Symbol:
Cav1
Name:
caveolin 1
RGD ID:
2280
Description:
Enables several functions, including enzyme binding activity; syntaxin binding activity; and transmembrane transporter binding activity. Involved in several processes, including negative regulation of cation transmembrane transport; positive regulation of cellular component organization; and regulation of endothelial cell proliferation. Located in several cellular components, including basal plasma membrane; focal adhesion; and peroxisomal membrane. Part of protein-containing complex. Biomarker of several diseases, including artery disease (multiple); brain ischemia (multiple); obesity; osteoarthritis; and sciatic neuropathy. Human ortholog(s) of this gene implicated in several diseases, including breast cancer (multiple); lipodystrophy (multiple); primary open angle glaucoma; primary pulmonary hypertension; and systemic scleroderma (multiple). Orthologous to human CAV1 (caveolin 1); PARTICIPATES IN transforming growth factor-beta signaling pathway; insulin signaling pathway; platelet-derived growth factor signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2-ethoxyethanol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Cav; caveolin; caveolin 1, caveolae protein; Caveolin caveolae protein 22 kDa; caveolin, caveolae protein 1; Caveolin, caveolae protein, 22 kDa; caveolin-1; caveolin-like; LOC100362870; MGC187299
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CAV1 (caveolin 1)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Cav1 (caveolin 1, caveolae protein)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cav1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CAV1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CAV1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cav1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CAV1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CAV1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cav1 (caveolin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ELMOD2 (ELMO domain containing 2)
HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CAV1 (caveolin 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cav1 (caveolin 1, caveolae protein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cav1 (caveolin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
cav-1
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
cav1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Is Marker For:
Strains:
BB/OK
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 46,606,538 - 46,639,616 (+) NCBI GRCr8 mRatBN7.2 4 45,640,624 - 45,673,708 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 45,634,918 - 45,673,705 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 50,634,317 - 50,667,383 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 46,555,310 - 46,588,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 44,969,814 - 45,002,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 44,597,123 - 44,630,206 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 44,597,123 - 44,630,200 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 45,203,494 - 45,236,461 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 42,956,102 - 42,989,057 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 43,098,177 - 43,130,873 (+) NCBI Celera 4 40,918,628 - 40,949,677 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cav1 Rat (-)-anisomycin multiple interactions ISO CAV1 (Homo sapiens) 6480464 wogonin inhibits the reaction [Anisomycin results in increased phosphorylation of CAV1 protein] CTD PMID:23246481 Cav1 Rat (-)-anisomycin increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 Anisomycin results in increased phosphorylation of CAV1 protein CTD PMID:23246481 Cav1 Rat (1->4)-beta-D-glucan multiple interactions ISO Cav1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CAV1 mRNA CTD PMID:36331819 Cav1 Rat (R,R,R)-alpha-tocopherol multiple interactions ISO CAV1 (Homo sapiens) 6480464 alpha-Tocopherol inhibits the reaction [Lysophosphatidylcholines results in increased expression of CAV1 mRNA] CTD PMID:27257344 Cav1 Rat 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane increases expression ISO CAV1 (Homo sapiens) 6480464 2 and 2'-(hydroxynitrosohydrazono)bis-ethanamine results in increased expression of CAV1 protein CTD PMID:19706615 Cav1 Rat 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane multiple interactions ISO CAV1 (Homo sapiens) 6480464 2 more ... CTD PMID:19706615 Cav1 Rat 1,2-dimethylhydrazine decreases expression ISO Cav1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CAV1 mRNA CTD PMID:22206623 Cav1 Rat 1,2-dimethylhydrazine multiple interactions ISO Cav1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CAV1 mRNA CTD PMID:22206623 Cav1 Rat 13-HPODE increases expression ISO CAV1 (Homo sapiens) 6480464 13-hydroperoxy-9 and 11-octadecadienoic acid results in increased expression of CAV1 mRNA CTD PMID:27257344 Cav1 Rat 17beta-estradiol multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CAV1 mRNA and Estradiol inhibits the reaction [Fulvestrant results in decreased expression of CAV1 mRNA] CTD PMID:19619570 and PMID:31646340 Cav1 Rat 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with bisphenol A] results in decreased expression of CAV1 mRNA CTD PMID:35700937 Cav1 Rat 17beta-estradiol increases expression ISO CAV1 (Homo sapiens) 6480464 Estradiol results in increased expression of CAV1 mRNA CTD PMID:31646340 Cav1 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of CAV1 mRNA CTD PMID:27174447 Cav1 Rat 17beta-estradiol increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 Estradiol results in increased phosphorylation of CAV1 protein CTD PMID:18296501 Cav1 Rat 17beta-estradiol decreases expression ISO CAV1 (Homo sapiens) 6480464 Estradiol results in decreased expression of CAV1 mRNA CTD PMID:19619570 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of CAV1 mRNA CTD PMID:19619570 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cav1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CAV1 mRNA CTD PMID:28238261 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cav1 (Mus musculus) 6480464 [TIPARP gene mutant form results in increased susceptibility to Tetrachlorodibenzodioxin] which results in increased expression of CAV1 mRNA CTD PMID:25975270 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO CAV1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CAV1 mRNA CTD PMID:19619570 more ... Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CAV mRNA CTD PMID:15358164 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CAV mRNA CTD PMID:15358164 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CAV1 mRNA CTD PMID:22298810 and PMID:34747641 Cav1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO CAV1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of CAV1 mRNA CTD PMID:22298810 Cav1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cav1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cav1 Rat 2,6-dimethoxyphenol multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 and 3-dimethyl ether] results in increased expression of and affects the localization of CAV1 protein CTD PMID:38598786 Cav1 Rat 2-ethoxyethanol increases expression EXP 6480464 2-ethoxyethanol results in increased expression of CAV mRNA CTD PMID:19643169 Cav1 Rat 2-methoxyethanol affects expression EXP 6480464 methyl cellosolve affects the expression of CAV mRNA CTD PMID:19643169 Cav1 Rat 22-Hydroxycholesterol increases expression ISO CAV1 (Homo sapiens) 6480464 22-hydroxycholesterol results in increased expression of CAV1 mRNA CTD PMID:15314095 Cav1 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 affects the reaction [3 more ... CTD PMID:19265715 more ... Cav1 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions ISO CAV1 (Homo sapiens) 6480464 3 more ... CTD PMID:24709675 Cav1 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Cav1 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Cav1 (Mus musculus) 6480464 3 more ... CTD PMID:18786521 and PMID:20406653 Cav1 Rat 3,3',4,4'-tetrachlorobiphenyl increases expression ISO Cav1 (Mus musculus) 6480464 3 more ... CTD PMID:18786521 Cav1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Cav1 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of CAV1 mRNA CTD PMID:25172293 Cav1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Cav1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of CAV1 mRNA CTD PMID:16054899 Cav1 Rat 3-Nitrobenzanthrone increases expression ISO CAV1 (Homo sapiens) 6480464 3-nitrobenzanthrone results in increased expression of CAV1 mRNA CTD PMID:34036453 Cav1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of CAV1 mRNA CTD PMID:25380136 Cav1 Rat 4,4'-sulfonyldiphenol increases expression ISO Cav1 (Mus musculus) 6480464 bisphenol S results in increased expression of CAV1 mRNA CTD PMID:30951980 and PMID:39298647 Cav1 Rat 4,4'-sulfonyldiphenol increases expression ISO CAV1 (Homo sapiens) 6480464 bisphenol S results in increased expression of CAV1 protein CTD PMID:31945527 Cav1 Rat 4,4'-sulfonyldiphenol decreases methylation ISO CAV1 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CAV1 gene CTD PMID:31601247 Cav1 Rat 5-aza-2'-deoxycytidine increases expression ISO CAV1 (Homo sapiens) 6480464 Decitabine results in increased expression of CAV1 mRNA CTD PMID:16367923 Cav1 Rat 5-aza-2'-deoxycytidine multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Decitabine co-treated with Depsipeptides] results in decreased expression of CAV1 mRNA CTD PMID:17064661 Cav1 Rat 5-fluorouracil affects response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 Cav1 Rat 5-fluorouracil increases expression ISO CAV1 (Homo sapiens) 6480464 Fluorouracil results in increased expression of CAV1 mRNA CTD PMID:24737281 Cav1 Rat 5-fluorouracil decreases expression ISO CAV1 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of CAV1 protein CTD PMID:15352031 Cav1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of CAV1 mRNA CTD PMID:24780913 and PMID:30047161 Cav1 Rat acetylcholine multiple interactions ISO Cav1 (Mus musculus) 6480464 Sodium and Dietary affects the reaction [CAV1 protein affects the susceptibility to Acetylcholine] CTD PMID:18178722 Cav1 Rat acetylsalicylic acid decreases expression EXP 6480464 Aspirin results in decreased expression of CAV1 mRNA CTD PMID:12800193 Cav1 Rat acrolein multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CAV1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of CAV1 mRNA CTD PMID:32699268 Cav1 Rat actinomycin D multiple interactions ISO CAV1 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [rosiglitazone results in increased expression of CAV1 mRNA] CTD PMID:15314095 Cav1 Rat aflatoxin B1 increases expression ISO CAV1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CAV1 mRNA CTD PMID:27153756 Cav1 Rat aldehydo-D-glucose decreases expression ISO CAV1 (Homo sapiens) 6480464 Glucose results in decreased expression of CAV1 mRNA and Glucose results in decreased expression of CAV1 protein CTD PMID:19816600 and PMID:31655124 Cav1 Rat aldehydo-D-glucose multiple interactions ISO CAV1 (Homo sapiens) 6480464 EGF protein inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] and Simvastatin inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] CTD PMID:19816600 Cav1 Rat all-trans-retinoic acid decreases expression ISO CAV1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of CAV1 mRNA CTD PMID:21934132 Cav1 Rat alpha-pinene multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CAV1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of CAV1 mRNA CTD PMID:32699268 Cav1 Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CAV1 mRNA CTD PMID:35163327 Cav1 Rat aminoguanidine decreases expression ISO CAV1 (Homo sapiens) 6480464 pimagedine results in decreased expression of CAV1 protein CTD PMID:19706615 Cav1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of CAV1 mRNA CTD PMID:30047161 Cav1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CAV1 mRNA CTD PMID:16483693 Cav1 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of CAV1 protein CTD PMID:16483693 Cav1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of CAV1 mRNA CTD PMID:30779732 Cav1 Rat amphibole asbestos increases expression EXP 6480464 Asbestos and Amphibole results in increased expression of CAV1 mRNA CTD PMID:22352330 Cav1 Rat antirheumatic drug increases expression ISO CAV1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of CAV1 mRNA CTD PMID:24449571 Cav1 Rat Aroclor 1254 decreases expression ISO Cav1 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of CAV1 mRNA CTD PMID:23650126 Cav1 Rat arsane multiple interactions ISO CAV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAV1 mRNA CTD PMID:39836092 Cav1 Rat arsenic atom multiple interactions ISO CAV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAV1 mRNA CTD PMID:39836092 Cav1 Rat arsenite(3-) multiple interactions ISO CAV1 (Homo sapiens) 6480464 arsenite inhibits the reaction [Fulvestrant results in decreased expression of CAV1 mRNA] more ... CTD PMID:12640124 more ... Cav1 Rat arsenite(3-) decreases expression ISO CAV1 (Homo sapiens) 6480464 arsenite results in decreased expression of CAV1 mRNA CTD PMID:31646340 Cav1 Rat arsenite(3-) multiple interactions ISO Cav1 (Mus musculus) 6480464 tyrphostin 25 inhibits the reaction [arsenite results in increased phosphorylation of CAV1 protein] CTD PMID:14511371 Cav1 Rat arsenite(3-) increases phosphorylation ISO Cav1 (Mus musculus) 6480464 arsenite results in increased phosphorylation of CAV1 protein CTD PMID:14511371 Cav1 Rat arsenous acid decreases expression ISO CAV1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CAV1 mRNA and Arsenic Trioxide results in decreased expression of CAV1 protein CTD PMID:15725085 more ... Cav1 Rat arsenous acid increases expression ISO CAV1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CAV1 mRNA and Arsenic Trioxide results in increased expression of CAV1 protein CTD PMID:17512576 and PMID:22521957 Cav1 Rat atrazine increases expression ISO CAV1 (Homo sapiens) 6480464 Atrazine results in increased expression of CAV1 mRNA CTD PMID:22378314 Cav1 Rat benzo[a]pyrene increases expression ISO CAV1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CAV1 protein CTD PMID:26657896 Cav1 Rat benzo[a]pyrene increases methylation ISO CAV1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of CAV1 promoter CTD PMID:27901495 Cav1 Rat benzo[a]pyrene multiple interactions ISO Cav1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CAV1 mRNA CTD PMID:27858113 Cav1 Rat benzo[a]pyrene increases expression ISO Cav1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of CAV1 mRNA CTD PMID:22228805 and PMID:32417428 Cav1 Rat benzo[a]pyrene decreases expression ISO Cav1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CAV1 mRNA CTD PMID:19770486 Cav1 Rat benzo[a]pyrene decreases expression ISO CAV1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of CAV1 mRNA CTD PMID:20106945 Cav1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO CAV1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Cav1 Rat benzo[b]fluoranthene multiple interactions ISO Cav1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CAV1 mRNA CTD PMID:27858113 Cav1 Rat beta-carotene decreases expression ISO CAV1 (Homo sapiens) 6480464 beta Carotene results in decreased expression of CAV1 protein CTD PMID:26733226 Cav1 Rat beta-lapachone decreases expression ISO CAV1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CAV1 mRNA CTD PMID:38218311 Cav1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CAV mRNA CTD PMID:18164116 Cav1 Rat bis(2-ethylhexyl) phthalate increases expression ISO CAV1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of CAV1 mRNA CTD PMID:31163220 Cav1 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Cav1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of CAV1 mRNA CTD PMID:34319233 Cav1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Cav1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CAV1 mRNA CTD PMID:33162236 and PMID:33754040 Cav1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of CAV1 mRNA CTD PMID:25181051 Cav1 Rat bisphenol A multiple interactions ISO CAV1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of CAV1 gene CTD PMID:31601247 Cav1 Rat bisphenol A increases expression ISO CAV1 (Homo sapiens) 6480464 bisphenol A results in increased expression of CAV1 mRNA and bisphenol A results in increased expression of CAV1 protein CTD PMID:32028606 and PMID:34186270 Cav1 Rat bisphenol A affects methylation ISO CAV1 (Homo sapiens) 6480464 bisphenol A affects the methylation of CAV1 gene CTD PMID:31601247 Cav1 Rat bisphenol A decreases expression ISO Cav1 (Mus musculus) 6480464 bisphenol A results in decreased expression of CAV1 mRNA CTD PMID:37105096 Cav1 Rat bisphenol A increases expression ISO Cav1 (Mus musculus) 6480464 bisphenol A results in increased expression of CAV1 mRNA CTD PMID:30951980 Cav1 Rat bisphenol A multiple interactions EXP 6480464 [Estradiol co-treated with bisphenol A] results in decreased expression of CAV1 mRNA more ... CTD PMID:28067316 and PMID:35700937 Cav1 Rat bisphenol A decreases acetylation EXP 6480464 bisphenol A results in decreased acetylation of CAV1 protein CTD PMID:28067316 Cav1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CAV1 mRNA and bisphenol A results in decreased expression of CAV1 protein CTD PMID:27174447 more ... Cav1 Rat Bisphenol A diglycidyl ether multiple interactions ISO CAV1 (Homo sapiens) 6480464 bisphenol A diglycidyl ether inhibits the reaction [Rosiglitazone results in increased expression of CAV1 protein] CTD PMID:16806087 Cav1 Rat bisphenol AF increases expression ISO CAV1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of CAV1 protein CTD PMID:34186270 Cav1 Rat Bisphenol B increases expression ISO CAV1 (Homo sapiens) 6480464 bisphenol B results in increased expression of CAV1 protein CTD PMID:34186270 Cav1 Rat bisphenol F increases expression ISO Cav1 (Mus musculus) 6480464 bisphenol F results in increased expression of CAV1 mRNA CTD PMID:30951980 Cav1 Rat bisphenol F increases expression ISO CAV1 (Homo sapiens) 6480464 bisphenol F results in increased expression of CAV1 protein CTD PMID:34186270 Cav1 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of CAV1 protein CTD PMID:25933445 Cav1 Rat bleomycin A2 multiple interactions ISO CAV1 (Homo sapiens) 6480464 yupingfeng inhibits the reaction [Bleomycin results in decreased expression of CAV1 mRNA] and yupingfeng inhibits the reaction [Bleomycin results in decreased expression of CAV1 protein] CTD PMID:37898439 Cav1 Rat bleomycin A2 decreases expression ISO CAV1 (Homo sapiens) 6480464 Bleomycin results in decreased expression of CAV1 mRNA and Bleomycin results in decreased expression of CAV1 protein CTD PMID:37898439 Cav1 Rat butan-1-ol multiple interactions ISO CAV1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of CAV1 mRNA CTD PMID:29432896 Cav1 Rat butyric acid decreases expression EXP 6480464 Butyric Acid results in decreased expression of CAV1 mRNA CTD PMID:12800193 Cav1 Rat cadmium atom multiple interactions ISO Cav1 (Mus musculus) 6480464 Cadmium promotes the reaction [HMOX1 protein binds to CAV1 protein] CTD PMID:14658758 Cav1 Rat cadmium atom multiple interactions ISO CAV1 (Homo sapiens) 6480464 Cadmium inhibits the reaction [Fulvestrant results in decreased expression of CAV1 mRNA] and Fulvestrant inhibits the reaction [Cadmium results in decreased expression of CAV1 mRNA] CTD PMID:31646340 Cav1 Rat cadmium atom decreases expression ISO CAV1 (Homo sapiens) 6480464 Cadmium results in decreased expression of CAV1 mRNA CTD PMID:31646340 Cav1 Rat cadmium dichloride increases expression ISO CAV1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CAV1 mRNA CTD PMID:26472689 and PMID:38382870 Cav1 Rat cadmium dichloride decreases expression ISO CAV1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of CAV1 mRNA CTD PMID:38568856 Cav1 Rat cadmium nitrate decreases expression ISO CAV1 (Homo sapiens) 6480464 cadmium nitrate results in decreased expression of CAV1 protein CTD PMID:19061949 Cav1 Rat caffeine increases expression ISO CAV1 (Homo sapiens) 6480464 Caffeine results in increased expression of CAV1 protein CTD PMID:31195006 Cav1 Rat calcitriol multiple interactions ISO CAV1 (Homo sapiens) 6480464 Calcitriol results in increased localization of [VDR protein co-treated with CAV1 protein] CTD PMID:20371703 Cav1 Rat calcium atom affects transport ISO Cav1 (Mus musculus) 6480464 CAV1 protein affects the transport of Calcium CTD PMID:16428350 Cav1 Rat calcium(0) affects transport ISO Cav1 (Mus musculus) 6480464 CAV1 protein affects the transport of Calcium CTD PMID:16428350 Cav1 Rat camptothecin decreases methylation ISO CAV1 (Homo sapiens) 6480464 Camptothecin results in decreased methylation of CAV1 gene CTD PMID:30720231 Cav1 Rat captan decreases expression ISO Cav1 (Mus musculus) 6480464 Captan results in decreased expression of CAV1 mRNA CTD PMID:31558096 Cav1 Rat carbamazepine affects expression ISO CAV1 (Homo sapiens) 6480464 Carbamazepine affects the expression of CAV1 mRNA CTD PMID:25979313 Cav1 Rat carbon nanotube decreases expression ISO Cav1 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of CAV1 mRNA CTD PMID:21624382 and PMID:25554681 Cav1 Rat carboxy-PTIO decreases expression ISO CAV1 (Homo sapiens) 6480464 1 more ... CTD PMID:19706615 Cav1 Rat celecoxib increases expression ISO CAV1 (Homo sapiens) 6480464 Celecoxib results in increased expression of CAV1 protein CTD PMID:18848576 Cav1 Rat CGP 52608 multiple interactions ISO CAV1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CAV1 gene] CTD PMID:28238834 Cav1 Rat chlorohydrocarbon multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of CAV1 mRNA CTD PMID:30744511 Cav1 Rat chloropicrin affects expression ISO CAV1 (Homo sapiens) 6480464 chloropicrin affects the expression of CAV1 mRNA CTD PMID:26352163 Cav1 Rat chloropicrin decreases expression ISO CAV1 (Homo sapiens) 6480464 chloropicrin results in decreased expression of CAV1 mRNA CTD PMID:28476498 Cav1 Rat cholesterol increases transport ISO CAV1 (Homo sapiens) 6480464 CAV1 protein results in increased transport of Cholesterol CTD PMID:12640124 Cav1 Rat cholesterol multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 protein affects the reaction [Cholesterol affects the localization of APOE protein] CTD PMID:21169230 Cav1 Rat cholesterol multiple interactions EXP 6480464 Cholesterol promotes the reaction [APOE protein binds to CAV1 protein] CTD PMID:21169230 Cav1 Rat chromium atom multiple interactions EXP 6480464 [Niacin co-treated with Chromium] inhibits the reaction [CAV1 protein binds to NOS3 protein] and [Niacin co-treated with Chromium] results in decreased expression of CAV1 protein CTD PMID:19027847 Cav1 Rat chrysene decreases expression ISO Cav1 (Mus musculus) 6480464 chrysene results in decreased expression of CAV1 mRNA CTD PMID:26377693 Cav1 Rat chrysene multiple interactions ISO Cav1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CAV1 mRNA CTD PMID:27858113 Cav1 Rat ciprofloxacin increases expression ISO CAV1 (Homo sapiens) 6480464 Ciprofloxacin results in increased expression of CAV1 protein CTD PMID:26947806 Cav1 Rat cisplatin affects response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Cav1 Rat cisplatin increases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 mRNA results in increased susceptibility to Cisplatin and CAV1 protein results in increased susceptibility to Cisplatin CTD PMID:35622184 Cav1 Rat cisplatin multiple interactions ISO CAV1 (Homo sapiens) 6480464 [ACE2 protein promotes the reaction [CAV1 protein results in increased expression of CYP3A4 protein]] which results in decreased susceptibility to Cisplatin more ... CTD PMID:30871063 and PMID:35622184 Cav1 Rat cisplatin increases expression ISO CAV1 (Homo sapiens) 6480464 Cisplatin results in increased expression of CAV1 mRNA CTD PMID:27392435 Cav1 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of CAV1 mRNA CTD PMID:22023808 Cav1 Rat cisplatin affects expression ISO Cav1 (Mus musculus) 6480464 Cisplatin affects the expression of CAV1 mRNA CTD PMID:21151649 Cav1 Rat clofibrate affects expression ISO CAV1 (Homo sapiens) 6480464 Clofibrate affects the expression of CAV1 protein CTD PMID:17961437 Cav1 Rat cobalt dichloride decreases expression ISO CAV1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of CAV1 mRNA CTD PMID:19320972 Cav1 Rat cordycepin multiple interactions ISO CAV1 (Homo sapiens) 6480464 [[cordycepin results in increased expression of CAV1 protein] which results in decreased expression of DUSP5 protein] which results in increased phosphorylation of MAPK8 protein CTD PMID:28099944 Cav1 Rat cordycepin increases expression ISO Cav1 (Mus musculus) 6480464 cordycepin results in increased expression of CAV1 protein CTD PMID:28099944 Cav1 Rat cordycepin affects expression ISO CAV1 (Homo sapiens) 6480464 cordycepin affects the expression of CAV1 mRNA and cordycepin affects the expression of CAV1 protein CTD PMID:28099944 Cav1 Rat corosolic acid decreases expression ISO CAV1 (Homo sapiens) 6480464 corosolic acid results in decreased expression of CAV1 mRNA CTD PMID:37939859 Cav1 Rat coumestrol multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of CAV1 mRNA CTD PMID:19167446 Cav1 Rat coumestrol increases expression ISO CAV1 (Homo sapiens) 6480464 Coumestrol results in increased expression of CAV1 mRNA CTD PMID:19167446 Cav1 Rat crocidolite asbestos decreases expression ISO Cav1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of CAV1 mRNA CTD PMID:29279043 Cav1 Rat cumene decreases expression ISO Cav1 (Mus musculus) 6480464 cumene results in decreased expression of CAV1 mRNA CTD PMID:18648096 Cav1 Rat cycloheximide multiple interactions ISO CAV1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [rosiglitazone results in increased expression of CAV1 mRNA] CTD PMID:15314095 Cav1 Rat cyclosporin A decreases expression ISO CAV1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CAV1 mRNA CTD PMID:20106945 and PMID:27989131 Cav1 Rat cylindrospermopsin increases expression ISO CAV1 (Homo sapiens) 6480464 cylindrospermopsin results in increased expression of CAV1 mRNA CTD PMID:24921660 Cav1 Rat cyproconazole decreases expression ISO CAV1 (Homo sapiens) 6480464 cyproconazole results in decreased expression of CAV1 mRNA CTD PMID:26238599 Cav1 Rat D-glucose multiple interactions ISO CAV1 (Homo sapiens) 6480464 EGF protein inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] and Simvastatin inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] CTD PMID:19816600 Cav1 Rat D-glucose decreases expression ISO CAV1 (Homo sapiens) 6480464 Glucose results in decreased expression of CAV1 mRNA and Glucose results in decreased expression of CAV1 protein CTD PMID:19816600 and PMID:31655124 Cav1 Rat depsipeptide multiple interactions ISO CAV1 (Homo sapiens) 6480464 [decitabine co-treated with Depsipeptides] results in decreased expression of CAV1 mRNA CTD PMID:17064661 Cav1 Rat desferrioxamine B increases expression ISO CAV1 (Homo sapiens) 6480464 Deferoxamine results in increased expression of CAV1 protein CTD PMID:16927372 Cav1 Rat dexamethasone multiple interactions ISO Cav1 (Mus musculus) 6480464 [Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of CAV1 mRNA more ... CTD PMID:14984747 and PMID:16054899 Cav1 Rat dexamethasone multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Dexamethasone results in increased expression of CAV1 protein] which results in decreased susceptibility to VEGFA protein CTD PMID:23426970 Cav1 Rat dexamethasone increases expression ISO CAV1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of CAV1 mRNA and Dexamethasone results in increased expression of CAV1 protein CTD PMID:23426970 and PMID:25047013 Cav1 Rat diallyl disulfide multiple interactions ISO CAV1 (Homo sapiens) 6480464 diallyl disulfide promotes the reaction [NOS3 protein binds to CAV1 protein] CTD PMID:20229525 Cav1 Rat diallyl trisulfide multiple interactions ISO CAV1 (Homo sapiens) 6480464 diallyl trisulfide promotes the reaction [NOS3 protein binds to CAV1 protein] CTD PMID:20229525 Cav1 Rat diarsenic trioxide increases expression ISO CAV1 (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of CAV1 mRNA and Arsenic Trioxide results in increased expression of CAV1 protein CTD PMID:17512576 and PMID:22521957 Cav1 Rat diarsenic trioxide decreases expression ISO CAV1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of CAV1 mRNA and Arsenic Trioxide results in decreased expression of CAV1 protein CTD PMID:15725085 more ... Cav1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of CAV1 mRNA CTD PMID:21266533 Cav1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of CAV1 mRNA CTD PMID:21658437 Cav1 Rat diethylstilbestrol increases expression ISO CAV1 (Homo sapiens) 6480464 Diethylstilbestrol results in increased expression of CAV1 mRNA CTD PMID:36621641 Cav1 Rat dioxygen multiple interactions ISO Cav1 (Mus musculus) 6480464 [CAV1 gene mutant form results in increased susceptibility to Oxygen deficiency] which results in increased expression of CYBB mRNA more ... CTD PMID:24835767 Cav1 Rat dioxygen increases expression ISO CAV1 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of CAV1 mRNA and Oxygen deficiency results in increased expression of CAV1 protein CTD PMID:18717816 Cav1 Rat dioxygen multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Oxygen deficiency co-treated with 1-hydroxy-2-oxo-3 more ... CTD PMID:18717816 Cav1 Rat dioxygen multiple interactions EXP 6480464 [Semaxinib co-treated with Oxygen deficiency] results in decreased expression of CAV1 mRNA more ... CTD PMID:16698853 and PMID:24835767 Cav1 Rat dioxygen increases response to substance ISO Cav1 (Mus musculus) 6480464 CAV1 gene mutant form results in increased susceptibility to Oxygen deficiency CTD PMID:24835767 Cav1 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of CAV1 mRNA CTD PMID:21551480 and PMID:25152437 Cav1 Rat dorsomorphin multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cav1 Rat doxorubicin affects response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Cav1 Rat doxorubicin increases expression ISO Cav1 (Mus musculus) 6480464 Doxorubicin results in increased expression of CAV1 mRNA CTD PMID:22008532 Cav1 Rat equol multiple interactions ISO CAV1 (Homo sapiens) 6480464 Equol inhibits the reaction [NOS3 protein binds to CAV1 protein] CTD PMID:16840783 Cav1 Rat ethanol increases expression ISO CAV1 (Homo sapiens) 6480464 Ethanol results in increased expression of CAV1 mRNA CTD PMID:15963989 Cav1 Rat ethanol multiple interactions ISO Cav1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of CAV1 mRNA CTD PMID:30517762 Cav1 Rat ethyl methanesulfonate decreases expression ISO CAV1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of CAV1 mRNA CTD PMID:23649840 Cav1 Rat fenofibrate increases expression ISO CAV1 (Homo sapiens) 6480464 Fenofibrate results in increased expression of CAV1 mRNA CTD PMID:15314095 Cav1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of CAV1 mRNA CTD PMID:34044035 Cav1 Rat folic acid increases expression ISO Cav1 (Mus musculus) 6480464 Folic Acid results in increased expression of CAV1 mRNA CTD PMID:25629700 Cav1 Rat folic acid multiple interactions ISO Cav1 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of CAV1 mRNA CTD PMID:22206623 Cav1 Rat folpet decreases expression ISO Cav1 (Mus musculus) 6480464 folpet results in decreased expression of CAV1 mRNA CTD PMID:31558096 Cav1 Rat formaldehyde decreases expression ISO CAV1 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of CAV1 mRNA CTD PMID:23649840 Cav1 Rat fulvestrant multiple interactions EXP 6480464 fulvestrant inhibits the reaction [Raloxifene Hydrochloride results in increased expression of CAV1 mRNA] and fulvestrant inhibits the reaction [Raloxifene Hydrochloride results in increased expression of CAV1 protein] CTD PMID:17091190 Cav1 Rat fulvestrant multiple interactions ISO CAV1 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] affects the methylation of CAV1 gene more ... CTD PMID:31601247 and PMID:31646340 Cav1 Rat fulvestrant decreases expression ISO CAV1 (Homo sapiens) 6480464 Fulvestrant results in decreased expression of CAV1 mRNA CTD PMID:31646340 Cav1 Rat furan increases expression EXP 6480464 furan results in increased expression of CAV1 mRNA CTD PMID:27387713 Cav1 Rat furfural multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of CAV1 protein CTD PMID:38598786 Cav1 Rat gefitinib increases expression ISO CAV1 (Homo sapiens) 6480464 gefitinib results in increased expression of CAV1 mRNA and gefitinib results in increased expression of CAV1 protein CTD PMID:19288272 Cav1 Rat genistein decreases expression ISO CAV1 (Homo sapiens) 6480464 Genistein results in decreased expression of CAV1 mRNA CTD PMID:22228119 Cav1 Rat geranylgeraniol multiple interactions ISO CAV1 (Homo sapiens) 6480464 geranylgeraniol inhibits the reaction [rosiglitazone results in increased expression of CAV1 mRNA] CTD PMID:15314095 Cav1 Rat glucose multiple interactions ISO CAV1 (Homo sapiens) 6480464 EGF protein inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] and Simvastatin inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] CTD PMID:19816600 Cav1 Rat glucose decreases expression ISO CAV1 (Homo sapiens) 6480464 Glucose results in decreased expression of CAV1 mRNA and Glucose results in decreased expression of CAV1 protein CTD PMID:19816600 and PMID:31655124 Cav1 Rat Glutathione ethyl ester multiple interactions ISO CAV1 (Homo sapiens) 6480464 S-ethyl glutathione inhibits the reaction [2 more ... CTD PMID:35349355 Cav1 Rat glycidyl methacrylate increases expression ISO CAV1 (Homo sapiens) 6480464 glycidyl methacrylate results in increased expression of CAV1 protein CTD PMID:36641056 Cav1 Rat hexadecanoic acid decreases phosphorylation ISO CAV1 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of CAV1 protein CTD PMID:28073184 Cav1 Rat hydrogen peroxide multiple interactions ISO CAV1 (Homo sapiens) 6480464 Hydrogen Peroxide inhibits the reaction [Acetylcysteine results in increased ubiquitination of and results in increased degradation of CAV1 protein] more ... CTD PMID:12640124 more ... Cav1 Rat hydrogen peroxide increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased phosphorylation of CAV1 protein CTD PMID:23246481 and PMID:25512378 Cav1 Rat hydrogen peroxide increases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein results in increased susceptibility to Hydrogen Peroxide CTD PMID:12640124 Cav1 Rat hydrogen peroxide increases expression ISO Cav1 (Mus musculus) 6480464 Hydrogen Peroxide results in increased expression of CAV1 mRNA and Hydrogen Peroxide results in increased expression of CAV1 protein CTD PMID:12134086 and PMID:17108117 Cav1 Rat hydrogen peroxide multiple interactions ISO Cav1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with CAV1 protein] results in increased expression of CDKN1A protein more ... CTD PMID:12134086 more ... Cav1 Rat hydrogen peroxide increases expression ISO CAV1 (Homo sapiens) 6480464 Hydrogen Peroxide results in increased expression of CAV1 mRNA and Hydrogen Peroxide results in increased expression of CAV1 protein CTD PMID:18385095 Cav1 Rat inulin multiple interactions ISO Cav1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of CAV1 mRNA CTD PMID:36331819 Cav1 Rat iron atom affects localization EXP 6480464 Iron affects the localization of CAV1 protein CTD PMID:17172471 Cav1 Rat iron(0) affects localization EXP 6480464 Iron affects the localization of CAV1 protein CTD PMID:17172471 Cav1 Rat iron(2+) sulfate (anhydrous) affects localization EXP 6480464 ferrous sulfate affects the localization of CAV1 protein CTD PMID:17172471 Cav1 Rat isoprenaline multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 protein promotes the reaction [Isoproterenol results in increased activity of ADRB2 protein] CTD PMID:18820136 Cav1 Rat ivermectin decreases expression ISO CAV1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of CAV1 protein CTD PMID:32959892 Cav1 Rat ketoconazole increases expression ISO CAV1 (Homo sapiens) 6480464 Ketoconazole results in increased expression of CAV1 mRNA CTD PMID:36621641 Cav1 Rat L-ascorbic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 Ascorbic Acid inhibits the reaction [2 more ... CTD PMID:35349355 Cav1 Rat lead diacetate decreases expression EXP 6480464 lead acetate results in decreased expression of CAV1 mRNA CTD PMID:11578147 Cav1 Rat lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of CAV1 mRNA CTD PMID:22641619 Cav1 Rat lipopolysaccharide multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of CAV1 mRNA more ... CTD PMID:24835767 more ... Cav1 Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of CAV1 protein modified form CTD PMID:26357463 Cav1 Rat lipopolysaccharide multiple interactions EXP 6480464 4-amino-5-(4-methylphenyl)-7-(tert-butyl)pyrazolo(3 more ... CTD PMID:26357463 Cav1 Rat lipopolysaccharide affects expression ISO Cav1 (Mus musculus) 6480464 Lipopolysaccharides affects the expression of CAV1 mRNA and Lipopolysaccharides affects the expression of CAV1 protein CTD PMID:10948129 Cav1 Rat lipopolysaccharide multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 gene mutant form promotes the reaction [Lipopolysaccharides results in increased expression of CYBB mRNA] and CAV1 protein inhibits the reaction [Lipopolysaccharides results in increased expression of CYBB mRNA] CTD PMID:24835767 Cav1 Rat lipopolysaccharide increases expression ISO CAV1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of CAV1 protein modified form CTD PMID:26357463 Cav1 Rat lithocholic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 Lithocholic Acid results in increased localization of [VDR protein co-treated with CAV1 protein] CTD PMID:20371703 Cav1 Rat lysophosphatidylcholine multiple interactions ISO CAV1 (Homo sapiens) 6480464 alpha-Tocopherol inhibits the reaction [Lysophosphatidylcholines results in increased expression of CAV1 mRNA] more ... CTD PMID:27257344 Cav1 Rat lysophosphatidylcholine increases expression ISO CAV1 (Homo sapiens) 6480464 Lysophosphatidylcholines results in increased expression of CAV1 mRNA and Lysophosphatidylcholines results in increased expression of CAV1 protein CTD PMID:27257344 Cav1 Rat manganese atom decreases expression ISO Cav1 (Mus musculus) 6480464 Manganese results in decreased expression of CAV1 mRNA and Manganese results in decreased expression of CAV1 protein CTD PMID:23499988 and PMID:23597857 Cav1 Rat manganese(0) decreases expression ISO Cav1 (Mus musculus) 6480464 Manganese results in decreased expression of CAV1 mRNA and Manganese results in decreased expression of CAV1 protein CTD PMID:23499988 and PMID:23597857 Cav1 Rat mercury dibromide increases expression ISO CAV1 (Homo sapiens) 6480464 mercuric bromide results in increased expression of CAV1 mRNA CTD PMID:26272509 Cav1 Rat mercury dibromide multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CAV1 mRNA CTD PMID:27188386 Cav1 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of CAV1 mRNA CTD PMID:32035215 Cav1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of CAV1 mRNA CTD PMID:30047161 Cav1 Rat methotrexate decreases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 mRNA results in decreased susceptibility to Methotrexate CTD PMID:18694510 Cav1 Rat methotrexate increases expression ISO CAV1 (Homo sapiens) 6480464 Methotrexate results in increased expression of CAV1 mRNA CTD PMID:21678067 Cav1 Rat methotrexate affects response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 mRNA affects the susceptibility to Methotrexate CTD PMID:22753658 Cav1 Rat methoxychlor increases methylation EXP 6480464 Methoxychlor results in increased methylation of CAV1 gene CTD PMID:23303685 Cav1 Rat methyl beta-cyclodextrin multiple interactions EXP 6480464 methyl-beta-cyclodextrin inhibits the reaction [Lipopolysaccharides results in increased expression of CAV1 protein modified form] CTD PMID:26357463 Cav1 Rat methyl beta-cyclodextrin multiple interactions ISO Cav1 (Mus musculus) 6480464 methyl-beta-cyclodextrin inhibits the reaction [[lipopolysaccharide and Escherichia coli O111 B4 co-treated with IFNG protein] affects the localization of CAV1 protein] CTD PMID:20060843 Cav1 Rat methyl methanesulfonate decreases expression ISO CAV1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of CAV1 mRNA CTD PMID:23649840 Cav1 Rat methylisothiazolinone decreases expression ISO CAV1 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in decreased expression of CAV1 protein CTD PMID:29110394 Cav1 Rat methylmercury chloride multiple interactions EXP 6480464 [Hydrocarbons and Chlorinated co-treated with Polychlorinated Biphenyls co-treated with methylmercuric chloride] results in increased expression of CAV1 mRNA CTD PMID:30744511 Cav1 Rat mifepristone multiple interactions ISO CAV1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of CAV1 mRNA] CTD PMID:15674352 Cav1 Rat miquelianin multiple interactions ISO CAV1 (Homo sapiens) 6480464 quercetin 3-O-glucuronide inhibits the reaction [Lysophosphatidylcholines results in increased expression of CAV1 mRNA] CTD PMID:27257344 Cav1 Rat monocrotaline decreases expression EXP 6480464 Monocrotaline results in decreased expression of CAV1 mRNA and Monocrotaline results in decreased expression of CAV1 protein CTD PMID:24835767 and PMID:25275723 Cav1 Rat monocrotaline multiple interactions EXP 6480464 NCP-2454 inhibits the reaction [Monocrotaline results in decreased expression of CAV1 protein] CTD PMID:25275723 Cav1 Rat N-[3-(aminomethyl)benzyl]acetamidine multiple interactions ISO CAV1 (Homo sapiens) 6480464 N-(3-(aminomethyl)benzyl)acetamidine inhibits the reaction [Oxygen deficiency results in increased expression of CAV1 protein] CTD PMID:18717816 Cav1 Rat N-acetyl-L-cysteine decreases expression ISO CAV1 (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of CAV1 CTD PMID:21148404 Cav1 Rat N-acetyl-L-cysteine multiple interactions ISO CAV1 (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [2 more ... CTD PMID:18507034 more ... Cav1 Rat N-acetylsphingosine multiple interactions ISO CAV1 (Homo sapiens) 6480464 N-acetylsphingosine inhibits the reaction [CAV1 protein results in increased phosphorylation of AKT1 protein] CTD PMID:12640124 Cav1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Cav1 (Mus musculus) 6480464 [MYBPC3 protein affects the susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde] which results in decreased expression of CAV1 mRNA CTD PMID:25566086 Cav1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO CAV1 (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of CAV1 protein CTD PMID:19706615 Cav1 Rat N-methyl-D-aspartic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the reaction [N-Methylaspartate results in decreased expression of TJP1 mRNA] more ... CTD PMID:35257817 Cav1 Rat N-methyl-D-aspartic acid increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 N-Methylaspartate results in increased phosphorylation of CAV1 protein CTD PMID:35257817 Cav1 Rat N-nitrosodiethylamine increases expression ISO CAV1 (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of CAV1 mRNA CTD PMID:21527772 Cav1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of CAV mRNA CTD PMID:18164116 Cav1 Rat N-nitrosodiethylamine increases expression ISO Cav1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of CAV1 mRNA CTD PMID:24535843 Cav1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of CAV1 mRNA and Dimethylnitrosamine results in increased expression of CAV1 protein CTD PMID:18364076 and PMID:25380136 Cav1 Rat N-nitrosodimethylamine multiple interactions EXP 6480464 Dimethylnitrosamine promotes the reaction [CAV1 protein binds to NOS3 protein] CTD PMID:18364076 Cav1 Rat nicotinic acid multiple interactions EXP 6480464 [Niacin co-treated with Chromium] inhibits the reaction [CAV1 protein binds to NOS3 protein] and [Niacin co-treated with Chromium] results in decreased expression of CAV1 protein CTD PMID:19027847 Cav1 Rat nimesulide increases expression ISO CAV1 (Homo sapiens) 6480464 nimesulide results in increased expression of CAV1 protein CTD PMID:18848576 Cav1 Rat nitric oxide multiple interactions ISO CAV1 (Homo sapiens) 6480464 [resveratrol promotes the reaction [ESR1 protein binds to CAV1 protein binds to SRC protein]] which results in increased abundance of Nitric Oxide more ... CTD PMID:18296501 and PMID:19706615 Cav1 Rat nitric oxide increases expression ISO CAV1 (Homo sapiens) 6480464 Nitric Oxide results in increased expression of CAV1 protein CTD PMID:19706615 Cav1 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of CAV1 mRNA and nitrofen results in decreased expression of CAV1 protein CTD PMID:25078423 Cav1 Rat nitroprusside multiple interactions ISO CAV1 (Homo sapiens) 6480464 Nitroprusside results in decreased ubiquitination of and results in decreased degradation of CAV1 protein and Nitroprusside results in increased metabolism of and results in increased stability of CAV1 protein CTD PMID:19706615 Cav1 Rat nitroprusside increases expression ISO CAV1 (Homo sapiens) 6480464 Nitroprusside results in increased expression of CAV1 protein CTD PMID:19706615 Cav1 Rat NS-398 decreases expression ISO CAV1 (Homo sapiens) 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide results in decreased expression of CAV1 protein CTD PMID:18848576 Cav1 Rat nystatin multiple interactions ISO CAV1 (Homo sapiens) 6480464 Nystatin inhibits the reaction [Quercetin affects the localization of CAV1 protein] CTD PMID:17876056 Cav1 Rat octanoic acid multiple interactions ISO Cav1 (Mus musculus) 6480464 [octanoic acid co-treated with Dexamethasone] results in increased expression of CAV1 protein and [SB 203580 results in decreased activity of MAPK14 protein] inhibits the reaction [[octanoic acid co-treated with Dexamethasone] results in increased expression of CAV1 protein] CTD PMID:14984747 Cav1 Rat ouabain decreases expression ISO CAV1 (Homo sapiens) 6480464 Ouabain results in decreased expression of CAV1 mRNA CTD PMID:28795476 Cav1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CAV1 mRNA CTD PMID:25729387 Cav1 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CAV1 mRNA CTD PMID:25729387 Cav1 Rat ozone decreases expression ISO Cav1 (Mus musculus) 6480464 Ozone results in decreased expression of CAV1 mRNA and Ozone results in decreased expression of CAV1 protein CTD PMID:12763052 and PMID:18207479 Cav1 Rat ozone multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of CAV1 mRNA more ... CTD PMID:32699268 Cav1 Rat ozone multiple interactions ISO Cav1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CAV1 mRNA and TNF protein affects the reaction [Ozone results in decreased expression of CAV1 protein] CTD PMID:18207479 and PMID:34911549 Cav1 Rat p-menthan-3-ol increases expression ISO CAV1 (Homo sapiens) 6480464 Menthol results in increased expression of CAV1 mRNA CTD PMID:26760959 Cav1 Rat paclitaxel increases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 mRNA results in increased susceptibility to Paclitaxel CTD PMID:16322897 Cav1 Rat paracetamol decreases expression ISO Cav1 (Mus musculus) 6480464 Acetaminophen results in decreased expression of CAV1 protein CTD PMID:20100502 Cav1 Rat paracetamol increases response to substance ISO Cav1 (Mus musculus) 6480464 CAV1 results in increased susceptibility to Acetaminophen CTD PMID:20100502 Cav1 Rat paracetamol decreases expression ISO CAV1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CAV1 mRNA CTD PMID:21420995 and PMID:29067470 Cav1 Rat paracetamol multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 affects the reaction [Acetaminophen results in increased expression of BIRC5 protein] more ... CTD PMID:20100502 Cav1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of CAV1 mRNA and Paraquat results in increased expression of CAV1 protein CTD PMID:26813466 Cav1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Cav1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of CAV1 mRNA more ... CTD PMID:36331819 Cav1 Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of CAV1 mRNA CTD PMID:35163327 Cav1 Rat phenethyl isothiocyanate decreases expression ISO CAV1 (Homo sapiens) 6480464 phenethyl isothiocyanate results in decreased expression of CAV1 mRNA CTD PMID:26678675 Cav1 Rat phenobarbital affects expression ISO Cav1 (Mus musculus) 6480464 Phenobarbital affects the expression of CAV1 mRNA CTD PMID:23091169 Cav1 Rat phenylephrine multiple interactions ISO Cav1 (Mus musculus) 6480464 Sodium and Dietary affects the reaction [CAV1 protein results in increased susceptibility to Phenylephrine] CTD PMID:18178722 Cav1 Rat phenylmercury acetate increases expression ISO CAV1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CAV1 mRNA CTD PMID:26272509 Cav1 Rat phenylmercury acetate multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CAV1 mRNA CTD PMID:27188386 Cav1 Rat pioglitazone affects expression ISO CAV1 (Homo sapiens) 6480464 pioglitazone affects the expression of CAV1 protein CTD PMID:17961437 Cav1 Rat pirinixic acid multiple interactions ISO Cav1 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of CAV1 mRNA CTD PMID:19710929 Cav1 Rat pirinixic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of CAV1 mRNA CTD PMID:19710929 Cav1 Rat piroxicam decreases expression ISO CAV1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of CAV1 mRNA CTD PMID:21858171 Cav1 Rat poly(I:C) multiple interactions EXP 6480464 [Poly I-C co-treated with HU 211] results in decreased expression of CAV1 mRNA CTD PMID:26923065 Cav1 Rat potassium chloride multiple interactions ISO Cav1 (Mus musculus) 6480464 Sodium and Dietary affects the reaction [CAV1 protein results in increased susceptibility to Potassium Chloride] CTD PMID:18178722 Cav1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of CAV1 mRNA CTD PMID:30047161 Cav1 Rat progesterone increases expression ISO CAV1 (Homo sapiens) 6480464 Progesterone results in increased expression of CAV1 mRNA CTD PMID:15674352 Cav1 Rat progesterone multiple interactions ISO CAV1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of CAV1 mRNA] CTD PMID:15674352 Cav1 Rat quartz decreases expression ISO Cav1 (Mus musculus) 6480464 Quartz results in decreased expression of CAV1 mRNA and Quartz results in decreased expression of CAV1 protein CTD PMID:36053221 Cav1 Rat quartz multiple interactions ISO Cav1 (Mus musculus) 6480464 CAV1 protein modified form inhibits the reaction [Quartz affects the localization of YAP1 protein] more ... CTD PMID:36053221 Cav1 Rat quercetin multiple interactions EXP 6480464 Quercetin inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of CAV1 protein] CTD PMID:26357463 Cav1 Rat quercetin multiple interactions ISO Cav1 (Mus musculus) 6480464 Quercetin inhibits the reaction [[lipopolysaccharide more ... CTD PMID:12134086 more ... Cav1 Rat quercetin decreases expression ISO Cav1 (Mus musculus) 6480464 Quercetin results in decreased expression of CAV1 protein CTD PMID:12134086 Cav1 Rat quercetin multiple interactions ISO CAV1 (Homo sapiens) 6480464 Nystatin inhibits the reaction [Quercetin affects the localization of CAV1 protein] more ... CTD PMID:17876056 more ... Cav1 Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of CAV1 protein CTD PMID:16331104 Cav1 Rat raloxifene multiple interactions EXP 6480464 fulvestrant inhibits the reaction [Raloxifene Hydrochloride results in increased expression of CAV1 mRNA] and fulvestrant inhibits the reaction [Raloxifene Hydrochloride results in increased expression of CAV1 protein] CTD PMID:17091190 Cav1 Rat raloxifene affects expression ISO CAV1 (Homo sapiens) 6480464 Raloxifene Hydrochloride affects the expression of CAV1 mRNA CTD PMID:14699072 Cav1 Rat raloxifene increases expression EXP 6480464 Raloxifene Hydrochloride results in increased expression of CAV1 mRNA and Raloxifene Hydrochloride results in increased expression of CAV1 protein CTD PMID:17091190 Cav1 Rat reactive oxygen species multiple interactions ISO Cav1 (Mus musculus) 6480464 Reactive Oxygen Species promotes the reaction [CAVIN1 protein binds to CAV1 protein] CTD PMID:21705337 Cav1 Rat rebaudioside A decreases expression ISO CAV1 (Homo sapiens) 6480464 rebaudioside A results in decreased expression of CAV1 mRNA CTD PMID:31655124 Cav1 Rat resveratrol affects transport ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the transport of resveratrol CTD PMID:19321006 Cav1 Rat resveratrol multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of CAV1 mRNA more ... CTD PMID:18296501 and PMID:19167446 Cav1 Rat resveratrol decreases expression EXP 6480464 resveratrol results in decreased expression of CAV1 protein CTD PMID:18266981 Cav1 Rat resveratrol multiple interactions EXP 6480464 Resveratrol inhibits the reaction [Streptozocin promotes the reaction [CAV1 protein binds to NOS3 protein]] and Resveratrol inhibits the reaction [Streptozocin results in increased expression of CAV1 protein] CTD PMID:18266981 Cav1 Rat resveratrol increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 resveratrol results in increased phosphorylation of CAV1 protein CTD PMID:18296501 Cav1 Rat resveratrol increases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein results in increased susceptibility to resveratrol CTD PMID:19321006 Cav1 Rat resveratrol increases expression ISO CAV1 (Homo sapiens) 6480464 resveratrol results in increased expression of CAV1 protein CTD PMID:19321006 Cav1 Rat rimonabant affects expression ISO Cav1 (Mus musculus) 6480464 Rimonabant affects the expression of CAV1 mRNA CTD PMID:19030233 Cav1 Rat rimonabant multiple interactions ISO Cav1 (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of CAV1 mRNA] CTD PMID:19030233 Cav1 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO CAV1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of CAV1 mRNA CTD PMID:33725128 and PMID:35811015 Cav1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CAV1 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Cav1 Rat saracatinib multiple interactions EXP 6480464 saracatinib inhibits the reaction [Lipopolysaccharides results in increased phosphorylation of CAV1 protein] CTD PMID:26357463 Cav1 Rat SB 203580 multiple interactions ISO CAV1 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Hydrogen Peroxide promotes the reaction [SP1 protein results in increased expression of CAV1 protein]] and SB 203580 inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of CAV1 protein] CTD PMID:17108117 and PMID:25512378 Cav1 Rat SB 203580 multiple interactions ISO Cav1 (Mus musculus) 6480464 [SB 203580 results in decreased activity of MAPK14 protein] inhibits the reaction [[octanoic acid co-treated with Dexamethasone] results in increased expression of CAV1 protein] more ... CTD PMID:14984747 more ... Cav1 Rat SB 431542 multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Cav1 Rat senecionine decreases expression ISO Cav1 (Mus musculus) 6480464 senecionine results in decreased expression of CAV1 protein CTD PMID:35357534 Cav1 Rat silicon dioxide increases expression ISO CAV1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of CAV1 mRNA and Silicon Dioxide results in increased expression of CAV1 mRNA CTD PMID:25895662 and PMID:28425640 Cav1 Rat silicon dioxide decreases expression ISO Cav1 (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of CAV1 mRNA CTD PMID:29203145 Cav1 Rat simvastatin multiple interactions ISO CAV1 (Homo sapiens) 6480464 Simvastatin inhibits the reaction [Glucose results in decreased expression of CAV1 mRNA] CTD PMID:19816600 Cav1 Rat simvastatin multiple interactions EXP 6480464 Simvastatin inhibits the reaction [[Semaxinib co-treated with Oxygen deficiency] results in decreased expression of CAV1 protein] CTD PMID:16698853 Cav1 Rat simvastatin decreases expression ISO Cav1 (Mus musculus) 6480464 Simvastatin results in decreased expression of CAV1 protein CTD PMID:18224302 Cav1 Rat simvastatin multiple interactions ISO Cav1 (Mus musculus) 6480464 Simvastatin promotes the reaction [[APOA4 protein co-treated with CBS protein] affects the expression of CAV1 protein] CTD PMID:18224302 Cav1 Rat sodium arsenite multiple interactions ISO CAV1 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of CAV1 mRNA more ... CTD PMID:12640124 and PMID:39836092 Cav1 Rat sodium arsenite decreases expression ISO CAV1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of CAV1 mRNA CTD PMID:34032870 and PMID:38568856 Cav1 Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of CAV1 protein CTD PMID:19072884 Cav1 Rat sodium arsenite increases expression ISO Cav1 (Mus musculus) 6480464 sodium arsenite results in increased expression of CAV1 protein CTD PMID:17123562 and PMID:29044176 Cav1 Rat sodium arsenite decreases expression ISO Cav1 (Mus musculus) 6480464 sodium arsenite results in decreased expression of CAV1 mRNA CTD PMID:16014739 Cav1 Rat sodium arsenite increases response to substance ISO CAV1 (Homo sapiens) 6480464 CAV1 protein results in increased susceptibility to sodium arsenite CTD PMID:12640124 Cav1 Rat sodium chloride multiple interactions ISO CAV1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of CAV1 protein more ... CTD PMID:38598786 Cav1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of CAV mRNA and Soman results in increased expression of CAV1 mRNA CTD PMID:19281266 Cav1 Rat streptozocin multiple interactions EXP 6480464 resveratrol inhibits the reaction [Streptozocin promotes the reaction [CAV1 protein binds to NOS3 protein]] more ... CTD PMID:18266981 Cav1 Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of CAV1 protein CTD PMID:18266981 Cav1 Rat sulfasalazine multiple interactions ISO Cav1 (Mus musculus) 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [[Sulfasalazine results in decreased activity of SLC7A11 protein] which results in increased expression of CAV1 mRNA] and [Sulfasalazine results in decreased activity of SLC7A11 protein] which results in increased expression of CAV1 mRNA CTD PMID:19015640 Cav1 Rat tamoxifen affects expression ISO CAV1 (Homo sapiens) 6480464 Tamoxifen affects the expression of CAV1 mRNA CTD PMID:14699072 Cav1 Rat tamoxifen increases expression ISO CAV1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of CAV1 protein CTD PMID:19288272 Cav1 Rat taurocholic acid increases secretion ISO CAV1 (Homo sapiens) 6480464 CAV1 protein results in increased secretion of Taurocholic Acid CTD PMID:14647059 Cav1 Rat tert-butyl hydroperoxide increases expression ISO CAV1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of CAV1 mRNA CTD PMID:15963989 Cav1 Rat testosterone multiple interactions ISO CAV1 (Homo sapiens) 6480464 [FSHB protein co-treated with Testosterone] results in decreased expression of CAV1 mRNA CTD PMID:18535249 Cav1 Rat tetrachloromethane increases expression ISO Cav1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CAV1 mRNA CTD PMID:17484886 Cav1 Rat tetrachloromethane multiple interactions ISO Cav1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of CAV1 mRNA CTD PMID:30517762 Cav1 Rat tetraphene multiple interactions ISO Cav1 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of CAV1 mRNA CTD PMID:27858113 Cav1 Rat theophylline increases expression ISO CAV1 (Homo sapiens) 6480464 Theophylline results in increased expression of CAV1 mRNA CTD PMID:16083514 Cav1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CAV1 mRNA CTD PMID:23411599 Cav1 Rat thiram decreases expression ISO CAV1 (Homo sapiens) 6480464 Thiram results in decreased expression of CAV1 mRNA CTD PMID:38568856 Cav1 Rat titanium dioxide decreases expression ISO Cav1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of CAV1 mRNA CTD PMID:23557971 and PMID:27760801 Cav1 Rat titanium dioxide increases expression ISO CAV1 (Homo sapiens) 6480464 titanium dioxide results in increased expression of CAV1 protein CTD PMID:30910687 Cav1 Rat tolfenamic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 CAV1 protein affects the reaction [tolfenamic acid results in decreased expression of TGFBR2 protein] CTD PMID:31381904 Cav1 Rat toluene 2,4-diisocyanate multiple interactions ISO CAV1 (Homo sapiens) 6480464 AG 1879 inhibits the reaction [Toluene 2 more ... CTD PMID:29940203 and PMID:30261222 Cav1 Rat toluene 2,4-diisocyanate multiple interactions ISO Cav1 (Mus musculus) 6480464 FPS-ZM1 inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased phosphorylation of CAV1 protein] CTD PMID:30261222 Cav1 Rat toluene 2,4-diisocyanate increases phosphorylation ISO CAV1 (Homo sapiens) 6480464 Toluene 2 and 4-Diisocyanate analog results in increased phosphorylation of CAV1 protein CTD PMID:30261222 Cav1 Rat toluene 2,4-diisocyanate increases phosphorylation ISO Cav1 (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased phosphorylation of CAV1 protein CTD PMID:30261222 Cav1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CAV1 mRNA CTD PMID:25729387 Cav1 Rat tremolite asbestos decreases expression ISO Cav1 (Mus musculus) 6480464 tremolite results in decreased expression of CAV1 mRNA CTD PMID:29279043 Cav1 Rat triadimefon decreases expression ISO CAV1 (Homo sapiens) 6480464 triadimefon analog results in decreased expression of CAV1 mRNA and triadimefon results in decreased expression of CAV1 mRNA CTD PMID:26238599 and PMID:26705709 Cav1 Rat trichostatin A increases expression ISO CAV1 (Homo sapiens) 6480464 trichostatin A results in increased expression of CAV1 mRNA CTD PMID:24935251 more ... Cav1 Rat trichostatin A multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CAV1 mRNA CTD PMID:27188386 Cav1 Rat triclosan increases expression ISO CAV1 (Homo sapiens) 6480464 Triclosan results in increased expression of CAV1 mRNA CTD PMID:30510588 Cav1 Rat trimellitic anhydride decreases expression ISO Cav1 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of CAV1 mRNA CTD PMID:19042947 Cav1 Rat Triptolide increases expression EXP 6480464 triptolide results in increased expression of CAV1 protein CTD PMID:32519852 Cav1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of CAV1 mRNA CTD PMID:21515302 Cav1 Rat trovafloxacin increases expression ISO Cav1 (Mus musculus) 6480464 trovafloxacin results in increased expression of CAV1 mRNA CTD PMID:35537566 Cav1 Rat tyrphostin AG 1478 multiple interactions ISO CAV1 (Homo sapiens) 6480464 RTKI cpd inhibits the reaction [Rosiglitazone results in increased expression of CAV1] CTD PMID:18507034 Cav1 Rat valproic acid decreases expression ISO CAV1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CAV1 mRNA CTD PMID:29154799 and PMID:29501571 Cav1 Rat valproic acid increases methylation ISO CAV1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of CAV1 gene CTD PMID:29501571 Cav1 Rat valproic acid multiple interactions ISO CAV1 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CAV1 mRNA CTD PMID:27188386 Cav1 Rat valproic acid increases expression ISO CAV1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of CAV1 mRNA and Valproic Acid results in increased expression of CAV1 protein CTD PMID:23179753 more ... Cav1 Rat valproic acid decreases methylation ISO CAV1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CAV1 gene CTD PMID:29154799 Cav1 Rat valproic acid affects expression ISO CAV1 (Homo sapiens) 6480464 Valproic Acid affects the expression of CAV1 mRNA CTD PMID:25979313 Cav1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of CAV mRNA CTD PMID:19015723 Cav1 Rat vitamin E multiple interactions ISO Cav1 (Mus musculus) 6480464 Vitamin E inhibits the reaction [Hydrogen Peroxide results in increased expression of CAV1 protein] CTD PMID:12134086 Cav1 Rat vitamin E multiple interactions ISO CAV1 (Homo sapiens) 6480464 Vitamin E inhibits the reaction [2 more ... CTD PMID:35349355 Cav1 Rat vorinostat increases expression ISO CAV1 (Homo sapiens) 6480464 vorinostat results in increased expression of CAV1 mRNA CTD PMID:26272509 Cav1 Rat wogonin multiple interactions ISO CAV1 (Homo sapiens) 6480464 wogonin inhibits the reaction [Anisomycin results in increased phosphorylation of CAV1 protein] and wogonin inhibits the reaction [Hydrogen Peroxide results in increased phosphorylation of CAV1 protein] CTD PMID:23246481 Cav1 Rat wortmannin multiple interactions ISO CAV1 (Homo sapiens) 6480464 wortmannin inhibits the reaction [CAV1 protein results in increased susceptibility to Hydrogen Peroxide] and wortmannin inhibits the reaction [CAV1 protein results in increased susceptibility to sodium arsenite] CTD PMID:12640124
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-anisomycin (ISO) (1->4)-beta-D-glucan (ISO) (R,R,R)-alpha-tocopherol (ISO) 1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO) 1,2-dimethylhydrazine (ISO) 13-HPODE (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2-ethoxyethanol (EXP) 2-methoxyethanol (EXP) 22-Hydroxycholesterol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP,ISO) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-Nitrobenzanthrone (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetylcholine (ISO) acetylsalicylic acid (EXP) acrolein (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (EXP) aminoguanidine (ISO) amitrole (EXP) ammonium chloride (EXP) amphetamine (EXP) amphibole asbestos (EXP) antirheumatic drug (ISO) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) beta-carotene (ISO) beta-lapachone (ISO) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol A diglycidyl ether (ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP,ISO) butan-1-ol (ISO) butyric acid (EXP) cadmium atom (ISO) cadmium dichloride (ISO) cadmium nitrate (ISO) caffeine (ISO) calcitriol (ISO) calcium atom (ISO) calcium(0) (ISO) camptothecin (ISO) captan (ISO) carbamazepine (ISO) carbon nanotube (ISO) carboxy-PTIO (ISO) celecoxib (ISO) CGP 52608 (ISO) chlorohydrocarbon (EXP) chloropicrin (ISO) cholesterol (EXP,ISO) chromium atom (EXP) chrysene (ISO) ciprofloxacin (ISO) cisplatin (EXP,ISO) clofibrate (ISO) cobalt dichloride (ISO) cordycepin (ISO) corosolic acid (ISO) coumestrol (ISO) crocidolite asbestos (ISO) cumene (ISO) cycloheximide (ISO) cyclosporin A (ISO) cylindrospermopsin (ISO) cyproconazole (ISO) D-glucose (ISO) depsipeptide (ISO) desferrioxamine B (ISO) dexamethasone (ISO) diallyl disulfide (ISO) diallyl trisulfide (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) diethylstilbestrol (EXP,ISO) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) equol (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) fenofibrate (ISO) fipronil (EXP) folic acid (ISO) folpet (ISO) formaldehyde (ISO) fulvestrant (EXP,ISO) furan (EXP) furfural (ISO) gefitinib (ISO) genistein (ISO) geranylgeraniol (ISO) glucose (ISO) Glutathione ethyl ester (ISO) glycidyl methacrylate (ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) inulin (ISO) iron atom (EXP) iron(0) (EXP) iron(2+) sulfate (anhydrous) (EXP) isoprenaline (ISO) ivermectin (ISO) ketoconazole (ISO) L-ascorbic acid (ISO) lead diacetate (EXP) lipopolysaccharide (EXP,ISO) lithocholic acid (ISO) lysophosphatidylcholine (ISO) manganese atom (ISO) manganese(0) (ISO) mercury dibromide (ISO) methamphetamine (EXP) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) methyl beta-cyclodextrin (EXP,ISO) methyl methanesulfonate (ISO) methylisothiazolinone (ISO) methylmercury chloride (EXP) mifepristone (ISO) miquelianin (ISO) monocrotaline (EXP) N-[3-(aminomethyl)benzyl]acetamidine (ISO) N-acetyl-L-cysteine (ISO) N-acetylsphingosine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-methyl-D-aspartic acid (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) nicotinic acid (EXP) nimesulide (ISO) nitric oxide (ISO) nitrofen (EXP) nitroprusside (ISO) NS-398 (ISO) nystatin (ISO) octanoic acid (ISO) ouabain (ISO) oxaliplatin (EXP) ozone (ISO) p-menthan-3-ol (ISO) paclitaxel (ISO) paracetamol (ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenethyl isothiocyanate (ISO) phenobarbital (ISO) phenylephrine (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) pirinixic acid (ISO) piroxicam (ISO) poly(I:C) (EXP) potassium chloride (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) quartz (ISO) quercetin (EXP,ISO) raloxifene (EXP,ISO) reactive oxygen species (ISO) rebaudioside A (ISO) resveratrol (EXP,ISO) rimonabant (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) saracatinib (EXP) SB 203580 (ISO) SB 431542 (ISO) senecionine (ISO) silicon dioxide (ISO) simvastatin (EXP,ISO) sodium arsenite (EXP,ISO) sodium chloride (ISO) Soman (EXP) streptozocin (EXP) sulfasalazine (ISO) tamoxifen (ISO) taurocholic acid (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) tetraphene (ISO) theophylline (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) tolfenamic acid (ISO) toluene 2,4-diisocyanate (ISO) topotecan (EXP) tremolite asbestos (ISO) triadimefon (ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) Triptolide (EXP) troglitazone (EXP) trovafloxacin (ISO) tyrphostin AG 1478 (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) vorinostat (ISO) wogonin (ISO) wortmannin (ISO)
Biological Process
angiogenesis (IEA,ISO) angiotensin-activated signaling pathway (IEA,ISO) animal organ regeneration (IEP) apoptotic signaling pathway (IEA,ISO) basement membrane organization (IEA,ISO) calcium ion homeostasis (IEA,ISO) calcium ion transport (IEA,ISO) canonical Wnt signaling pathway (IEA,ISO) caveola assembly (IBA,IEA,ISO) caveolin-mediated endocytosis (IEA,ISO) cell differentiation (IBA) cell population proliferation (IEA,ISO) cellular response to exogenous dsRNA (IEA,ISO) cellular response to hyperoxia (IEA,ISO) cellular response to hypoxia (IEP) cellular response to mechanical stimulus (IDA) cellular response to misfolded protein (IEA,ISO) cellular response to peptide hormone stimulus (IEA,ISO) cellular response to starvation (ISO) cellular response to transforming growth factor beta stimulus (IEA,ISO) cellular senescence (IMP) cholesterol efflux (IMP) cholesterol homeostasis (IEA,ISO) cytokine-mediated signaling pathway (IEA,ISO) endothelial cell proliferation (IEA,ISO) establishment of localization in cell (IEA,ISO) fibroblast proliferation (IEA,ISO) glandular epithelial cell differentiation (IEA,ISO) insulin receptor internalization (IEA,ISO) intracellular calcium ion homeostasis (IEA,IMP,ISO) intracellular nitric oxide homeostasis (IEA,ISO) lactation (IEA,ISO) lipid storage (IEA,ISO) maintenance of protein location in cell (IMP) mammary gland development (IEA,ISO) mammary gland involution (IEA,ISO) MAPK cascade (IEA,ISO) membrane depolarization (IEA,ISO) microtubule polymerization (IMP) muscle cell cellular homeostasis (IEA,ISO) negative regulation of anoikis (IEA,ISO) negative regulation of BMP signaling pathway (ISO) negative regulation of calcium ion import across plasma membrane (IMP) negative regulation of canonical Wnt signaling pathway (IEA,ISO,ISS) negative regulation of cation channel activity (IDA) negative regulation of cell population proliferation (IEA,ISO) negative regulation of cytokine-mediated signaling pathway (IEA,ISO) negative regulation of endothelial cell proliferation (IBA,IEA,IMP,ISO) negative regulation of epithelial cell differentiation (IEA,ISO) negative regulation of ERK1 and ERK2 cascade (IDA) negative regulation of fibroblast proliferation (IEA,ISO) negative regulation of MAP kinase activity (ISO) negative regulation of MAPK cascade (IEA,ISO) negative regulation of muscle cell apoptotic process (IMP) negative regulation of necroptotic process (IEA,ISO) negative regulation of neuron differentiation (IMP) negative regulation of nitric oxide biosynthetic process (IEA,ISO) negative regulation of nitric-oxide synthase activity (ISO) negative regulation of pinocytosis (IEA,ISO) negative regulation of potassium ion transmembrane transport (IEA,ISO) negative regulation of protein ubiquitination (IEA,ISO) negative regulation of receptor signaling pathway via JAK-STAT (IEA,ISO) negative regulation of signal transduction (IEA,ISO) negative regulation of smooth muscle cell migration (IMP) negative regulation of smooth muscle cell proliferation (IMP) negative regulation of transcription by RNA polymerase II (IEA,ISO,ISS) negative regulation of tyrosine phosphorylation of STAT protein (ISO) negative regulation of vascular associated smooth muscle cell proliferation (IMP) nitric oxide biosynthetic process (IEA,ISO) positive regulation of calcium ion transport into cytosol (IEA,ISO) positive regulation of canonical NF-kappaB signal transduction (IEA,ISO) positive regulation of catalytic activity (ISO) positive regulation of cell adhesion molecule production (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of cholesterol efflux (IEA,ISO) positive regulation of cold-induced thermogenesis (IEA,ISO,ISS) positive regulation of endocytosis (IMP) positive regulation of endothelial cell proliferation (IMP) positive regulation of ERAD pathway (IEA,ISO) positive regulation of extrinsic apoptotic signaling pathway (IEA,ISO) positive regulation of gap junction assembly (IEA,ISO) positive regulation of gene expression (IEA,ISO) positive regulation of intrinsic apoptotic signaling pathway (IEA,ISO) positive regulation of microtubule polymerization (IMP) positive regulation of protein ubiquitination (IEA,ISO) positive regulation of signal transduction (IMP) positive regulation of toll-like receptor 3 signaling pathway (IEA,ISO) positive regulation of vasoconstriction (IEA,IMP,ISO) post-transcriptional regulation of gene expression (IEA,ISO) protein localization (IEA,ISO) protein localization to basolateral plasma membrane (ISO) protein localization to plasma membrane raft (ISO) protein transport (IEA,ISO) receptor internalization (IEA,ISO,ISS) receptor-mediated endocytosis of virus by host cell (IEA,ISO) regulation of blood coagulation (IEA,ISO) regulation of cell communication by electrical coupling involved in cardiac conduction (IEA,ISO) regulation of cytosolic calcium ion concentration (IBA,IEA,ISO) regulation of entry of bacterium into host cell (IEA,ISO) regulation of fatty acid metabolic process (IEA,ISO) regulation of heart rate by cardiac conduction (IEA,ISO) regulation of membrane repolarization during action potential (IEA,ISO) regulation of peptidase activity (ISO) regulation of ruffle assembly (IEA,ISO) regulation of smooth muscle contraction (IEA,ISO) regulation of the force of heart contraction (IEA,ISO) regulation of the force of heart contraction by chemical signal (IEA,ISO) regulation of ventricular cardiac muscle cell action potential (IEA,ISO) response to bacterium (IEA,ISO) response to calcium ion (IEA,ISO) response to estrogen (IEA,ISO) response to gamma radiation (IEP) response to glucocorticoid (IEP) response to hypoxia (IEA,ISO) response to ischemia (IEA,ISO) response to mechanical stimulus (IMP) response to nutrient (IEP) response to progesterone (IEA,ISO) response to xenobiotic stimulus (IEP) skeletal muscle tissue development (IEA,ISO) T cell costimulation (IEA,ISO,ISS) triglyceride metabolic process (IEA,ISO) tyrosine phosphorylation of STAT protein (ISO) vasculogenesis (IEA,ISO) vasoconstriction (IEA,ISO) vesicle organization (ISO)
Cellular Component
acrosomal membrane (IEA,ISO) apical plasma membrane (ISO) basal plasma membrane (IDA) basolateral plasma membrane (ISO) caveola (IDA,IEA,ISO,ISS) caveolar macromolecular signaling complex (IEA,ISO) cell cortex (IEA,ISO) cell surface (IDA) cilium (IEA,ISO) cytoplasmic vesicle (IBA,IEA,ISO) endoplasmic reticulum (IEA,ISO,ISS) endosome (IEA,ISO,ISS) exocytic vesicle (ISO) focal adhesion (IDA,IEA,ISO) Golgi apparatus (IBA,IDA,IEA,ISO) Golgi membrane (IEA,ISO,ISS) lipid droplet (IDA) membrane (IEA,ISO) membrane raft (IDA,IEA,ISO) perinuclear region of cytoplasm (IBA,IDA,IEA,ISO) peroxisomal membrane (IDA) plasma membrane (IDA,IEA,ISO) protein-containing complex (IDA,IEA,ISO)
Molecular Function
ATPase binding (IEA,ISO) enzyme binding (IEA,ISO) identical protein binding (IEA,ISO) inward rectifier potassium channel inhibitor activity (IEA,ISO) kinase binding (IPI) molecular adaptor activity (IBA,IEA,ISO) nitric-oxide synthase binding (IEA,IPI,ISO) nitric-oxide synthase inhibitor activity (ISO) oxysterol binding (IEA,ISO,ISS) peptidase activator activity (IEA,ISO) protein binding (IPI,ISO) protein heterodimerization activity (IEA,ISO) protein kinase binding (IBA,IEA,ISO) protein tyrosine kinase inhibitor activity (IEA,ISO) protein-containing complex binding (IEA,ISO) protein-macromolecule adaptor activity (IEA,ISO) receptor serine/threonine kinase binding (IPI) signaling receptor binding (IEA,ISO) small GTPase binding (IEA,ISO) SNARE binding (IMP) syntaxin binding (IMP) transmembrane transporter binding (IBA,IEA,IPI,ISO)
1.
Global gene expression profiling and tissue microarray reveal novel candidate genes and down-regulation of the tumor suppressor gene CAV1 in sporadic vestibular schwannomas.
Aarhus M, etal., Neurosurgery. 2010 Oct;67(4):998-1019; discussion 1019. doi: 10.1227/NEU.0b013e3181ec7b71.
2.
Lack of association of SNP rs4236601 near CAV1 and CAV2 with POAG in a Saudi cohort.
Abu-Amero KK, etal., Mol Vis. 2012;18:1960-5. Epub 2012 Jul 18.
3.
Caveolin-1 assembles type 1 inositol 1,4,5-trisphosphate receptors and canonical transient receptor potential 3 channels into a functional signaling complex in arterial smooth muscle cells.
Adebiyi A, etal., J Biol Chem. 2011 Feb 11;286(6):4341-8. Epub 2010 Nov 23.
4.
Increased expression of caveolin-1 and -2 in the hearts of Lewis rats with experimental autoimmune myocarditis.
Ahn M, etal., Autoimmunity. 2006 Sep;39(6):489-95.
5.
Contribution of caveolin-1 to ventricular nitric oxide in age-related adaptation to hypovolemic state.
Arreche ND, etal., Regul Pept. 2012 Nov 10;179(1-3):43-9. doi: 10.1016/j.regpep.2012.08.002. Epub 2012 Sep 3.
6.
Downmodulation of caveolin-1 expression in human ovarian carcinoma is directly related to alpha-folate receptor overexpression.
Bagnoli M, etal., Oncogene. 2000 Sep 28;19(41):4754-63.
7.
Effect of insulin on caveolin-enriched membrane domains in rat liver.
Balbis A, etal., J Biol Chem. 2004 Sep 17;279(38):39348-57. Epub 2004 Jul 12.
8.
Cell selective glucocorticoid induction of caveolin-1 and caveolae in differentiating pulmonary alveolar epithelial cell cultures.
Barar J, etal., Biochem Biophys Res Commun. 2007 Jul 27;359(2):360-6. Epub 2007 May 24.
9.
Opposite pattern of MDR1 and caveolin-1 gene expression in human atherosclerotic lesions and proliferating human smooth muscle cells.
Batetta B, etal., Cell Mol Life Sci. 2001 Jul;58(8):1113-20.
10.
Integrins regulate opioid receptor signaling in trigeminal ganglion neurons.
Berg KA, etal., Neuroscience. 2007 Feb 9;144(3):889-97. Epub 2006 Dec 8.
11.
Caveolin-1 interacts with 5-HT2A serotonin receptors and profoundly modulates the signaling of selected Galphaq-coupled protein receptors.
Bhatnagar A, etal., J Biol Chem. 2004 Aug 13;279(33):34614-23. Epub 2004 Jun 9.
12.
Ruscogenin attenuates monocrotaline-induced pulmonary hypertension in rats.
Bi LQ, etal., Int Immunopharmacol. 2013 May;16(1):7-16. doi: 10.1016/j.intimp.2013.03.010. Epub 2013 Mar 26.
13.
Caveolin-1/PTRF upregulation constitutes a mechanism for mediating p53-induced cellular senescence: implications for evidence-based therapy of delayed wound healing in diabetes.
Bitar MS, etal., Am J Physiol Endocrinol Metab. 2013 Oct 15;305(8):E951-63. doi: 10.1152/ajpendo.00189.2013. Epub 2013 Aug 13.
14.
Downregulation and altered spatial pattern of caveolin-1 in chronic plaque psoriasis.
Campbell L, etal., Br J Dermatol. 2002 Oct;147(4):701-9.
15.
Choroid plexus megalin is involved in neuroprotection by serum insulin-like growth factor I.
Carro E, etal., J Neurosci. 2005 Nov 23;25(47):10884-93. doi: 10.1523/JNEUROSCI.2909-05.2005.
16.
Evidence for Na+/Ca2+ exchanger 1 association with caveolin-1 and -2 in C6 glioma cells.
Cha SH, etal., IUBMB Life. 2004 Oct;56(10):621-7.
17.
Cellular localization and interaction of ABCA1 and caveolin-1 in aortic endothelial cells after HDL incubation.
Chao WT, etal., Biochem Biophys Res Commun. 2005 Jul 8;332(3):743-9.
18.
Caveolae: biochemical analysis.
Chatenay-Rivauday C, etal., Mol Biol Rep. 2004 Jun;31(2):67-84.
19.
Mutational, epigenetic and expressional analyses of caveolin-1 gene in breast cancers.
Chen ST, etal., Int J Mol Med. 2004 Oct;14(4):577-82.
20.
Serotonin inhibits voltage-gated K+ currents in pulmonary artery smooth muscle cells: role of 5-HT2A receptors, caveolin-1, and KV1.5 channel internalization.
Cogolludo A, etal., Circ Res. 2006 Apr 14;98(7):931-8. Epub 2006 Mar 9.
21.
Caveolin-1 expression is essential for proper nonshivering thermogenesis in brown adipose tissue.
Cohen AW, etal., Diabetes. 2005 Mar;54(3):679-86.
22.
Hypermethylation of the caveolin-1 gene promoter in prostate cancer.
Cui J, etal., Prostate. 2001 Feb 15;46(3):249-56.
23.
Caveolin-1--a novel interacting partner of organic cation/carnitine transporter (Octn2): effect of protein kinase C on this interaction in rat astrocytes.
Czeredys M, etal., PLoS One. 2013 Dec 13;8(12):e82105. doi: 10.1371/journal.pone.0082105. eCollection 2013.
24.
Catabolic stress induces features of chondrocyte senescence through overexpression of caveolin 1: possible involvement of caveolin 1-induced down-regulation of articular chondrocytes in the pathogenesis of osteoarthritis.
Dai SM, etal., Arthritis Rheum. 2006 Mar;54(3):818-31.
25.
Interaction with caveolin-1 modulates vascular ATP-sensitive potassium (KATP) channel activity.
Davies LM, etal., J Physiol. 2010 Sep 1;588(Pt 17):3255-66. Epub 2010 Jul 12.
26.
Decreased expression of caveolin 1 in patients with systemic sclerosis: crucial role in the pathogenesis of tissue fibrosis.
Del Galdo F, etal., Arthritis Rheum. 2008 Sep;58(9):2854-65. doi: 10.1002/art.23791.
27.
Caveolin-1 is required for the upregulation of fatty acid synthase (FASN), a tumor promoter, during prostate cancer progression.
Di Vizio D, etal., Cancer Biol Ther. 2007 Aug;6(8):1263-8. Epub 2007 May 17.
28.
Peripheral nerve injury alters blood-spinal cord barrier functional and molecular integrity through a selective inflammatory pathway.
Echeverry S, etal., J Neurosci. 2011 Jul 27;31(30):10819-28.
29.
Reciprocal regulation of neu tyrosine kinase activity and caveolin-1 protein expression in vitro and in vivo. Implications for human breast cancer.
Engelman JA, etal., J Biol Chem. 1998 Aug 7;273(32):20448-55.
30.
Expression of caveolin-1 and caveolin-2 in urothelial carcinoma of the urinary bladder correlates with tumor grade and squamous differentiation.
Fong A, etal., Am J Clin Pathol. 2003 Jul;120(1):93-100.
31.
Up-regulation of caveolin-1 by DJ-1 attenuates rat pulmonary arterial hypertension by inhibiting TGFβ/Smad signaling pathway.
Gao W, etal., Exp Cell Res. 2017 Dec 1;361(1):192-198. doi: 10.1016/j.yexcr.2017.10.019. Epub 2017 Oct 22.
32.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
33.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
34.
Caveolin-1 regulates the delivery and endocytosis of the glutamate transporter, excitatory amino acid carrier 1.
Gonzalez MI, etal., J Biol Chem. 2007 Oct 12;282(41):29855-65. Epub 2007 Aug 22.
35.
Vascular microarray profiling in two models of hypertension identifies Cav-1, Rgs2 and Rgs5 as antihypertensive targets.
Grayson TH, etal., BMC Genomics. 2007 Nov 7;8(1):404.
36.
Caveolin-1 regulates nitric oxide-mediated matrix metalloproteinases activity and blood-brain barrier permeability in focal cerebral ischemia and reperfusion injury.
Gu Y, etal., J Neurochem. 2012 Jan;120(1):147-56. doi: 10.1111/j.1471-4159.2011.07542.x. Epub 2011 Nov 17.
37.
Association of a CAV-1 haplotype to familial aggressive prostate cancer.
Haeusler J, etal., Prostate. 2005 Oct 1;65(2):171-7.
38.
Invasion activating caveolin-1 mutation in human scirrhous breast cancers.
Hayashi K, etal., Cancer Res. 2001 Mar 15;61(6):2361-4.
39.
Influence of caveolin on constitutively activated recombinant eNOS: insights into eNOS dysfunction in BDL rat liver.
Hendrickson H, etal., Am J Physiol Gastrointest Liver Physiol 2003 Sep;285(3):G652-60. Epub 2003 Jun 26.
40.
Impact of caveolin-1 expression on clinicopathological parameters in renal cell carcinoma.
Horiguchi A, etal., J Urol. 2004 Aug;172(2):718-22.
41.
Caveolin 3-mediated integrin beta1 signaling is required for the proliferation of folliculostellate cells in rat anterior pituitary gland under the influence of extracellular matrix.
Horiguchi K, etal., J Endocrinol. 2011 Jul;210(1):29-36. Epub 2011 Apr 20.
42.
Caveolin-3 expression and caveolae are required for isoflurane-induced cardiac protection from hypoxia and ischemia/reperfusion injury.
Horikawa YT, etal., J Mol Cell Cardiol. 2008 Jan;44(1):123-30. Epub 2007 Oct 11.
43.
Dietary obesity increases NO and inhibits BKCa-mediated, endothelium-dependent dilation in rat cremaster muscle artery: association with caveolins and caveolae.
Howitt L, etal., Am J Physiol Heart Circ Physiol. 2012 Jun;302(12):H2464-76. Epub 2012 Apr 6.
44.
Endothelin-1 activates mesangial cell ERK1/2 via EGF-receptor transactivation and caveolin-1 interaction.
Hua H, etal., Am J Physiol Renal Physiol 2003 Feb;284(2):F303-12.
45.
The potential role of caveolin-1 in inhibition of aquaporins during the AVD.
Jablonski EM and Hughes FM Jr, Biol Cell. 2006 Jan;98(1):33-42.
46.
Caveolin-1 deficiency increases cerebral ischemic injury.
Jasmin JF, etal., Circ Res. 2007 Mar 16;100(5):721-9. Epub 2007 Feb 9.
47.
Caveolin-1 sensitizes rat pituitary adenoma GH3 cells to bromocriptine induced apoptosis.
Jiang YN, etal., Cancer Cell Int. 2007 Mar 2;7:1.
48.
Caveolin-1 and caveolin-3 regulate Ca2+ homeostasis of single smooth muscle cells from rat cerebral resistance arteries.
Kamishima T, etal., Am J Physiol Heart Circ Physiol. 2007 Jul;293(1):H204-14. Epub 2007 Mar 2.
49.
Association study of genetic variants on chromosome 7q31 with susceptibility to normal tension glaucoma in a Japanese population.
Kato T, etal., Eye (Lond). 2013 Aug;27(8):979-83. doi: 10.1038/eye.2013.123. Epub 2013 Jun 7.
50.
Caveolin regulates microtubule polymerization in the vascular smooth muscle cells.
Kawabe J, etal., Biochem Biophys Res Commun. 2006 Mar 31;342(1):164-9. Epub 2006 Feb 3.
51.
Increased phosphorylation of caveolin-1 in the sciatic nerves of Lewis rats with experimental autoimmune neuritis.
Kim H, etal., Brain Res. 2007 Mar 16;1137(1):153-60. Epub 2006 Dec 20.
52.
Increased phosphorylation of caveolin-1 in the spinal cord of irradiated rats.
Kim H, etal., J Vet Sci. 2007 Dec;8(4):323-7.
53.
Caveolin-1 expression by means of p38beta mitogen-activated protein kinase mediates the antiproliferative effect of carbon monoxide.
Kim HP, etal., Proc Natl Acad Sci U S A. 2005 Aug 9;102(32):11319-24. Epub 2005 Jul 28.
54.
Caveolin isoforms in resident and elicited rat peritoneal macrophages.
Kiss AL, etal., Eur J Cell Biol. 2000 May;79(5):343-9.
55.
Oestrogen-mediated tyrosine phosphorylation of caveolin-1 and its effect on the oestrogen receptor localisation: an in vivo study.
Kiss AL, etal., Mol Cell Endocrinol. 2005 Dec 21;245(1-2):128-37. Epub 2005 Dec 20.
56.
REDOX REGULATION OF ISCHEMIC PRECONDITIONING IS MEDIATED BY THE DIFFERENTIAL ACTIVATION OF CAVEOLINS AND THEIR ASSOCIATION WITH eNOS AND GLUT-4.
Koneru S, etal., Am J Physiol Heart Circ Physiol. 2007 Feb 2;.
57.
Caveolin-1 and -2 in airway epithelium: expression and in situ association as detected by FRET-CLSM.
Krasteva G, etal., Respir Res. 2006 Aug 11;7:108.
58.
Increased expression of endothelial nitric oxide synthase and caveolin-1 in the aorta of rats with isoproterenol-induced cardiac hypertrophy.
Krenek P, etal., Can J Physiol Pharmacol. 2006 Dec;84(12):1245-50.
59.
Transitional cell carcinomas and nonurothelial carcinomas of the urinary bladder differ in the promoter methylation status of the caveolin-1, hDAB2IP and p53 genes, but not in the global methylation of Alu elements.
Kunze E, etal., Int J Mol Med. 2006 Jan;17(1):3-13.
60.
Co-localization and interaction of b0,+-type amino acid transporter 1 (BAT1) with caveolin-1 in rat kidney.
Kwak JO, etal., J Nephrol. 2005 Nov-Dec;18(6):681-9.
61.
MLC1 trafficking and membrane expression in astrocytes: role of caveolin-1 and phosphorylation.
Lanciotti A, etal., Neurobiol Dis. 2010 Mar;37(3):581-95. Epub 2009 Nov 26.
62.
Caveolin-1 and -2 interact with connexin43 and regulate gap junctional intercellular communication in keratinocytes.
Langlois S, etal., Mol Biol Cell. 2008 Mar;19(3):912-28. Epub 2007 Dec 27.
63.
Fibrosis-associated single-nucleotide polymorphisms in TGFB1 and CAV1 are not associated with the development of nephrogenic systemic fibrosis.
Le LP, etal., Am J Dermatopathol. 2013 May;35(3):351-6. doi: 10.1097/DAD.0b013e31826c5508.
64.
Caveolin-1 mutations (P132L and null) and the pathogenesis of breast cancer: caveolin-1 (P132L) behaves in a dominant-negative manner and caveolin-1 (-/-) null mice show mammary epithelial cell hyperplasia.
Lee H, etal., Am J Pathol. 2002 Oct;161(4):1357-69.
65.
Upregulation of caveolin-1 contributes to aggravated high-salt diet-induced endothelial dysfunction and hypertension in type 1 diabetic rats.
Li X, etal., Life Sci. 2014 Sep 15;113(1-2):31-9. doi: 10.1016/j.lfs.2014.07.027. Epub 2014 Jul 30.
66.
Caveolin-1 plays a crucial role in inhibiting neuronal differentiation of neural stem/progenitor cells via VEGF signaling-dependent pathway.
Li Y, etal., PLoS One. 2011;6(8):e22901. Epub 2011 Aug 3.
67.
Caveolin-1 expression in benign and malignant lesions of the breast.
Liedtke C, etal., World J Surg Oncol. 2007 Oct 3;5:110.
68.
A novel caveolin-1 biomarker for clinical outcome of sarcopenia.
Lin CH, etal., In Vivo. 2014 May-Jun;28(3):383-9.
69.
The regulation of the cardiac potassium channel (HERG) by caveolin-1.
Lin J, etal., Biochem Cell Biol. 2008 Oct;86(5):405-15. doi: 10.1139/o08-118.
70.
Molecular interaction between caveolin-1 and ABCA1 on high-density lipoprotein-mediated cholesterol efflux in aortic endothelial cells.
Lin YC, etal., Cardiovasc Res. 2007 Aug 1;75(3):575-83. Epub 2007 Apr 21.
71.
Significant association of caveolin-1 (CAV1) genotypes with breast cancer in Taiwan.
Liu LC, etal., Anticancer Res. 2011 Oct;31(10):3511-5.
72.
Caveolin 1 and G-Protein-Coupled Receptor Kinase-2 Coregulate Endothelial Nitric Oxide Synthase Activity in Sinusoidal Endothelial Cells.
Liu S, etal., Am J Pathol. 2017 Apr;187(4):896-907. doi: 10.1016/j.ajpath.2016.11.017. Epub 2017 Feb 3.
73.
Association of CAV1/CAV2 genomic variants with primary open-angle glaucoma overall and by gender and pattern of visual field loss.
Loomis SJ, etal., Ophthalmology. 2014 Feb;121(2):508-16. doi: 10.1016/j.ophtha.2013.09.012. Epub 2013 Oct 25.
74.
High-fat feeding period affects gene expression in rat white adipose tissue.
Lopez IP, etal., Mol Cell Biochem. 2005 Jul;275(1-2):109-15.
75.
ATP dependence of the SNARE/caveolin 1 interaction in the hippocampus.
Magga JM, etal., Biochem Biophys Res Commun 2002 Mar 15;291(5):1232-8.
76.
14-Deoxyandrographolide targets adenylate cyclase and prevents ethanol-induced liver injury through constitutive NOS dependent reduced redox signaling in rats.
Mandal S, etal., Food Chem Toxicol. 2013 Sep;59:236-48. doi: 10.1016/j.fct.2013.05.056. Epub 2013 Jun 10.
77.
Evidence for caveolin-1 as a new susceptibility gene regulating tissue fibrosis in systemic sclerosis.
Manetti M, etal., Ann Rheum Dis. 2012 Jun;71(6):1034-41. doi: 10.1136/annrheumdis-2011-200986. Epub 2012 Mar 8.
78.
Sonic hedgehog ligand partners with caveolin-1 for intracellular transport.
Mao H, etal., Lab Invest. 2009 Mar;89(3):290-300. Epub 2009 Jan 12.
79.
Caveolin-1 and mitochondrial alterations in regenerating rat liver.
Mastrodonato M, etal., Microsc Res Tech. 2012 Aug;75(8):1026-32. doi: 10.1002/jemt.22027. Epub 2012 Mar 19.
80.
Disruption of endothelial-cell caveolin-1alpha/raft scaffolding during development of monocrotaline-induced pulmonary hypertension.
Mathew R, etal., Circulation. 2004 Sep 14;110(11):1499-506. Epub 2004 Sep 7.
81.
Caveolin-1 and altered neuregulin signaling contribute to the pathophysiological progression of diabetic peripheral neuropathy.
McGuire JF, etal., Diabetes. 2009 Nov;58(11):2677-86. doi: 10.2337/db09-0594. Epub 2009 Aug 12.
82.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
83.
Comparative effect of fish oil feeding and other dietary fatty acids on plasma lipoproteins, biliary lipids, and hepatic expression of proteins involved in reverse cholesterol transport in the rat.
Morgado N, etal., Ann Nutr Metab. 2005 Nov-Dec;49(6):397-406. Epub 2005 Oct 14.
84.
Decreased endothelial nitric-oxide synthase (eNOS) activity resulting from abnormal interaction between eNOS and its regulatory proteins in hypoxia-induced pulmonary hypertension.
Murata T, etal., J Biol Chem 2002 Nov 15;277(46):44085-92. Epub 2002 Aug 15.
85.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
86.
Association of the low-density lipoprotein receptor with caveolae in hamster and rat liver.
Ness GC, etal., Biochem Biophys Res Commun 2003 Mar 28;303(1):177-81.
87.
Reverse cholesterol transport and cholesterol efflux in atherosclerosis.
Ohashi R, etal., QJM. 2005 Dec;98(12):845-56. Epub 2005 Oct 28.
88.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
89.
Angiotensin II enhances adenylyl cyclase signaling via Ca2+/calmodulin. Gq-Gs cross-talk regulates collagen production in cardiac fibroblasts.
Ostrom RS, etal., J Biol Chem. 2003 Jul 4;278(27):24461-8. Epub 2003 Apr 23.
90.
Non-existence of caveolin-1 gene mutations in human breast cancer.
Patani N, etal., Breast Cancer Res Treat. 2012 Jan;131(1):307-10. doi: 10.1007/s10549-011-1761-2. Epub 2011 Sep 11.
91.
Increased smooth muscle cell expression of caveolin-1 and caveolae contribute to the pathophysiology of idiopathic pulmonary arterial hypertension.
Patel HH, etal., FASEB J. 2007 Apr 30;.
92.
Growth hormone activity in mitochondria depends on GH receptor Box 1 and involves caveolar pathway targeting.
Perret-Vivancos C, etal., Exp Cell Res. 2006 Feb 1;312(3):215-32.
93.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
94.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
95.
Dynamic and regulated association of caveolin with lipid bodies: modulation of lipid body motility and function by a dominant negative mutant.
Pol A, etal., Mol Biol Cell. 2004 Jan;15(1):99-110. Epub 2003 Oct 3.
96.
In situ prostate cancer gene therapy using a novel adenoviral vector regulated by the caveolin-1 promoter.
Pramudji C, etal., Clin Cancer Res. 2001 Dec;7(12):4272-9.
97.
Prognostic significance of tumor/stromal caveolin-1 expression in breast cancer patients.
Qian N, etal., Cancer Sci. 2011 Aug;102(8):1590-6. doi: 10.1111/j.1349-7006.2011.01985.x. Epub 2011 Jun 27.
98.
Caveolin-1 and -3 dissociations from caveolae to cytosol in the heart during aging and after myocardial infarction in rat.
Ratajczak P, etal., Cardiovasc Res. 2003 Feb;57(2):358-69.
99.
Hexose transporters GLUT1 and GLUT3 are colocalized with hexokinase I in caveolae microdomains of rat spermatogenic cells.
Rauch MC, etal., J Cell Physiol. 2006 May;207(2):397-406.
100.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
101.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
102.
Caveolin-1 Down-Regulation Inhibits Insulin-Like Growth Factor-I Receptor Signal Transduction in H9C2 Rat Cardiomyoblasts.
Salani B, etal., Endocrinology. 2008 Feb;149(2):461-5. Epub 2007 Nov 26.
103.
Caveolae localize protein kinase A signaling to arterial ATP-sensitive potassium channels.
Sampson LJ, etal., Circ Res. 2004 Nov 12;95(10):1012-8. Epub 2004 Oct 21.
104.
Decline in caveolin-1 expression and scaffolding of G protein receptor kinase-2 with age in Fischer 344 aortic vascular smooth muscle.
Schutzer WE, etal., Am J Physiol Heart Circ Physiol. 2005 May;288(5):H2457-64. Epub 2004 Dec 30.
105.
Caveolin-1 facilitates mechanosensitive protein kinase B (Akt) signaling in vitro and in vivo.
Sedding DG, etal., Circ Res. 2005 Apr 1;96(6):635-42. Epub 2005 Feb 24.
106.
Expression of sex hormone-binding globulin, oxytocin receptor, caveolin-1 and p21 in leiomyoma.
Sendemir A, etal., Gynecol Endocrinol. 2008 Feb;24(2):105-12.
107.
Nitric oxide down-regulates caveolin-1 expression in rat brains during focal cerebral ischemia and reperfusion injury.
Shen J, etal., J Neurochem. 2006 Feb;96(4):1078-89. Epub 2006 Jan 17.
108.
Increases in the phosphorylated form of caveolin-1 in the spinal cord of rats with clip compression injury.
Shin T Brain Res. 2007 Apr 13;1141:228-34. Epub 2007 Jan 9.
109.
Expression of caveolin-1, -2, and -3 in the spinal cords of Lewis rats with experimental autoimmune encephalomyelitis.
Shin T, etal., J Neuroimmunol. 2005 Aug;165(1-2):11-20.
110.
Caveolin-1 inhibits breast cancer growth and metastasis.
Sloan EK, etal., Oncogene. 2004 Oct 14;23(47):7893-7.
111.
Focal adhesions in (myo)fibroblasts scaffold adenylyl cyclase with phosphorylated caveolin.
Swaney JS, etal., J Biol Chem. 2006 Jun 23;281(25):17173-9. Epub 2006 Apr 17.
112.
Development of an immunoassay for serum caveolin-1: a novel biomarker for prostate cancer.
Tahir SA, etal., Clin Cancer Res. 2003 Sep 1;9(10 Pt 1):3653-9.
113.
Caveolin 1 is critical for abdominal aortic aneurysm formation induced by angiotensin II and inhibition of lysyl oxidase.
Takayanagi T, etal., Clin Sci (Lond). 2014 Jun;126(11):785-94. doi: 10.1042/CS20130660.
114.
Nerve growth factor blocks the glucose-induced down-regulation of caveolin-1 expression in Schwann cells via p75 neurotrophin receptor signaling.
Tan W, etal., J Biol Chem 2003 Jun 20;278(25):23151-62. Epub 2003 Apr 5.
115.
Common variants near CAV1 and CAV2 are associated with primary open-angle glaucoma.
Thorleifsson G, etal., Nat Genet. 2010 Oct;42(10):906-9. doi: 10.1038/ng.661. Epub 2010 Sep 12.
116.
Cav1 suppresses tumor growth and metastasis in a murine model of cutaneous SCC through modulation of MAPK/AP-1 activation.
Trimmer C, etal., Am J Pathol. 2013 Mar;182(3):992-1004. doi: 10.1016/j.ajpath.2012.11.008. Epub 2012 Dec 22.
117.
Independent amplification of two gene clusters on chromosome 4 in rat endometrial cancer: identification and molecular characterization.
Walentinsson A, etal., Cancer Res 2001 Nov 15;61(22):8263-73.
118.
A dual-color FISH gene map of the proximal region of rat Chromosome 4 and comparative analysis in human and mouse.
Walentinsson A, etal., Mamm Genome 2001 Dec;12(12):900-8.
119.
Caveolin-1 regulates neural differentiation of rat bone mesenchymal stem cells into neurons by modulating Notch signaling.
Wang S, etal., Int J Dev Neurosci. 2013 Feb;31(1):30-5. doi: 10.1016/j.ijdevneu.2012.09.004. Epub 2012 Sep 29.
120.
A role for caveolin-1 in mechanotransduction of fetal type II epithelial cells.
Wang Y, etal., Am J Physiol Lung Cell Mol Physiol. 2010 Jun;298(6):L775-83. Epub 2010 Feb 19.
121.
Developmental iodine deficiency and hypothyroidism impair neural development, upregulate caveolin-1, and downregulate synaptotagmin-1 in the rat cerebellum.
Wang Y, etal., Biol Trace Elem Res. 2011 Dec;144(1-3):1039-49. Epub 2011 May 25.
122.
Caveolin-1 gene disruption promotes mammary tumorigenesis and dramatically enhances lung metastasis in vivo. Role of Cav-1 in cell invasiveness and matrix metalloproteinase (MMP-2/9) secretion.
Williams TM, etal., J Biol Chem. 2004 Dec 3;279(49):51630-46. Epub 2004 Sep 7.
123.
Caveolin-1 is enriched in the peroxisomal membrane of rat hepatocytes.
Woudenberg J, etal., Hepatology. 2010 May;51(5):1744-53.
124.
Loss of stromal caveolin-1 expression in malignant melanoma metastases predicts poor survival.
Wu KN, etal., Cell Cycle. 2011 Dec 15;10(24):4250-5. doi: 10.4161/cc.10.24.18551. Epub 2011 Dec 15.
125.
Low-Frequency Ultrasound Irradiation Increases Blood-Tumor Barrier Permeability by Transcellular Pathway in a Rat Glioma Model.
Xia CY, etal., J Mol Neurosci. 2012 Apr 20.
126.
The role of caveolin1 and sprouty1 in genistein's regulation of vascular smooth muscle cell and endothelial cell proliferation.
Xiang Q, etal., Eur J Pharmacol. 2010 Dec 1;648(1-3):153-61. Epub 2010 Sep 7.
127.
Pretreatment with andrographolide pills((R)) attenuates lipopolysaccharide-induced pulmonary microcirculatory disturbance and acute lung injury in rats.
Yang N, etal., Microcirculation. 2014 Nov;21(8):703-16. doi: 10.1111/micc.12152.
128.
Skew in the human caveolin 1 gene upstream purine complex homozygote haplotype compartment in multiple sclerosis.
Zarif Yeganeh M, etal., J Neuroimmunol. 2009 Nov 30;216(1-2):103-7. doi: 10.1016/j.jneuroim.2009.09.007. Epub 2009 Oct 13.
129.
Caveolin-1 phosphorylation is required for stretch-induced EGFR and Akt activation in mesangial cells.
Zhang B, etal., Cell Signal. 2007 Aug;19(8):1690-700. Epub 2007 Mar 19.
130.
Integrated Analysis of Multiple Microarray Studies to Identify Core Gene-Expression Signatures Involved in Tubulointerstitial Injury in Diabetic Nephropathy.
Zhou H, etal., Biomed Res Int. 2022 May 10;2022:9554658. doi: 10.1155/2022/9554658. eCollection 2022.
131.
Xuezhikang, extract of red yeast rice, improved abnormal hemorheology, suppressed caveolin-1 and increased eNOS expression in atherosclerotic rats.
Zhu XY, etal., PLoS One. 2013 May 10;8(5):e62731. doi: 10.1371/journal.pone.0062731. Print 2013.
132.
Caveolin and GLT-1 gene expression is reciprocally regulated in primary astrocytes: association of GLT-1 with non-caveolar lipid rafts.
Zschocke J, etal., Glia. 2005 Jan 15;49(2):275-87.
Cav1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 46,606,538 - 46,639,616 (+) NCBI GRCr8 mRatBN7.2 4 45,640,624 - 45,673,708 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 45,634,918 - 45,673,705 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 50,634,317 - 50,667,383 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 46,555,310 - 46,588,376 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 44,969,814 - 45,002,892 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 44,597,123 - 44,630,206 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 44,597,123 - 44,630,200 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 45,203,494 - 45,236,461 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 42,956,102 - 42,989,057 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 4 43,098,177 - 43,130,873 (+) NCBI Celera 4 40,918,628 - 40,949,677 (+) NCBI Celera Cytogenetic Map 4 q22 NCBI
CAV1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 116,525,009 - 116,561,185 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 116,524,994 - 116,561,179 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 116,165,063 - 116,201,239 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 115,952,075 - 115,988,466 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 115,758,789 - 115,795,181 NCBI Celera 7 110,972,249 - 111,008,654 (+) NCBI Celera Cytogenetic Map 7 q31.2 NCBI HuRef 7 110,530,835 - 110,566,784 (+) NCBI HuRef CHM1_1 7 116,098,482 - 116,134,827 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 117,840,041 - 117,876,175 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 115,560,275 - 115,596,679 (+) NCBI
Cav1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 17,306,387 - 17,341,323 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 17,306,334 - 17,341,451 (+) Ensembl GRCm39 Ensembl GRCm38 6 17,306,335 - 17,341,328 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 17,306,335 - 17,341,452 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 17,256,370 - 17,291,324 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 17,256,370 - 17,291,324 (+) NCBI MGSCv36 mm8 Celera 6 17,378,835 - 17,414,670 (+) NCBI Celera Cytogenetic Map 6 A2 NCBI cM Map 6 7.73 NCBI
Cav1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955432 22,258,250 - 22,292,403 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955432 22,258,262 - 22,292,403 (+) NCBI ChiLan1.0 ChiLan1.0
CAV1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 153,356,633 - 153,393,045 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 5,367,106 - 5,403,301 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 108,497,125 - 108,533,090 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 121,193,678 - 121,229,655 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 121,193,424 - 121,229,655 (+) Ensembl panpan1.1 panPan2
CAV1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 14 55,458,934 - 55,494,563 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 14 55,461,048 - 55,492,935 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 14 54,856,462 - 54,888,069 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 14 55,500,946 - 55,536,541 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 14 55,503,040 - 55,536,538 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 14 55,530,973 - 55,562,566 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 14 55,219,411 - 55,251,015 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 14 55,590,528 - 55,622,125 (+) NCBI UU_Cfam_GSD_1.0
Cav1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 44,152,891 - 44,185,619 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936589 2,504,224 - 2,537,170 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936589 2,504,235 - 2,536,778 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CAV1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 18 29,649,992 - 29,682,465 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 18 29,648,120 - 29,682,451 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 18 31,745,664 - 31,778,987 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CAV1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 21 85,222,724 - 85,258,562 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 21 85,222,879 - 85,258,627 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666042 18,474,866 - 18,510,943 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cav1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 179 Count of miRNA genes: 135 Interacting mature miRNAs: 153 Transcripts: ENSRNOT00000009253 Prediction methods: Miranda Result types: miRGate_prediction
2302371 Stl22 Serum triglyceride level QTL 22 5.15 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 57114705 Rat 2303585 Bw86 Body weight QTL 86 4 body mass (VT:0001259) body weight (CMO:0000012) 4 14678065 59678065 Rat 1358352 Srcrt3 Stress Responsive Cort QTL 3 2.29 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 38465774 146803430 Rat 61445 Strs3 Sensitivity to stroke QTL 3 3 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 4 40433388 85433388 Rat 6893678 Bw108 Body weight QTL 108 2.6 0.006 body mass (VT:0001259) body weight (CMO:0000012) 4 43457976 88457976 Rat 8552906 Pigfal3 Plasma insulin-like growth factor 1 level QTL 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 4 10084089 55084089 Rat 10755501 Bp390 Blood pressure QTL 390 2.5 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 4 26775591 168368347 Rat 1331807 Rf31 Renal function QTL 31 2.988 urine potassium amount (VT:0010539) urine potassium level (CMO:0000128) 4 39524264 74726312 Rat 6478766 Anxrr47 Anxiety related response QTL 47 0.09637 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 4 10084089 55084089 Rat 8552782 Vie1 Viral induced encephalitis QTL 1 26.4 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 631642 Stl2 Serum triglyceride level QTL 2 3.3 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5219178 56647776 Rat 6478769 Anxrr48 Anxiety related response QTL 48 0.02514 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 4 10084089 55084089 Rat 631261 Tcas3 Tongue tumor susceptibility QTL 3 6.88 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 4 10814170 91360527 Rat 2312567 Glom19 Glomerulus QTL 19 1.9 0.006 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 4 45456990 146803430 Rat 2313401 Anxrr27 Anxiety related response QTL 27 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 4 17933508 62933508 Rat 8655961 Kidm43 Kidney mass QTL 43 18 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 4 36303261 103194984 Rat 1354612 Foco1 Food consumption QTL 1 8.87 eating behavior trait (VT:0001431) food intake rate (CMO:0000427) 4 44463908 148090542 Rat 6909128 Pancm4 Pancreatic morphology QTL 4 11.35 pancreas mass (VT:0010144) pancreas wet weight (CMO:0000626) 4 26907285 75585128 Rat 8694374 Bw155 Body weight QTL 155 3.39 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 4 10084089 55084089 Rat 2303168 Bp330 Blood pressure QTL 330 4.25 0.017 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 4 5214602 146446691 Rat 8552801 Bw143 Body weight QTL 143 7.3 body mass (VT:0001259) change in body weight to body weight ratio (CMO:0002216) 4 34430484 82490359 Rat 61475 Aia2 Adjuvant induced arthritis QTL 2 5.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 4 39505275 73892441 Rat 8694439 Bw168 Body weight QTL 168 9.57 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 4 40433414 85433414 Rat 61412 Pia2 Pristane induced arthritis QTL 2 3.9 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 4 21333343 62278020 Rat 6478724 Anxrr35 Anxiety related response QTL 35 0.00449 defecation behavior trait (VT:0010462) defecation measurement (CMO:0000997) 4 10084089 55084089 Rat 8655906 Rf60 Renal function QTL 60 3.8 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 4 29494195 81006281 Rat 619616 Bp79 Blood pressure QTL 79 0.0292 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 4 5214602 78882945 Rat 1576305 Emca6 Estrogen-induced mammary cancer QTL 6 5.8 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 4 44463720 155883716 Rat 7387227 Uae40 Urinary albumin excretion QTL 40 2.9 0.0052 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 4 17946999 62946999 Rat 6909122 Insul22 Insulin level QTL 22 4.63 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 4 26907285 75585128 Rat 8552809 Vie5 Viral induced encephalitis QTL 5 25.3 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 4 34430484 82490359 Rat 1358203 Stl19 Serum triglyceride level QTL 19 2.8 0.002 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 4 5218294 65958103 Rat 1354660 Salc1 Saline consumption QTL 1 11.26 drinking behavior trait (VT:0001422) saline drink intake rate (CMO:0001627) 4 44463908 148090542 Rat 9590304 Scort17 Serum corticosterone level QTL 17 4.96 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 4 10084089 55084089 Rat 1300139 Hrtrt6 Heart rate QTL 6 2.85 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 4 39524264 116179656 Rat 12798520 Anxrr55 Anxiety related response QTL 55 4.45 0.01 locomotor behavior trait (VT:0001392) number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715) 4 32583980 114627242 Rat 11530004 Niddm71 Non-insulin dependent diabetes mellitus QTL 71 0.001 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 4 32584199 52754138 Rat 2316958 Gluco58 Glucose level QTL 58 10 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 4 11320076 180699135 Rat
RH142797
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 45,672,046 - 45,672,280 (+) MAPPER mRatBN7.2 Rnor_6.0 4 44,628,545 - 44,628,778 NCBI Rnor6.0 Rnor_5.0 4 45,234,800 - 45,235,033 UniSTS Rnor5.0 RGSC_v3.4 4 42,987,400 - 42,987,633 UniSTS RGSC3.4 Celera 4 40,948,019 - 40,948,252 UniSTS RH 3.4 Map 4 284.1 UniSTS Cytogenetic Map 4 q21 UniSTS
AA946480
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 4 45,673,157 - 45,673,362 (+) MAPPER mRatBN7.2 Rnor_6.0 4 44,629,656 - 44,629,860 NCBI Rnor6.0 Rnor_5.0 4 45,235,911 - 45,236,115 UniSTS Rnor5.0 Celera 4 40,949,130 - 40,949,334 UniSTS RH 3.4 Map 4 282.8 UniSTS Cytogenetic Map 4 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000078250 ⟹ ENSRNOP00000073712
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 45,640,546 - 45,673,705 (+) Ensembl Rnor_6.0 Ensembl 4 44,597,123 - 44,630,200 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105620 ⟹ ENSRNOP00000087572
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 45,634,918 - 45,673,700 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111645 ⟹ ENSRNOP00000097222
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 4 45,641,877 - 45,673,700 (+) Ensembl
RefSeq Acc Id:
NM_031556 ⟹ NP_113744
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 46,606,538 - 46,639,616 (+) NCBI mRatBN7.2 4 45,640,624 - 45,673,705 (+) NCBI Rnor_6.0 4 44,597,123 - 44,630,203 (+) NCBI Rnor_5.0 4 45,203,494 - 45,236,461 (+) NCBI RGSC_v3.4 4 42,956,102 - 42,989,057 (+) RGD Celera 4 40,918,628 - 40,949,677 (+) NCBI
Sequence:
AAACCCCTGGCCAACAGCCAAGAGGCTCCCTCTCAGCCACCGCCCCCCGCCAGCGCCTTTCCCCCTCTATACAATACAAGATCTTCCTTCCTCAGTTCTCTTAAATCACAGCCCAGGGAAACCTCCTC AGAGCCTGCAGCCAGCCACGCGCCAGCATGTCTGGGGGTAAATACGTAGACTCCGAGGGACATCTCTACACTGTTCCCATCCGGGAACAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCAGA CGAGGTGAATGAGAAGCAAGTGTACGACGCGCACACCAAGGAGATTGATCTGGTCAACCGCGACCCCAAGCATCTCAACGACGACGTGGTCAAGATTGACTTTGAAGATGTGATTGCGGAACCAGAAG GGACACACAGTTTCGACGGCATCTGGAAGGCCAGCTTCACCACCTTCACTGTGACAAAATATTGGTTTTACCGCTTGCTGTCTACCATCTTCGGCATCCCTATGGCGCTCATCTGGGGCATCTACTTT GCCATCCTCTCTTTCCTGCACATCTGGGCAGTTGTACCGTGCATCAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCTTCTGTGATCCACTCTTTGAAGC GATTGGCAAGATATTCAGCAATATCCGCATCAGCACGCAGAAAGAGATATGAGTGACATTTCAGGGATGGAAGGCTTTTCTCCCCCTTACTATTCCCTTGGTGCCAATTCCAAGTTGCTATCACAGCC GTGATTTCTGAATGGTTTGTCTTGGTCAAGAACAAAGAATTCATTCCCTCCATTTTCATGTATACTGCTTGTCTCTCCTGAGCTACTGCATCTATTTTTGACAGTCTGGAATGTTTAAACCCATTCCT GCTCTCCCGTTCCTTTGTGGATCATTGTTTCATTGGCTAAAATATAAACATGTTGTTGAAAGATACTTTGAGAAAAAATAGGAAGACTGGGAGGCGGAGGATGAGTGCCAACACCCTCGACTGCCTGC TCTAGGCGATGAGGTTATAGAAAGGGAAGAGTTTCAGGATATGGCTGTGTGTGTAGGGGGCATGAAGGCAGGTTATAAACAAATATATCCCAGCTGCCTAAGGAGTTGGTTGCTGTCCTCACTCTTAA CAATCCAGTGGGATCTAGTGATCAACATCAGTTTGGAGACTCTAATCTTCATGCTCATGTATTCATCCTGACATTTTAACTTGTTATTCTGTGTGACCGAATACTTGTTATACCTAGAATACGACCTA AGTGCCTTCTGATTTCTCATGATTTCTTTTCAAACAGGGTCTAAGTCATCTACTTGCATTTTGCCAGAAGCTCTCCGGAAAACAAAGCATACAAAATCTACTTGCTATTTCTCTGTACTTGTTTCTGA CTCTGAGACACAGAACCTGTTGAAGTTGATCTCTGCGCTTGGTTTTGTAGCGTCTTTCTCTATACTAAGCCCAGTCAACATTAACCCAGTGAAATGATTCAAAGCAGACAAACGGGGCTGAGACCTCC CTGGAAGAAATAGGAGCCAACTTTACTGGCCACTCAGCACTGAATGAGGCCCTCGGGTCTATTCAGTTTCACTTATTTTCAAGAATAATCACACATTCCCGACTCTTACGCTAACCCCTCACCAGGAT GGTTTAGTGACCAACCAAGATGGCTTAATGACCAACCAGGATGGTTTAGGGACTCAACCCTGTGCTCCCTTTTCAGCTGATGAGTGAGCCTTCAGGGAGGGGTGTCAAAAAACGAGTCTGCCAAAGCA AGATTGCCAAACCTGTTGCAAACGCAACCCCCTTCTAGGCATAGCACAAGTAATAGTCTGTAACGCTGCGAAGCCTGACCTCTCCCCCTGCCAGGAGCCTTTGGCCTAACTCAAGCACCATTTTGTTC AGAGAGAAGATGGGGGAGGGGTGGTAACAAAAGCTTGAGGTAATGTTCTTGCTGGAATAAGTTCAAGTCTTTCTGAACCCAAACTGTGGAATTTCACCTGTGTACCTGAGTCTCCAGAATCCTGCCTG CCTGGGACACCCAAAAGGCTTTTATTCCCCCTGCTCACATGACAGCTCTGCCCTTGGGGATATTTTTAAGACTGCAGATAGGCCTTTGTTTTCACTTTCATACATTTATTGGAACTCTGCTTGACTTG TGTACTCCTTCAGTTTTGCTGACACTTTACCAACCCGCTACCTATTTTGATTGTTCCCATTTGAAACAGACACTGGCATGGCCACAGTTTGACTTTTTAAACTGTGTACATAACTGAAAATGTACTAG ACTGTATACCTGTTTAAATGTAGAGATATCCTTTATCTTTATATAAGGAAAATCACTTGGGAAGTGGTTCTACGTTTCAGTCTTTAAACTGTGTTCCAAGACATGTCTGTTCTTCCTAGATACTCAGT CTTATGCAAGTCAATTGCTGATCCAAAAGGTTACTGAAATTTTATATGCTTACTGATATTTTACACTTTTTTATGCTGCATGTCCTATAAAGATTTCAAATCTGCACAATAAAATTGTTTAACAGTAA AAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
NM_133651 ⟹ NP_598412
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 46,607,972 - 46,639,616 (+) NCBI mRatBN7.2 4 45,642,058 - 45,673,705 (+) NCBI Rnor_6.0 4 44,598,557 - 44,630,203 (+) NCBI Rnor_5.0 4 45,203,494 - 45,236,461 (+) NCBI RGSC_v3.4 4 42,956,102 - 42,989,057 (+) RGD Celera 4 40,920,068 - 40,949,677 (+) NCBI
Sequence:
CGTTGGAGTTTTCTGTGTGCAAAGCCTTTCTCCTGGGAGGTTGAAGCTAGCAAAAGTTGGAGCT CCAGGCTCCCCCCACCAACAGCCAGGCTGACTCTTGACTCTTGTTTTTCTTTCTGAACTCTTCTTCCCACCGCTGTTGCCGCCCTCCCCTGGCTTGGCCGGTTGCCCTCACAGGGACATCTCTACACT GTTCCCATCCGGGAACAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCAGACGAGGTGAATGAGAAGCAAGTGTACGACGCGCACACCAAGGAGATTGATCTGGTCAACCGCGACCCCAAGCA TCTCAACGACGACGTGGTCAAGATTGACTTTGAAGATGTGATTGCGGAACCAGAAGGGACACACAGTTTCGACGGCATCTGGAAGGCCAGCTTCACCACCTTCACTGTGACAAAATATTGGTTTTACC GCTTGCTGTCTACCATCTTCGGCATCCCTATGGCGCTCATCTGGGGCATCTACTTTGCCATCCTCTCTTTCCTGCACATCTGGGCAGTTGTACCGTGCATCAAGAGCTTCCTGATTGAGATTCAGTGC ATCAGCCGTGTCTATTCCATCTACGTCCACACCTTCTGTGATCCACTCTTTGAAGCGATTGGCAAGATATTCAGCAATATCCGCATCAGCACGCAGAAAGAGATATGAGTGACATTTCAGGGATGGAA GGCTTTTCTCCCCCTTACTATTCCCTTGGTGCCAATTCCAAGTTGCTATCACAGCCGTGATTTCTGAATGGTTTGTCTTGGTCAAGAACAAAGAATTCATTCCCTCCATTTTCATGTATACTGCTTGT CTCTCCTGAGCTACTGCATCTATTTTTGACAGTCTGGAATGTTTAAACCCATTCCTGCTCTCCCGTTCCTTTGTGGATCATTGTTTCATTGGCTAAAATATAAACATGTTGTTGAAAGATACTTTGAG AAAAAATAGGAAGACTGGGAGGCGGAGGATGAGTGCCAACACCCTCGACTGCCTGCTCTAGGCGATGAGGTTATAGAAAGGGAAGAGTTTCAGGATATGGCTGTGTGTGTAGGGGGCATGAAGGCAGG TTATAAACAAATATATCCCAGCTGCCTAAGGAGTTGGTTGCTGTCCTCACTCTTAACAATCCAGTGGGATCTAGTGATCAACATCAGTTTGGAGACTCTAATCTTCATGCTCATGTATTCATCCTGAC ATTTTAACTTGTTATTCTGTGTGACCGAATACTTGTTATACCTAGAATACGACCTAAGTGCCTTCTGATTTCTCATGATTTCTTTTCAAACAGGGTCTAAGTCATCTACTTGCATTTTGCCAGAAGCT CTCCGGAAAACAAAGCATACAAAATCTACTTGCTATTTCTCTGTACTTGTTTCTGACTCTGAGACACAGAACCTGTTGAAGTTGATCTCTGCGCTTGGTTTTGTAGCGTCTTTCTCTATACTAAGCCC AGTCAACATTAACCCAGTGAAATGATTCAAAGCAGACAAACGGGGCTGAGACCTCCCTGGAAGAAATAGGAGCCAACTTTACTGGCCACTCAGCACTGAATGAGGCCCTCGGGTCTATTCAGTTTCAC TTATTTTCAAGAATAATCACACATTCCCGACTCTTACGCTAACCCCTCACCAGGATGGTTTAGTGACCAACCAAGATGGCTTAATGACCAACCAGGATGGTTTAGGGACTCAACCCTGTGCTCCCTTT TCAGCTGATGAGTGAGCCTTCAGGGAGGGGTGTCAAAAAACGAGTCTGCCAAAGCAAGATTGCCAAACCTGTTGCAAACGCAACCCCCTTCTAGGCATAGCACAAGTAATAGTCTGTAACGCTGCGAA GCCTGACCTCTCCCCCTGCCAGGAGCCTTTGGCCTAACTCAAGCACCATTTTGTTCAGAGAGAAGATGGGGGAGGGGTGGTAACAAAAGCTTGAGGTAATGTTCTTGCTGGAATAAGTTCAAGTCTTT CTGAACCCAAACTGTGGAATTTCACCTGTGTACCTGAGTCTCCAGAATCCTGCCTGCCTGGGACACCCAAAAGGCTTTTATTCCCCCTGCTCACATGACAGCTCTGCCCTTGGGGATATTTTTAAGAC TGCAGATAGGCCTTTGTTTTCACTTTCATACATTTATTGGAACTCTGCTTGACTTGTGTACTCCTTCAGTTTTGCTGACACTTTACCAACCCGCTACCTATTTTGATTGTTCCCATTTGAAACAGACA CTGGCATGGCCACAGTTTGACTTTTTAAACTGTGTACATAACTGAAAATGTACTAGACTGTATACCTGTTTAAATGTAGAGATATCCTTTATCTTTATATAAGGAAAATCACTTGGGAAGTGGTTCTA CGTTTCAGTCTTTAAACTGTGTTCCAAGACATGTCTGTTCTTCCTAGATACTCAGTCTTATGCAAGTCAATTGCTGATCCAAAAGGTTACTGAAATTTTATATGCTTACTGATATTTTACACTTTTTT ATGCTGCATGTCCTATAAAGATTTCAAATCTGCACAATAAAATTGTTTAACAGTAAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_006236130 ⟹ XP_006236192
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 4 46,607,268 - 46,639,616 (+) NCBI mRatBN7.2 4 45,641,347 - 45,673,708 (+) NCBI Rnor_6.0 4 44,597,846 - 44,630,206 (+) NCBI Rnor_5.0 4 45,203,494 - 45,236,461 (+) NCBI
Sequence:
GAGGCCCGGAGGAGGTCCGAGGTGGGGGAGCCTCTTTCCTCACGAGTACCACCGCCATTGTCAACTACTTCTTGGTACTCTGGTGGACTGAATGTGGCGACCTGGGTTCCCCAATATGACTACGGTTC AGCCTGGAGTAGACAGCCTGGGGGTGATCTAAGGACATCTCTACACTGTTCCCATCCGGGAACAGGGCAACATCTACAAGCCCAACAACAAGGCCATGGCAGACGAGGTGAATGAGAAGCAAGTGTAC GACGCGCACACCAAGGAGATTGATCTGGTCAACCGCGACCCCAAGCATCTCAACGACGACGTGGTCAAGATTGACTTTGAAGATGTGATTGCGGAACCAGAAGGGACACACAGTTTCGACGGCATCTG GAAGGCCAGCTTCACCACCTTCACTGTGACAAAATATTGGTTTTACCGCTTGCTGTCTACCATCTTCGGCATCCCTATGGCGCTCATCTGGGGCATCTACTTTGCCATCCTCTCTTTCCTGCACATCT GGGCAGTTGTACCGTGCATCAAGAGCTTCCTGATTGAGATTCAGTGCATCAGCCGTGTCTATTCCATCTACGTCCACACCTTCTGTGATCCACTCTTTGAAGCGATTGGCAAGATATTCAGCAATATC CGCATCAGCACGCAGAAAGAGATATGAGTGACATTTCAGGGATGGAAGGCTTTTCTCCCCCTTACTATTCCCTTGGTGCCAATTCCAAGTTGCTATCACAGCCGTGATTTCTGAATGGTTTGTCTTGG TCAAGAACAAAGAATTCATTCCCTCCATTTTCATGTATACTGCTTGTCTCTCCTGAGCTACTGCATCTATTTTTGACAGTCTGGAATGTTTAAACCCATTCCTGCTCTCCCGTTCCTTTGTGGATCAT TGTTTCATTGGCTAAAATATAAACATGTTGTTGAAAGATACTTTGAGAAAAAATAGGAAGACTGGGAGGCGGAGGATGAGTGCCAACACCCTCGACTGCCTGCTCTAGGCGATGAGGTTATAGAAAGG GAAGAGTTTCAGGATATGGCTGTGTGTGTAGGGGGCATGAAGGCAGGTTATAAACAAATATATCCCAGCTGCCTAAGGAGTTGGTTGCTGTCCTCACTCTTAACAATCCAGTGGGATCTAGTGATCAA CATCAGTTTGGAGACTCTAATCTTCATGCTCATGTATTCATCCTGACATTTTAACTTGTTATTCTGTGTGACCGAATACTTGTTATACCTAGAATACGACCTAAGTGCCTTCTGATTTCTCATGATTT CTTTTCAAACAGGGTCTAAGTCATCTACTTGCATTTTGCCAGAAGCTCTCCGGAAAACAAAGCATACAAAATCTACTTGCTATTTCTCTGTACTTGTTTCTGACTCTGAGACACAGAACCTGTTGAAG TTGATCTCTGCGCTTGGTTTTGTAGCGTCTTTCTCTATACTAAGCCCAGTCAACATTAACCCAGTGAAATGATTCAAAGCAGACAAACGGGGCTGAGACCTCCCTGGAAGAAATAGGAGCCAACTTTA CTGGCCACTCAGCACTGAATGAGGCCCTCGGGTCTATTCAGTTTCACTTATTTTCAAGAATAATCACACATTCCCGACTCTTACGCTAACCCCTCACCAGGATGGTTTAGTGACCAACCAAGATGGCT TAATGACCAACCAGGATGGTTTAGGGACTCAACCCTGTGCTCCCTTTTCAGCTGATGAGTGAGCCTTCAGGGAGGGGTGTCAAAAAACGAGTCTGCCAAAGCAAGATTGCCAAACCTGTTGCAAACGC AACCCCCTTCTAGGCATAGCACAAGTAATAGTCTGTAACGCTGCGAAGCCTGACCTCTCCCCCTGCCAGGAGCCTTTGGCCTAACTCAAGCACCATTTTGTTCAGAGAGAAGATGGGGGAGGGGTGGT AACAAAAGCTTGAGGTAATGTTCTTGCTGGAATAAGTTCAAGTCTTTCTGAACCCAAACTGTGGAATTTCACCTGTGTACCTGAGTCTCCAGAATCCTGCCTGCCTGGGACACCCAAAAGGCTTTTAT TCCCCCTGCTCACATGACAGCTCTGCCCTTGGGGATATTTTTAAGACTGCAGATAGGCCTTTGTTTTCACTTTCATACATTTATTGGAACTCTGCTTGACTTGTGTACTCCTTCAGTTTTGCTGACAC TTTACCAACCCGCTACCTATTTTGATTGTTCCCATTTGAAACAGACACTGGCATGGCCACAGTTTGACTTTTTAAACTGTGTACATAACTGAAAATGTACTAGACTGTATACCTGTTTAAATGTAGAG ATATCCTTTATCTTTATATAAGGAAAATCACTTGGGAAGTGGTTCTACGTTTCAGTCTTTAAACTGTGTTCCAAGACATGTCTGTTCTTCCTAGATACTCAGTCTTATGCAAGTCAATTGCTGATCCA AAAGGTTACTGAAATTTTATATGCTTACTGATATTTTACACTTTTTTATGCTGCATGTCCTATAAAGATTTCAAATCTGCACAATAAAATTGTTTAACAGTAAAGCA
hide sequence
RefSeq Acc Id:
NP_113744 ⟸ NM_031556
- Peptide Label:
isoform alpha
- UniProtKB:
Q8VIK9 (UniProtKB/Swiss-Prot), Q8VIK8 (UniProtKB/Swiss-Prot), P41350 (UniProtKB/Swiss-Prot), Q2IBC6 (UniProtKB/TrEMBL)
- Sequence:
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIW AVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
hide sequence
RefSeq Acc Id:
NP_598412 ⟸ NM_133651
- Peptide Label:
isoform beta
- UniProtKB:
B1WBN8 (UniProtKB/TrEMBL), Q3MHT6 (UniProtKB/TrEMBL)
- Sequence:
MADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVT KYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
hide sequence
RefSeq Acc Id:
XP_006236192 ⟸ XM_006236130
- Peptide Label:
isoform X1
- UniProtKB:
B1WBN8 (UniProtKB/TrEMBL), Q3MHT6 (UniProtKB/TrEMBL)
- Sequence:
MADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPL FEAIGKIFSNIRISTQKEI
hide sequence
Ensembl Acc Id:
ENSRNOP00000073712 ⟸ ENSRNOT00000078250
Ensembl Acc Id:
ENSRNOP00000087572 ⟸ ENSRNOT00000105620
Ensembl Acc Id:
ENSRNOP00000097222 ⟸ ENSRNOT00000111645
RGD ID: 13692892
Promoter ID: EPDNEW_R3416
Type: initiation region
Name: Cav1_1
Description: caveolin 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 4 44,597,216 - 44,597,276 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-25
Cav1
caveolin 1
Cav1
caveolin 1, caveolae protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2013-03-29
Cav1
caveolin 1, caveolae protein
LOC100362870
caveolin-like
Data merged from RGD:2323909
737654
PROVISIONAL
2012-08-14
Cav1
caveolin 1, caveolae protein
Cav1
caveolin 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2012-08-13
Cav1
caveolin 1
Cav1
caveolin 1, caveolae protein
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2010-05-06
LOC100362870
caveolin-like
Symbol and Name status set to provisional
70820
PROVISIONAL
2008-09-18
Cav1
caveolin 1, caveolae protein
Cav1
caveolin, caveolae protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863
APPROVED
2007-10-01
Cav1
caveolin, caveolae protein 1
Cav
caveolin
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863
APPROVED
2003-04-09
Cav
caveolin
Symbol and Name updated
629477
APPROVED
2003-03-10
Cav
caveolin
Cav1
Data merged from RGD:620347
628472
PROVISIONAL
2002-08-07
Cav1
Symbol and Name status set to provisional
70820
PROVISIONAL
2002-06-10
Cav
Caveolin, caveolae protein, 22 kDa
Symbol and Name status set to approved
70586
APPROVED
Note Type
Note
Reference
gene_disease
upregulated in uterine tumors
70348
gene_disease
upregulated in uterine tumors
70557
gene_expression
expressed in uterus
70348
gene_expression
expressed in uterus
70557
gene_function
binds cholesterol and acts as a cholesterol shuttling protein
1298592
gene_process
inhibits the activity of the Erb B2 tyrosine kinase receptor for neuregulins
1298592