenzene (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) calciol (ISO) captan (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) choline (ISO) chondroitin sulfate (ISO) chromium(6+) (ISO) cisplatin (ISO) clotrimazole (EXP) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corn oil (EXP) coumestrol (EXP) crocidolite asbestos (ISO) curcumin (EXP,ISO) cyclosporin A (ISO) cytarabine (ISO) DDD (ISO) DDE (ISO) DDT (ISO) dermatan sulfate (ISO) desferrioxamine B (EXP) dexamethasone (ISO) dextran sulfate (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dichlorine (EXP) diclofenac (ISO) dicrotophos (ISO) dieldrin (ISO) diethylstilbestrol (EXP) Dimerumic acid (ISO) dioxygen (ISO) disodium selenite (EXP) disulfiram (ISO) doxorubicin (ISO) emodin (EXP) endrin (ISO) entinostat (ISO) ethanol (EXP,ISO) fenamidone (ISO) flutamide (EXP) folic acid (ISO) fomepizole (EXP) furan (EXP) furosemide (EXP) gamma-hexachlorocyclohexane (ISO) genistein (EXP,ISO) glutathione (ISO) GW 4064 (ISO) hemin (ISO) hydralazine (EXP) hydrogen peroxide (EXP,ISO) hydroquinone (ISO) indometacin (EXP) inulin (ISO) isotretinoin (ISO) kaempferol (EXP) L-ascorbic acid (EXP) L-cysteine (EXP) L-methionine (EXP,ISO) lercanidipine (EXP) leukotriene D4 (ISO) lipopolysaccharide (ISO) lipoxin A4 (ISO) losartan (EXP) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) masitinib (ISO) melittin (EXP) methimazole (EXP) methoxychlor (EXP) methylisothiazolinone (ISO) methylmercury chloride (ISO) mifepristone (EXP) mono(2-ethylhexyl) phthalate (EXP) Muraglitazar (EXP) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (EXP) niclosamide (ISO) nicotine (EXP,ISO) nitrofen (EXP) Nonylphenol (EXP) olmesartan (EXP) orantinib (ISO) oxaliplatin (EXP) oxidopamine (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) pentane-2,3-dione (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenethyl caffeate (EXP) phenobarbital (ISO) pirinixic acid (ISO) ponatinib (ISO) potassium chromate (ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) raloxifene (ISO) reactive oxygen species (ISO) resveratrol (ISO) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) Salinomycin (ISO) simvastatin (ISO) sodium arsenite (ISO) sodium chloride (ISO) sorafenib (EXP,ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) tanespimycin (EXP,ISO) temozolomide (ISO) Tesaglitazar (EXP) tetrachloromethane (EXP,ISO) tetramethylpyrazine (EXP,ISO) tetraphene (ISO) tetrathiomolybdate(2-) (ISO) Theaflavin 3,3'-digallate (EXP) thiacloprid (ISO) thioacetamide (EXP) thiophanate-methyl (ISO) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) trichloroethene (EXP) triphenyl phosphate (EXP,ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) tunicamycin (ISO) valproic acid (ISO) vancomycin (ISO) vinclozolin (EXP) vitamin E (ISO) Vitisin A (EXP) Y-27632 (EXP) zinc atom (EXP) zinc(0) (EXP) ziram (ISO)
Biological Process
adrenal gland development (ISO) angiogenesis (IBA) animal organ development (IEA) aorta morphogenesis (ISO) blood vessel development (ISO) cardiac myofibril assembly (ISO,ISS) cell chemotaxis (IBA,IEA,ISO,ISS) cell migration involved in coronary angiogenesis (ISO,ISS) cell migration involved in vasculogenesis (ISO,ISS) cell surface receptor protein tyrosine kinase signaling pathway (IBA,IEA) cellular response to growth factor stimulus (IEA) cellular response to hydrogen peroxide (ISO) cellular response to platelet-derived growth factor stimulus (IEA) chemotaxis (IEA) embryonic organ development (ISO) glycosaminoglycan biosynthetic process (IMP) hemopoiesis (ISO,ISS) in utero embryonic development (ISO) inner ear development (IEP) intracellular signal transduction (IMP) kidney development (ISO) lung growth (IMP) male gonad development (IEP) metanephric comma-shaped body morphogenesis (IEP) metanephric glomerular capillary formation (ISO,ISS) metanephric glomerular mesangial cell proliferation involved in metanephros development (ISO,ISS) metanephric glomerular mesangium development (ISO) metanephric glomerulus morphogenesis (IEP) metanephric mesenchymal cell migration (IDA) metanephric mesenchyme development (IEP) metanephric S-shaped body morphogenesis (IEP) negative regulation of apoptotic process (IMP) peptidyl-tyrosine phosphorylation (ISO) platelet-derived growth factor receptor signaling pathway (IEA,ISO) platelet-derived growth factor receptor-beta signaling pathway (IEA,ISO) positive regulation of apoptotic process (IMP) positive regulation of calcium ion import (ISO,ISS) positive regulation of calcium-mediated signaling (IEA,ISO,ISS) positive regulation of cell migration (IEA,ISO,ISS) positive regulation of cell population proliferation (IBA,IEA,IMP,ISO) positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway (IEA,ISO) positive regulation of chemotaxis (ISO,ISS) positive regulation of collagen biosynthetic process (IMP) positive regulation of DNA biosynthetic process (ISO,ISS) positive regulation of ERK1 and ERK2 cascade (IEA,ISO,ISS) positive regulation of fibroblast proliferation (IMP) positive regulation of hepatic stellate cell activation (IMP) positive regulation of MAP kinase activity (ISO,ISS) positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway (ISO,ISS) positive regulation of mitotic nuclear division (ISO,ISS) positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO,ISS) positive regulation of reactive oxygen species metabolic process (ISO,ISS) positive regulation of Rho protein signal transduction (IMP) positive regulation of smooth muscle cell migration (IBA,IEA,ISO,ISS) positive regulation of smooth muscle cell proliferation (IEA,ISO,ISS) protein autophosphorylation (ISO) regulation of actin cytoskeleton organization (ISO) regulation of peptidyl-tyrosine phosphorylation (ISO) response to ceramide (ISO) response to estradiol (IEP) response to estrogen (IEP) response to fluid shear stress (IEP) response to hydrogen peroxide (IEP) response to hyperoxia (IEP) response to lipid (IEP) response to retinoic acid (IEP) response to toxic substance (IEP) retina vasculature development in camera-type eye (ISO,ISS) ruffle assembly (ISO) signal transduction (IEA,ISO) skeletal system morphogenesis (ISO) smooth muscle cell chemotaxis (ISO) smooth muscle tissue development (ISO) system development (IEA) tissue homeostasis (ISO)
Molecular Function
ATP binding (IEA) enzyme binding (IEA,ISO) GTPase activator activity (IEA,ISO,ISS) kinase activity (IEA,ISO) metal ion binding (IEA) nucleotide binding (IEA) phosphatidylinositol 3-kinase binding (IPI) phospholipase C activator activity (IEA,ISO,ISS) platelet-derived growth factor beta-receptor activity (IBA,IEA,ISO,ISS) platelet-derived growth factor binding (IBA,IEA,ISO) platelet-derived growth factor receptor activity (IDA,ISO,TAS) platelet-derived growth factor receptor binding (IEA,ISO) protein binding (IPI,ISO) protein kinase activity (IEA,ISO,TAS) protein kinase binding (IEA,ISO) protein tyrosine kinase activity (IDA,IEA,ISO,TAS) signaling receptor binding (IEA,ISO) transferase activity (IEA) transmembrane receptor protein tyrosine kinase activity (IEA) vascular endothelial growth factor binding (IEA,ISO)
1.
Stimulated activation of platelet-derived growth factor receptor in vivo in balloon-injured arteries: a link between angiotensin II and intimal thickening.
Abe J, etal., Circulation. 1997 Sep 16;96(6):1906-13.
2.
High glucose-induced upregulation of Rho/Rho-kinase via platelet-derived growth factor receptor-beta increases migration of aortic smooth muscle cells.
Akiyama N, etal., J Mol Cell Cardiol. 2008 Aug;45(2):326-32. doi: 10.1016/j.yjmcc.2008.04.006. Epub 2008 Apr 25.
3.
Response to imatinib mesylate in patients with chronic myeloproliferative diseases with rearrangements of the platelet-derived growth factor receptor beta.
Apperley JF, etal., N Engl J Med. 2002 Aug 15;347(7):481-7.
4.
Platelet-derived growth factor receptor beta regulates migration and DNA synthesis in metanephric mesenchymal cells.
Arar M, etal., J Biol Chem. 2000 Mar 31;275(13):9527-33.
5.
Nilotinib-mediated mucosal healing in a rat model of colitis.
Ataca P, etal., World J Gastroenterol. 2013 Oct 7;19(37):6237-44. doi: 10.3748/wjg.v19.i37.6237.
6.
Expression of platelet-derived growth factor-A (PDGF-A), PDGF-B, and PDGF receptor-alpha and -beta during human testicular development and disease.
Basciani S, etal., J Clin Endocrinol Metab. 2002 May;87(5):2310-9.
7.
PDGF- and insulin/IGF-1-specific distinct modes of class IA PI 3-kinase activation in normal rat retinas and RGC-5 retinal ganglion cells.
Biswas SK, etal., Invest Ophthalmol Vis Sci. 2008 Aug;49(8):3687-98. Epub 2008 Apr 17.
8.
Dominant-negative soluble PDGF-beta receptor inhibits hepatic stellate cell activation and attenuates liver fibrosis.
Borkham-Kamphorst E, etal., Lab Invest. 2004 Jun;84(6):766-77.
9.
Expression patterns of PDGF-A, -B, -C and -D and the PDGF-receptors alpha and beta in activated rat hepatic stellate cells (HSC).
Breitkopf K, etal., Cytokine. 2005 Sep 7;31(5):349-57.
10.
Inhibition of receptor signaling and of glioblastoma-derived tumor growth by a novel PDGFRß aptamer.
Camorani S, etal., Mol Ther. 2014 Apr;22(4):828-41. doi: 10.1038/mt.2013.300. Epub 2014 Jan 2.
11.
PDGF-BB-mediated activation of p42(MAPK) is independent of PDGF beta-receptor tyrosine phosphorylation.
Cartel NJ, etal., Am J Physiol Lung Cell Mol Physiol 2001 Oct;281(4):L786-98.
12.
Platelet-derived growth factor-BB-mediated glycosaminoglycan synthesis is transduced through Akt.
Cartel NJ, etal., Biochem J. 2002 Apr 1;363(Pt 1):19-28.
13.
Oligohydramnios decreases platelet-derived growth factor expression in fetal rat lungs.
Chen CM, etal., Neonatology. 2007;92(3):187-93. Epub 2007 May 21.
14.
RNA interference targeting the platelet-derived growth factor receptor beta subunit ameliorates experimental hepatic fibrosis in rats.
Chen SW, etal., Liver Int. 2008 Dec;28(10):1446-57. doi: 10.1111/j.1478-3231.2008.01759.x. Epub 2008 May 3.
15.
Effects of ribozyme targeting platelet-derived growth factor receptor beta subunit gene on the proliferation and apoptosis of hepatic stellate cells in vitro.
Chen YX, etal., Chin Med J (Engl). 2005 Jun 20;118(12):982-8.
16.
c-Src couples PI 3 kinase/Akt and MAPK signaling to PDGF-induced DNA synthesis in mesangial cells.
Choudhury GG, etal., Cell Signal. 2006 Nov;18(11):1854-64.
17.
Temporal changes in gene expression following cryogenic rat brain injury.
Cook JL, etal., Brain Res Mol Brain Res. 1998 Mar 30;55(1):9-19.
18.
Quantitative trait loci disposing for both experimental arthritis and encephalomyelitis in the DA rat; impact on severity of myelin oligodendrocyte glycoprotein-induced experimental autoimmune encephalomyelitis and antibody isotype pattern.
Dahlman I, etal., Eur J Immunol 1998 Jul;28(7):2188-96
19.
Comparative transcriptional and functional profiling of clear cell and papillary renal cell carcinoma.
Diegmann J, etal., Int J Mol Med. 2006 Sep;18(3):395-403.
20.
A high-potassium diet reduces infarct size and improves vascular structure in hypertensive rats.
Dorrance AM, etal., Am J Physiol Regul Integr Comp Physiol. 2007 Jan;292(1):R415-22. Epub 2006 Aug 17.
21.
Identification of a new quantitative trait locus on chromosome 7 controlling disease severity of collagen-induced arthritis in rats.
Dracheva SV, etal., Immunogenetics 1999 Aug;49(9):787-91
22.
Sequential in-office vitreous aspirates demonstrate vitreous matrix metalloproteinase 9 levels correlate with the amount of subretinal fluid in eyes with wet age-related macular degeneration.
Ecker SM, etal., Mol Vis. 2012;18:1658-67. Epub 2012 Jun 20.
23.
Estrogen-induced smooth muscle cell growth is regulated by tuberin and associated with altered activation of platelet-derived growth factor receptor-beta and ERK-1/2.
Finlay GA, etal., J Biol Chem. 2004 May 28;279(22):23114-22. Epub 2004 Mar 23.
24.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
25.
PDGFRB is overexpressed in metastatic medulloblastoma.
Gilbertson RJ and Clifford SC, Nat Genet. 2003 Nov;35(3):197-8. doi: 10.1038/ng1103-197.
26.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
27.
p73 independent of c-Myc represses transcription of platelet-derived growth factor beta-receptor through interaction with NF-Y.
Hackzell A, etal., J Biol Chem 2002 Oct 18;277(42):39769-76.
28.
Conservation in sequence and affinity of human and rodent PDGF ligands and receptors.
Herren B, etal., Biochim Biophys Acta 1993 Jun 25;1173(3):294-302.
29.
Successive activation of the platelet-derived growth factor beta receptor and platelet-derived growth factor B genes correlates with the genesis of human choriocarcinoma.
Holmgren L, etal., Cancer Res. 1993 Jun 15;53(12):2927-31.
30.
A role for platelet-derived growth factor beta-receptor in a newborn rat model of endothelin-mediated pulmonary vascular remodeling.
Jankov RP, etal., Am J Physiol Lung Cell Mol Physiol. 2005 Jun;288(6):L1162-70. Epub 2005 Feb 18.
31.
Autocrine PDGFR signaling promotes mammary cancer metastasis.
Jechlinger M, etal., J Clin Invest. 2006 Jun;116(6):1561-70.
32.
A stroma targeted therapy enhances castration effects in a transplantable rat prostate cancer model.
Johansson A, etal., Prostate. 2007 Nov 1;67(15):1664-76.
33.
A novel DNA vaccine encoding PDGFRbeta suppresses growth and dissemination of murine colon, lung and breast carcinoma.
Kaplan CD, etal., Vaccine. 2006 Nov 17;24(47-48):6994-7002. Epub 2006 Jun 5.
34.
Inhibition of PDGF beta-receptor tyrosine phosphorylation and its downstream intracellular signal transduction in rat aortic vascular smooth muscle cells by kaempferol.
Kim SY, etal., Planta Med. 2005 Jul;71(7):599-603.
35.
Expression of platelet-derived growth factor in the developing cochlea of rats.
Lee YW, etal., Acta Otolaryngol. 2004 Jun;124(5):558-62.
36.
Role of platelet-derived growth factor receptor-mediated signal transduction in myocardial hypertrophy of spontaneously hypertensive rats.
Liu J, etal., Sheng Li Xue Bao. 2002 Apr 25;54(2):159-64.
37.
Pattern formation of vascular smooth muscle cells subject to nonuniform fluid shear stress: role of PDGF-beta receptor and Src.
Liu SQ, etal., Am J Physiol Heart Circ Physiol. 2003 Sep;285(3):H1081-90. Epub 2003 May 8.
38.
Autoantigen-pulsed dendritic cells constitute a beneficial cytokine and growth factor network in ameliorating experimental allergic encephalomyelitis.
Liu X, etal., Mult Scler. 2005 Aug;11(4):381-9.
39.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
40.
Expansion of the phenotype of Kosaki overgrowth syndrome.
Minatogawa M, etal., Am J Med Genet A. 2017 Sep;173(9):2422-2427. doi: 10.1002/ajmg.a.38310. Epub 2017 Jun 22.
41.
Immunohistochemical characterization of glomerular PDGF B-chain and PDGF beta-receptor expression in diabetic rats.
Nakagawa H, etal., Diabetes Res Clin Pract. 2000 May;48(2):87-98.
42.
Role of PDGF B-chain and PDGF receptors in rat tubular regeneration after acute injury.
Nakagawa T, etal., Am J Pathol. 1999 Nov;155(5):1689-99.
43.
Better-surviving liver grafts by the injection of anti-CD2 antibody: the important roles of host CD8+ and CD2+CD28+ T cells in chronic graft rejection and beta type platelet-derived growth factor receptor (PDGFR-beta) expression on apoptotic liver grafts.
Nakatsuji T Tohoku J Exp Med. 1999 Mar;187(3):215-25.
44.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
45.
Bolus endovascular PDGFR-beta antisense treatment suppressed intimal hyperplasia in a rat carotid injury model.
Noiseux N, etal., Circulation. 2000 Sep 12;102(11):1330-6.
46.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
47.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
48.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
49.
Sodium butyrate inhibits platelet-derived growth factor-induced proliferation of vascular smooth muscle cells.
Ranganna K, etal., Arterioscler Thromb Vasc Biol. 1995 Dec;15(12):2273-83.
50.
A genome scan localizes five non-MHC loci controlling collagen-induced arthritis in rats.
Remmers EF, etal., Nat Genet 1996 Sep;14(1):82-5
51.
GOA pipeline
RGD automated data pipeline
52.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
53.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
54.
Comprehensive gene review and curation
RGD comprehensive gene curation
55.
Effect of platelet-derived growth factor isoforms in rat metanephric mesenchymal cells.
Ricono JM, etal., Am J Physiol Renal Physiol. 2002 Feb;282(2):F211-9.
56.
Ligand-independent trans-activation of the platelet-derived growth factor receptor by reactive oxygen species requires protein kinase C-delta and c-Src.
Saito S, etal., J Biol Chem. 2002 Nov 22;277(47):44695-700. Epub 2002 Sep 10.
57.
Functional blockade of platelet-derived growth factor receptor-beta but not of receptor-alpha prevents vascular smooth muscle cell accumulation in fibrous cap lesions in apolipoprotein E-deficient mice.
Sano H, etal., Circulation. 2001 Jun 19;103(24):2955-60.
58.
Effects of hypertension and aging on platelet-derived growth factor and platelet-derived growth factor receptor expression in rat aorta and heart.
Sarzani R, etal., Hypertension. 1991 Nov;18(5 Suppl):III93-9.
59.
The effect of acute rejection and cyclosporin A-treatment on induction of platelet-derived growth factor and its receptors during the development of chronic rat renal allograft rejection.
Savikko J, etal., Transplantation. 2002 Feb 27;73(4):506-11.
60.
Melittin, a major bioactive component of bee venom toxin, inhibits PDGF receptor beta-tyrosine phosphorylation and downstream intracellular signal transduction in rat aortic vascular smooth muscle cells.
Son DJ, etal., J Toxicol Environ Health A. 2007 Aug;70(15-16):1350-5.
61.
Different roles for PDGF-alpha and -beta receptors in embryonic lung development.
Souza P, etal., Am J Respir Cell Mol Biol. 1996 Oct;15(4):551-62.
62.
Activation of Src kinase in platelet-derived growth factor-B-dependent tubular regeneration after acute ischemic renal injury.
Takikita-Suzuki M, etal., Am J Pathol. 2003 Jul;163(1):277-86.
63.
Sphingosine 1-phosphate transactivates the platelet-derived growth factor beta receptor and epidermal growth factor receptor in vascular smooth muscle cells.
Tanimoto T, etal., Circ Res. 2004 Apr 30;94(8):1050-8. Epub 2004 Mar 25.
64.
Prenatal exposure to estrogenic compounds alters the expression pattern of platelet-derived growth factor receptors alpha and beta in neonatal rat testis: identification of gonocytes as targets of estrogen exposure.
Thuillier R, etal., Biol Reprod. 2003 Mar;68(3):867-80.
65.
Glomerular expression of platelet-derived growth factor (PDGF)-A, -B chain and PDGF receptor-alpha, -beta in human diabetic nephropathy.
Uehara G, etal., Clin Exp Nephrol. 2004 Mar;8(1):36-42.
66.
Inhibition of platelet-derived growth factor actions in the embryonic testis influences normal cord development and morphology.
Uzumcu M, etal., Biol Reprod. 2002 Mar;66(3):745-53.
67.
Expression of endothelial PDGF receptors alpha and beta in breast cancer: up-regulation of endothelial PDGF receptor beta.
Vrekoussis T, etal., Oncol Rep. 2007 May;17(5):1115-9.
68.
PDGFR-β modulates vascular smooth muscle cell phenotype via IRF-9/SIRT-1/NF-κB pathway in subarachnoid hemorrhage rats.
Wan W, etal., J Cereb Blood Flow Metab. 2019 Jul;39(7):1369-1380. doi: 10.1177/0271678X18760954. Epub 2018 Feb 26.
69.
Crosstalk between angiotensin II and platelet derived growth factor-BB mediated signal pathways in cardiomyocytes.
Wang C, etal., Chin Med J (Engl). 2008 Feb 5;121(3):236-40.
70.
[A preliminary study on the changes of expression of PDGF-beta, PDGFR-beta, TGF-beta 1, TGFR, bFGF and its relationship with the wound age in wound healing]
Wang HJ, etal., Fa Yi Xue Za Zhi. 2001 Nov;17(4):198-201, 204.
71.
Identification and distribution of a novel platelet-derived growth factor receptor beta variant: effect of retinoic acid and involvement in cell differentiation.
Wang Y and Culty M, Endocrinology. 2007 May;148(5):2233-50. Epub 2007 Feb 15.
72.
Expression and mutational analysis of tyrosine kinase receptors c-kit, PDGFRalpha, and PDGFRbeta in ovarian cancers.
Wilczynski SP, etal., Hum Pathol. 2005 Mar;36(3):242-9.
73.
Blocking platelet-derived growth factor-D/platelet-derived growth factor receptor beta signaling inhibits human renal cell carcinoma progression in an orthotopic mouse model.
Xu L, etal., Cancer Res. 2005 Jul 1;65(13):5711-9.
74.
Activation of MAP kinases, Akt and PDGF receptors in injured peripheral nerves.
Yamazaki T, etal., J Peripher Nerv Syst. 2009 Sep;14(3):165-76. doi: 10.1111/j.1529-8027.2009.00228.x.
75.
The antihypertensive agent hydralazine reduced extracellular matrix synthesis and liver fibrosis in nonalcoholic steatohepatitis exacerbated by hypertension.
Yuan Y, etal., PLoS One. 2020 Dec 14;15(12):e0243846. doi: 10.1371/journal.pone.0243846. eCollection 2020.
76.
Enhancement of glomerular platelet-derived growth factor beta-receptor tyrosine phosphorylation in hypertensive rats and its inhibition by calcium channel blocker.
Zhan Y, etal., Hypertens Res. 2002 Mar;25(2):295-301.
Pdgfrb Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 56,770,348 - 56,809,228 (+) NCBI GRCr8 mRatBN7.2 18 54,499,962 - 54,538,840 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 54,499,964 - 54,538,843 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 56,587,978 - 56,626,738 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 57,302,576 - 57,341,334 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 55,123,817 - 55,162,705 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 56,364,586 - 56,406,381 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 56,364,620 - 56,406,381 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 55,596,682 - 55,637,692 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 57,014,475 - 57,053,581 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 57,086,706 - 57,125,813 (+) NCBI Celera 18 52,652,411 - 52,691,218 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
PDGFRB Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 150,113,839 - 150,155,845 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 150,113,839 - 150,155,872 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 149,493,402 - 149,535,408 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 149,473,595 - 149,515,615 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 149,473,595 - 149,515,503 NCBI Celera 5 145,574,776 - 145,616,798 (-) NCBI Celera Cytogenetic Map 5 q32 NCBI HuRef 5 144,641,381 - 144,683,476 (-) NCBI HuRef CHM1_1 5 148,925,983 - 148,968,003 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 150,650,431 - 150,692,448 (-) NCBI T2T-CHM13v2.0
Pdgfrb Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 61,178,194 - 61,218,139 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 61,178,222 - 61,218,133 (+) Ensembl GRCm39 Ensembl GRCm38 18 61,045,127 - 61,085,067 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 61,045,150 - 61,085,061 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 61,204,804 - 61,244,721 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 61,170,810 - 61,210,428 (+) NCBI MGSCv36 mm8 Celera 18 62,332,161 - 62,372,066 (+) NCBI Celera Cytogenetic Map 18 E1 NCBI cM Map 18 34.41 NCBI
Pdgfrb Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 4,365,743 - 4,403,587 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 4,365,848 - 4,403,317 (+) NCBI ChiLan1.0 ChiLan1.0
PDGFRB Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 145,342,640 - 145,388,629 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 143,482,189 - 143,524,580 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 145,538,330 - 145,580,312 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 151,543,581 - 151,585,630 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 151,543,891 - 151,585,530 (-) Ensembl panpan1.1 panPan2
PDGFRB Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 58,925,922 - 58,963,639 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 58,926,351 - 58,962,283 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 58,692,327 - 58,728,259 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 59,406,388 - 59,444,135 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 59,406,430 - 59,444,130 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 59,195,608 - 59,231,543 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 59,310,188 - 59,346,130 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 59,841,270 - 59,877,207 (+) NCBI UU_Cfam_GSD_1.0
Pdgfrb Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 143,188,255 - 143,225,815 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936504 4,762,184 - 4,799,829 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936504 4,762,251 - 4,799,789 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDGFRB Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 151,155,756 - 151,192,647 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 151,155,753 - 151,192,818 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 158,113,430 - 158,121,798 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PDGFRB Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 52,724,061 - 52,766,264 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 52,724,005 - 52,766,234 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 24,950,813 - 24,993,042 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdgfrb
.
Predicted Target Of
Count of predictions: 233 Count of miRNA genes: 153 Interacting mature miRNAs: 187 Transcripts: ENSRNOT00000068535 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331733 Bp233 Blood pressure QTL 233 3.97196 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 24796977 79788953 Rat 1358358 Sradr6 Stress Responsive Adrenal Weight QTL 6 2.49 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 18 11944299 59330563 Rat 1331730 Scl27 Serum cholesterol level QTL 27 3.826 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 18 52292875 59796643 Rat 1331741 Bp232 Blood pressure QTL 232 3.59112 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 21372893 83213037 Rat 1331742 Bp228 Blood pressure QTL 228 3.88752 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 1331736 Bp227 Blood pressure QTL 227 2.791 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 46718763 59796643 Rat 1300125 Rf26 Renal function QTL 26 3.2 urine potassium amount (VT:0010539) urine potassium excretion rate (CMO:0000761) 18 52539863 65844950 Rat 6893683 Bw110 Body weight QTL 110 2.7 0.002 body mass (VT:0001259) body weight (CMO:0000012) 18 43345022 83828827 Rat 1331727 Bp237 Blood pressure QTL 237 3.053 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 61698465 Rat 9589041 Epfw12 Epididymal fat weight QTL 12 17.08 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 18 46640675 83828827 Rat 8694432 Bw165 Body weight QTL 165 3.81 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 46640675 83828827 Rat 9589816 Gluco68 Glucose level QTL 68 7.25 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 29792965 74792965 Rat 1331774 Bp226 Blood pressure QTL 226 4.41065 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 61360 Eaey Experimental allergic encephalomyelitis QTL y 3 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis duration (CMO:0001424) 18 46988939 60377753 Rat 2300177 Bmd65 Bone mineral density QTL 65 19.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 1578667 Bss21 Bone structure and strength QTL 21 3.5 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 18 11791518 83218561 Rat 2303120 Mamtr8 Mammary tumor resistance QTL 8 0.001 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 31359408 83218561 Rat 12880368 Bw187 Body weight QTL 187 0.045 body mass (VT:0001259) body weight (CMO:0000012) 18 52539763 76104388 Rat 61367 Iddm4 Insulin dependent diabetes mellitus QTL 4 2.33 0.0074 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 18 38192455 83192455 Rat 2293658 Bmd23 Bone mineral density QTL 23 7.3 0.0001 femur mineral mass (VT:0010011) total volumetric bone mineral density (CMO:0001728) 18 51464733 63636873 Rat 1359020 Ppulsi2 Prepulse inhibition QTL 2 2.71 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 18 52292875 73997283 Rat 2299160 Iddm35 Insulin dependent diabetes mellitus QTL 35 2.79 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 18 4207941 60377792 Rat 9590318 Scort22 Serum corticosterone level QTL 22 7.64 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 18 29792965 74792965 Rat 1331752 Bw27 Body weight QTL 27 2.963 body mass (VT:0001259) body weight (CMO:0000012) 18 52292875 65845095 Rat 1578661 Bss20 Bone structure and strength QTL 20 3.7 femur morphology trait (VT:0000559) femoral neck cross-sectional area (CMO:0001697) 18 11791518 83218561 Rat 1331754 Bp230 Blood pressure QTL 230 4.61609 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 29792965 74792965 Rat 12904069 Cm123 Cardiac mass QTL 123 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 18 52539763 76104388 Rat 1331798 Bp224 Blood pressure QTL 224 3.53873 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359408 59796643 Rat 12904070 Cm124 Cardiac mass QTL 124 0.01 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 18 52539763 76104388 Rat 2303584 Gluco55 Glucose level QTL 55 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 18 48520044 83828827 Rat 12904071 Am18 Aortic mass QTL 18 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 18 52539763 76104388 Rat 61383 Bp47 Blood pressure QTL 47 17.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 31271681 60377755 Rat 12904067 Cm122 Cardiac mass QTL 122 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 18 52539763 76104388 Rat 1331806 Bp229 Blood pressure QTL 229 4.36484 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 57867167 Rat 2301417 Bp319 Blood pressure QTL 319 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 52539763 76104388 Rat 12904073 Kidm71 Kidney mass QTL 71 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 18 52539763 76104388 Rat 1331780 Bp238 Blood pressure QTL 238 3.269 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718763 59796643 Rat 738008 Hcar14 Hepatocarcinoma resistance QTL 14 4.3 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion number (CMO:0001462) 18 51464733 83218561 Rat 1331776 Bp225 Blood pressure QTL 225 2.829 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 18 31359408 59796643 Rat 6903359 Bp355 Blood pressure QTL 355 3.6 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 18 11944544 59796478 Rat 631518 Bw11 Body weight QTL 11 2.8 body mass (VT:0001259) body weight (CMO:0000012) 18 35870723 80870723 Rat 6903345 Bp349 Blood pressure QTL 349 3.9 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 2313082 Bss85 Bone structure and strength QTL 85 0.8 0.0001 long bone metaphysis morphology trait (VT:0000133) tibia midshaft total cross-sectional area (CMO:0001715) 18 14951337 59951337 Rat 6903347 Bp350 Blood pressure QTL 350 4.4 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 31359530 59796478 Rat 8694366 Abfw8 Abdominal fat weight QTL 8 6.38 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 18 46640675 83828827 Rat 6903349 Bp351 Blood pressure QTL 351 3.5 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631509 Sald2 Serum aldosterone level QTL 2 2.9 blood aldosterone amount (VT:0005346) serum aldosterone level (CMO:0000487) 18 52539763 69140759 Rat 2300157 Bmd66 Bone mineral density QTL 66 13.1 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 18 28964853 73964853 Rat 738005 Anxrr11 Anxiety related response QTL 11 3.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 18 30039813 75039813 Rat 6903351 Bp352 Blood pressure QTL 352 3.3 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 46718935 59796478 Rat 631274 Sprol1 Serum protein level QTL 1 5.3 blood total protein amount (VT:0005567) serum total protein level (CMO:0000661) 18 31393320 77209694 Rat 1358193 Emca2 Estrogen-induced mammary cancer QTL 2 1.6 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 18 18007599 63571040 Rat 2293704 Bss35 Bone structure and strength QTL 35 4.59 0.0002 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 18 28964853 73964853 Rat 2325839 Bp348 Blood pressure QTL 348 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 18 25570985 70570985 Rat 1600373 Mamtr6 Mammary tumor resistance QTL 6 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 18 19278901 83218561 Rat 2293708 Bss46 Bone structure and strength QTL 46 8.8 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 18 11791518 63636873 Rat 8694378 Bw157 Body weight QTL 157 3.59 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 18 29792965 74792965 Rat 1600375 Mcs22 Mammary carcinoma susceptibility QTL 22 3.3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 18 52539763 63933058 Rat 2303571 Bw92 Body weight QTL 92 3 body mass (VT:0001259) body weight (CMO:0000012) 18 48520044 83828827 Rat 1598826 Anxrr20 Anxiety related response QTL 20 3.04 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 18 41432971 83828827 Rat 61429 Cia17 Collagen induced arthritis QTL 17 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 18 31359408 70263868 Rat 7411719 Strs5 Sensitivity to stroke QTL 5 9.4 cerebrum integrity trait (VT:0010549) percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932) 18 49999958 65845095 Rat
D18Wox25
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 18 54,498,329 - 54,498,481 (+) MAPPER mRatBN7.2 Rnor_6.0 18 56,363,005 - 56,363,156 NCBI Rnor6.0 Rnor_5.0 18 55,595,086 - 55,595,237 UniSTS Rnor5.0 RGSC_v3.4 18 57,012,803 - 57,012,954 UniSTS RGSC3.4 Celera 18 52,650,739 - 52,650,890 UniSTS Cytogenetic Map 18 q12.1 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000068535 ⟹ ENSRNOP00000060534
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 54,515,659 - 54,538,843 (+) Ensembl Rnor_6.0 Ensembl 18 56,364,620 - 56,406,343 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000078764 ⟹ ENSRNOP00000070561
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 54,500,218 - 54,538,838 (+) Ensembl Rnor_6.0 Ensembl 18 56,379,890 - 56,404,671 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000086033 ⟹ ENSRNOP00000069485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 18 54,499,964 - 54,538,838 (+) Ensembl Rnor_6.0 Ensembl 18 56,364,677 - 56,406,381 (+) Ensembl
RefSeq Acc Id:
NM_031525 ⟹ NP_113713
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 56,770,348 - 56,809,228 (+) NCBI mRatBN7.2 18 54,499,962 - 54,538,838 (+) NCBI Rnor_6.0 18 56,364,677 - 56,406,381 (+) NCBI Rnor_5.0 18 55,596,682 - 55,637,692 (+) NCBI RGSC_v3.4 18 57,014,475 - 57,053,581 (+) RGD Celera 18 52,652,411 - 52,691,218 (+) RGD
Sequence:
CGGCTACCCTATCTGGGACATAGGATTGCTCTGGGAGTAACTTTGAGAGAGAAAGAGAACAGAGTCCAGAGCCAGAGCGGGCCCAGACCAGTCGTCAGTCTCCTGCCTGCCAGCTAGACCTAGGGCGG
hide sequence
RefSeq Acc Id:
XM_039096573 ⟹ XP_038952501
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 56,776,593 - 56,809,228 (+) NCBI mRatBN7.2 18 54,506,207 - 54,538,840 (+) NCBI
RefSeq Acc Id:
XM_063277094 ⟹ XP_063133164
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 18 56,789,933 - 56,809,228 (+) NCBI
RefSeq Acc Id:
NP_113713 ⟸ NM_031525
- Peptide Label:
precursor
- UniProtKB:
Q8R406 (UniProtKB/Swiss-Prot), Q925F7 (UniProtKB/Swiss-Prot), Q05030 (UniProtKB/Swiss-Prot), A6IXF6 (UniProtKB/TrEMBL), A0A8L2R1W6 (UniProtKB/TrEMBL)
- Sequence:
MGLPEVMPASVLRGQLLLFVLLLLGPQISQGLVITPPGPEFVLNISSTFVLTCSSSAPVMWEQMSQVPWQEAAMNQDGTFSSVLTLTNVTGGDTGEYFCVYNNSLGPELSERKRIYIFVPDPTMGFLP
hide sequence
Ensembl Acc Id:
ENSRNOP00000060534 ⟸ ENSRNOT00000068535
Ensembl Acc Id:
ENSRNOP00000070561 ⟸ ENSRNOT00000078764
Ensembl Acc Id:
ENSRNOP00000069485 ⟸ ENSRNOT00000086033
RefSeq Acc Id:
XP_038952501 ⟸ XM_039096573
- Peptide Label:
isoform X1
- UniProtKB:
Q8R406 (UniProtKB/Swiss-Prot), Q05030 (UniProtKB/Swiss-Prot), Q925F7 (UniProtKB/Swiss-Prot), A6IXF6 (UniProtKB/TrEMBL), A0A8L2R1W6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063133164 ⟸ XM_063277094
- Peptide Label:
isoform X2
- UniProtKB:
A0A8L2R2J5 (UniProtKB/TrEMBL)
RGD ID: 13700815 Promoter ID: EPDNEW_R11335 Type: initiation region Name: Pdgfrb_2 Description: platelet derived growth factor receptor beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11336 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 56,364,670 - 56,364,730 EPDNEW
RGD ID: 13700812 Promoter ID: EPDNEW_R11336 Type: initiation region Name: Pdgfrb_1 Description: platelet derived growth factor receptor beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11335 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 18 56,364,898 - 56,364,958 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-25
Pdgfrb
platelet derived growth factor receptor beta
Pdgfrb
platelet derived growth factor receptor, beta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Pdgfrb
Platelet-derived growth factor receptor, beta
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
ligand-activated tyrosine kinase
628442
gene_process
autophosphorylates and binds to downstream proteins linking cell surface message to the nucleus, required for the activation of mitogen-activated protein kinases when mediated by platelet-derived growht factor -BB but not required during tyrosine phosphor
628442
