Symbol:
Plau
Name:
plasminogen activator, urokinase
RGD ID:
3343
Description:
Enables peptidase activity. Involved in several processes, including cellular response to glucose stimulus; cellular response to hepatocyte growth factor stimulus; and cellular response to staurosporine. Located in extracellular space. Used to study several diseases, including alcoholic liver cirrhosis; lung disease (multiple); sciatic neuropathy; status epilepticus; and transient cerebral ischemia. Biomarker of brain disease (multiple); end stage renal disease; myocardial infarction; sciatic neuropathy; and thrombosis. Human ortholog(s) of this gene implicated in several diseases, including Alzheimer's disease (multiple); Quebec platelet disorder; end stage renal disease; lung disease (multiple); and mitral valve prolapse. Orthologous to human PLAU (plasminogen activator, urokinase); PARTICIPATES IN fibrinolysis pathway; fibroblast growth factor signaling pathway; coagulation cascade pathway; INTERACTS WITH (+)-catechin; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC124931; U-plasminogen activator; uPA; UPAM; Urinary plasminogen activator urokinase; Urinary plasminogen activator, urokinase; urokinase plasminogen activator; urokinase-type plasminogen activator
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PLAU (plasminogen activator, urokinase) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Plau (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Plau (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PLAU (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PLAU (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Plau (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PLAU (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PLAU (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Plau (plasminogen activator, urokinase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Plau (plasminogen activator, urokinase)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
PLAU (plasminogen activator, urokinase)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
plaua (plasminogen activator, urokinase a)
Alliance
DIOPT (Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Danio rerio (zebrafish):
plaub (plasminogen activator, urokinase b)
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 3,505,485 - 3,511,987 (-) NCBI GRCr8 mRatBN7.2 15 3,456,230 - 3,462,732 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 3,456,232 - 3,462,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 3,466,414 - 3,472,916 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 4,852,895 - 4,859,397 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 3,465,220 - 3,471,722 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 3,644,296 - 3,650,765 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 3,644,769 - 3,650,819 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 3,621,057 - 3,627,467 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 3,680,072 - 3,686,232 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 3,680,073 - 3,686,275 (-) NCBI Celera 15 1,129,191 - 1,135,694 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Plau Rat (+)-catechin increases expression ISO PLAU (Homo sapiens) 6480464 Catechin results in increased expression of PLAU mRNA and Catechin results in increased expression of PLAU protein CTD PMID:11236827 Plau Rat (+)-catechin increases expression EXP 6480464 Catechin results in increased expression of PLAU mRNA CTD PMID:17478321 Plau Rat (+)-catechin multiple interactions ISO PLAU (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Catechin results in increased expression of PLAU mRNA] CTD PMID:11236827 Plau Rat (-)-epigallocatechin 3-gallate decreases expression ISO PLAU (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of PLAU mRNA CTD PMID:16084531 Plau Rat (S)-nicotine multiple interactions ISO PLAU (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of PLAU mRNA] CTD PMID:20061081 Plau Rat (S)-nicotine multiple interactions ISO Plau (Mus musculus) 6480464 PLAU inhibits the reaction [Nicotine binds to CHRNA1 protein] CTD PMID:19690163 Plau Rat (S)-nicotine increases expression ISO PLAU (Homo sapiens) 6480464 Nicotine results in increased expression of PLAU mRNA CTD PMID:20061081 and PMID:23825647 Plau Rat 1,1-dichloroethene decreases expression ISO Plau (Mus musculus) 6480464 vinylidene chloride results in decreased expression of PLAU mRNA CTD PMID:26682919 Plau Rat 1,10-phenanthroline multiple interactions ISO Plau (Mus musculus) 6480464 1 and 10-phenanthroline inhibits the reaction [PLAU protein results in increased activity of MMP9 protein] CTD PMID:20177776 Plau Rat 1,2-dimethylhydrazine increases expression ISO Plau (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of PLAU mRNA CTD PMID:22206623 Plau Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of PLAU mRNA CTD PMID:25380136 Plau Rat 1-octadec-9-enoylglycero-3-phosphate multiple interactions ISO PLAU (Homo sapiens) 6480464 gefitinib inhibits the reaction [lysophosphatidic acid results in increased expression of PLAU mRNA] more ... CTD PMID:23127547 Plau Rat 1-octadec-9-enoylglycero-3-phosphate increases expression ISO PLAU (Homo sapiens) 6480464 lysophosphatidic acid results in increased expression of PLAU mRNA CTD PMID:23127547 Plau Rat 17beta-estradiol decreases expression ISO PLAU (Homo sapiens) 6480464 Estradiol results in decreased expression of PLAU mRNA CTD PMID:23019147 and PMID:25321415 Plau Rat 17beta-estradiol multiple interactions ISO PLAU (Homo sapiens) 6480464 [Estradiol binds to ESR2 protein] which results in decreased expression of PLAU mRNA more ... CTD PMID:17404688 more ... Plau Rat 17beta-estradiol affects expression ISO PLAU (Homo sapiens) 6480464 Estradiol affects the expression of PLAU mRNA CTD PMID:14699072 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Plau (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in decreased expression of PLAU mRNA CTD PMID:21167638 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Plau (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLAU mRNA CTD PMID:21041162 and PMID:27562557 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO PLAU (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of PLAU mRNA CTD PMID:20106945 more ... Plau Rat 2,3,7,8-tetrachlorodibenzodioxine increases stability EXP 6480464 Tetrachlorodibenzodioxin results in increased stability of PLAU mRNA CTD PMID:10833433 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Plau (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of PLAU mRNA CTD PMID:21570461 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PLAU mRNA and Tetrachlorodibenzodioxin results in increased expression of PLAU protein CTD PMID:12128104 and PMID:34747641 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 CGA protein inhibits the reaction [Tetrachlorodibenzodioxin results in increased expression of PLAU protein] CTD PMID:12128104 Plau Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PLAU mRNA CTD PMID:15644576 Plau Rat 2-hydroxypropanoic acid increases expression ISO PLAU (Homo sapiens) 6480464 Lactic Acid results in increased expression of PLAU mRNA CTD PMID:30851411 Plau Rat 2-palmitoylglycerol increases expression ISO PLAU (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of PLAU mRNA CTD PMID:37199045 Plau Rat 3,3',4,4',5-pentachlorobiphenyl increases expression ISO PLAU (Homo sapiens) 6480464 3 more ... CTD PMID:35618242 Plau Rat 3,3'-diindolylmethane increases expression ISO PLAU (Homo sapiens) 6480464 3 and 3'-diindolylmethane results in increased expression of PLAU mRNA CTD PMID:18025290 Plau Rat 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of PLAU mRNA] CTD PMID:20061081 Plau Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO PLAU (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLAU mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAU mRNA CTD PMID:28628672 Plau Rat 3-methylcholanthrene increases expression ISO PLAU (Homo sapiens) 6480464 Methylcholanthrene results in increased expression of PLAU mRNA CTD PMID:16619036 Plau Rat 3-phenylprop-2-enal multiple interactions ISO PLAU (Homo sapiens) 6480464 cinnamaldehyde inhibits the reaction [TGFB1 protein results in increased expression of PLAU protein] CTD PMID:28258635 Plau Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of PLAU mRNA CTD PMID:25380136 Plau Rat 4,4'-sulfonyldiphenol increases expression ISO Plau (Mus musculus) 6480464 bisphenol S results in increased expression of PLAU mRNA CTD PMID:30951980 Plau Rat 4,4'-sulfonyldiphenol multiple interactions ISO Plau (Mus musculus) 6480464 [bisphenol S co-treated with Tretinoin] results in decreased expression of PLAU mRNA CTD PMID:30951980 Plau Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression ISO Plau (Mus musculus) 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of PLAU mRNA CTD PMID:21167638 Plau Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one multiple interactions ISO Plau (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone] results in decreased expression of PLAU mRNA CTD PMID:21167638 Plau Rat 5-aza-2'-deoxycytidine multiple interactions ISO PLAU (Homo sapiens) 6480464 [Decitabine affects the methylation of PLAU promoter] which affects the expression of PLAU mRNA more ... CTD PMID:18320071 and PMID:21167264 Plau Rat 5-aza-2'-deoxycytidine increases expression ISO PLAU (Homo sapiens) 6480464 Decitabine results in increased expression of PLAU mRNA CTD PMID:16367923 and PMID:18025290 Plau Rat 5-aza-2'-deoxycytidine affects expression ISO PLAU (Homo sapiens) 6480464 Decitabine affects the expression of PLAU mRNA CTD PMID:23300844 Plau Rat 5-fluorouracil affects expression ISO PLAU (Homo sapiens) 6480464 Fluorouracil affects the expression of PLAU mRNA CTD PMID:16584549 Plau Rat 5-fluorouracil increases expression ISO PLAU (Homo sapiens) 6480464 Fluorouracil results in increased expression of PLAU mRNA CTD PMID:24737281 Plau Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PLAU mRNA CTD PMID:30047161 Plau Rat 7,12-dimethyltetraphene increases expression ISO PLAU (Homo sapiens) 6480464 9 more ... CTD PMID:21527772 Plau Rat acetaldehyde multiple interactions EXP 6480464 TGFB1 protein inhibits the reaction [Acetaldehyde results in increased expression of PLAU protein] CTD PMID:15452360 Plau Rat acetaldehyde increases expression EXP 6480464 Acetaldehyde results in increased expression of PLAU mRNA and Acetaldehyde results in increased expression of PLAU protein CTD PMID:10513995 and PMID:15452360 Plau Rat acetaldehyde affects activity EXP 6480464 Acetaldehyde affects the activity of PLAU protein CTD PMID:10513995 Plau Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PLAU mRNA CTD PMID:31881176 Plau Rat actinomycin D multiple interactions ISO PLAU (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Catechin results in increased expression of PLAU mRNA] more ... CTD PMID:11236827 Plau Rat actinomycin D increases expression ISO PLAU (Homo sapiens) 6480464 Dactinomycin results in increased expression of PLAU mRNA CTD PMID:21527772 Plau Rat aflatoxin B1 increases expression ISO PLAU (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of PLAU protein CTD PMID:21527772 Plau Rat aldehydo-D-glucose decreases expression ISO PLAU (Homo sapiens) 6480464 Glucose results in decreased expression of PLAU mRNA CTD PMID:31655124 Plau Rat all-trans-retinoic acid decreases expression ISO PLAU (Homo sapiens) 6480464 Tretinoin results in decreased expression of PLAU mRNA CTD PMID:23724009 Plau Rat all-trans-retinoic acid multiple interactions ISO Plau (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of PLAU mRNA and [bisphenol S co-treated with Tretinoin] results in decreased expression of PLAU mRNA CTD PMID:30951980 Plau Rat all-trans-retinoic acid increases expression ISO PLAU (Homo sapiens) 6480464 Tretinoin results in increased expression of PLAU mRNA CTD PMID:23830798 and PMID:33167477 Plau Rat allyl isothiocyanate decreases expression ISO PLAU (Homo sapiens) 6480464 allyl isothiocyanate results in decreased expression of PLAU protein CTD PMID:37318315 Plau Rat alpha-D-galactose increases expression EXP 6480464 Galactose results in increased expression of PLAU protein CTD PMID:30367734 Plau Rat alpha-D-galactose multiple interactions EXP 6480464 Alpinia oxyphylla fruit extract inhibits the reaction [Galactose results in increased expression of PLAU protein] CTD PMID:30367734 Plau Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLAU mRNA CTD PMID:35163327 Plau Rat amiloride multiple interactions ISO PLAU (Homo sapiens) 6480464 Amiloride inhibits the reaction [PLAU protein results in increased degradation of PLG protein] CTD PMID:14644129 Plau Rat amiloride decreases activity ISO PLAU (Homo sapiens) 6480464 Amiloride results in decreased activity of PLAU protein CTD PMID:11454671 more ... Plau Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of PLAU mRNA CTD PMID:30047161 Plau Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PLAU mRNA CTD PMID:16483693 Plau Rat andrographolide increases expression ISO PLAU (Homo sapiens) 6480464 andrographolide results in increased expression of PLAU mRNA CTD PMID:35724838 Plau Rat anethole decreases expression ISO PLAU (Homo sapiens) 6480464 anethole results in decreased expression of PLAU mRNA CTD PMID:21212515 Plau Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions ISO PLAU (Homo sapiens) 6480464 pyrazolanthrone inhibits the reaction [TNF protein results in increased activity of PLAU protein] more ... CTD PMID:19874453 and PMID:23437203 Plau Rat antirheumatic drug decreases expression ISO PLAU (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of PLAU mRNA CTD PMID:24449571 Plau Rat aripiprazole multiple interactions ISO PLAU (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PLAU mRNA CTD PMID:31476115 Plau Rat aristolochic acid A increases expression ISO PLAU (Homo sapiens) 6480464 aristolochic acid I results in increased expression of PLAU mRNA CTD PMID:33212167 Plau Rat arsane affects expression ISO PLAU (Homo sapiens) 6480464 Arsenic affects the expression of PLAU mRNA CTD PMID:28793237 Plau Rat arsane multiple interactions ISO PLAU (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of PLAU mRNA CTD PMID:28793237 Plau Rat arsenic atom affects expression ISO PLAU (Homo sapiens) 6480464 Arsenic affects the expression of PLAU mRNA CTD PMID:28793237 Plau Rat arsenic atom multiple interactions ISO PLAU (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of PLAU mRNA CTD PMID:28793237 Plau Rat arsenous acid increases expression ISO PLAU (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PLAU mRNA CTD PMID:20458559 Plau Rat arsenous acid decreases expression ISO PLAU (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PLAU mRNA CTD PMID:15962302 more ... Plau Rat arsenous acid multiple interactions ISO PLAU (Homo sapiens) 6480464 [Silybin co-treated with Arsenic Trioxide] results in decreased expression of PLAU mRNA more ... CTD PMID:15962302 more ... Plau Rat atorvastatin calcium decreases expression ISO PLAU (Homo sapiens) 6480464 Atorvastatin results in decreased expression of PLAU protein CTD PMID:16410222 Plau Rat ATP increases secretion ISO Plau (Mus musculus) 6480464 Adenosine Triphosphate results in increased secretion of PLAU protein CTD PMID:20177776 Plau Rat avobenzone increases expression ISO PLAU (Homo sapiens) 6480464 avobenzone results in increased expression of PLAU mRNA CTD PMID:31016361 Plau Rat Azoxymethane multiple interactions ISO Plau (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLAU mRNA CTD PMID:29950665 Plau Rat baicalein decreases activity ISO PLAU (Homo sapiens) 6480464 baicalein results in decreased activity of PLAU protein CTD PMID:21803068 Plau Rat Bardoxolone methyl increases expression ISO PLAU (Homo sapiens) 6480464 bardoxolone methyl results in increased expression of PLAU mRNA CTD PMID:35724838 Plau Rat belinostat increases expression ISO PLAU (Homo sapiens) 6480464 belinostat results in increased expression of PLAU mRNA CTD PMID:26272509 Plau Rat belinostat multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat benazepril multiple interactions EXP 6480464 benazepril inhibits the reaction [Streptozocin results in increased expression of PLAU mRNA] CTD PMID:15322501 Plau Rat benomyl decreases expression ISO PLAU (Homo sapiens) 6480464 Benomyl results in decreased expression of PLAU mRNA CTD PMID:25530041 Plau Rat benzo[a]pyrene affects expression ISO Plau (Mus musculus) 6480464 Benzo(a)pyrene affects the expression of PLAU mRNA CTD PMID:22342234 Plau Rat benzo[a]pyrene increases methylation ISO PLAU (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of PLAU exon and Benzo(a)pyrene results in increased methylation of PLAU promoter CTD PMID:27901495 Plau Rat benzo[a]pyrene increases expression ISO PLAU (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of PLAU mRNA CTD PMID:20106945 more ... Plau Rat benzo[a]pyrene increases expression ISO Plau (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PLAU mRNA CTD PMID:22228805 and PMID:22610609 Plau Rat benzo[b]fluoranthene increases expression ISO Plau (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of PLAU mRNA CTD PMID:26377693 Plau Rat beta-lapachone increases expression ISO PLAU (Homo sapiens) 6480464 beta-lapachone results in increased expression of PLAU mRNA CTD PMID:38218311 Plau Rat beta-naphthoflavone increases expression ISO PLAU (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of PLAU mRNA CTD PMID:32151702 Plau Rat bis(2-chloroethyl) sulfide multiple interactions ISO Plau (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Mustard Gas results in increased activity of PLAU protein] more ... CTD PMID:9101041 Plau Rat bis(2-chloroethyl) sulfide increases expression ISO Plau (Mus musculus) 6480464 Mustard Gas results in increased expression of PLAU mRNA CTD PMID:9101041 Plau Rat bis(2-ethylhexyl) phthalate increases expression ISO PLAU (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of PLAU mRNA CTD PMID:31163220 Plau Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat bisdemethoxycurcumin decreases secretion ISO PLAU (Homo sapiens) 6480464 bisdemethoxycurcumin results in decreased secretion of PLAU protein CTD PMID:18495463 Plau Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PLAU mRNA CTD PMID:25181051 more ... Plau Rat bisphenol A increases expression ISO Plau (Mus musculus) 6480464 bisphenol A results in increased expression of PLAU mRNA CTD PMID:30951980 and PMID:35479511 Plau Rat bisphenol A decreases expression ISO PLAU (Homo sapiens) 6480464 bisphenol A results in decreased expression of PLAU mRNA CTD PMID:29275510 Plau Rat bisphenol A multiple interactions ISO PLAU (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLAU mRNA CTD PMID:28628672 Plau Rat bisphenol A increases expression ISO PLAU (Homo sapiens) 6480464 bisphenol A results in increased expression of PLAU mRNA CTD PMID:27685785 Plau Rat bisphenol F multiple interactions ISO PLAU (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAU mRNA CTD PMID:28628672 Plau Rat bisphenol F multiple interactions ISO Plau (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of PLAU mRNA CTD PMID:30951980 Plau Rat bisphenol F increases expression ISO Plau (Mus musculus) 6480464 bisphenol F results in increased expression of PLAU mRNA CTD PMID:30951980 Plau Rat bleomycin A2 increases expression ISO Plau (Mus musculus) 6480464 Bleomycin results in increased expression of PLAU mRNA and Bleomycin results in increased expression of PLAU protein CTD PMID:25648892 Plau Rat bleomycin A2 multiple interactions ISO Plau (Mus musculus) 6480464 Curcumin inhibits the reaction [Bleomycin results in decreased expression of PLAU mRNA] and Curcumin inhibits the reaction [Bleomycin results in decreased expression of PLAU protein] CTD PMID:35716765 Plau Rat bleomycin A2 decreases expression ISO Plau (Mus musculus) 6480464 Bleomycin results in decreased expression of PLAU mRNA and Bleomycin results in decreased expression of PLAU protein CTD PMID:25648892 and PMID:35716765 Plau Rat butan-1-ol multiple interactions ISO PLAU (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PLAU mRNA CTD PMID:29432896 Plau Rat Butylbenzyl phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat Butylbenzyl phthalate increases expression ISO PLAU (Homo sapiens) 6480464 butylbenzyl phthalate results in increased expression of PLAU protein CTD PMID:33965509 Plau Rat cadmium atom increases expression EXP 6480464 Cadmium results in increased expression of PLAU mRNA CTD PMID:17327699 Plau Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of PLAU mRNA CTD PMID:17327699 Plau Rat capsaicin increases expression ISO PLAU (Homo sapiens) 6480464 Capsaicin results in increased expression of PLAU mRNA CTD PMID:21310942 Plau Rat captan decreases expression ISO Plau (Mus musculus) 6480464 Captan results in decreased expression of PLAU mRNA CTD PMID:31558096 Plau Rat carbamazepine affects expression ISO PLAU (Homo sapiens) 6480464 Carbamazepine affects the expression of PLAU mRNA CTD PMID:25979313 Plau Rat carbendazim decreases expression ISO PLAU (Homo sapiens) 6480464 carbendazim results in decreased expression of PLAU mRNA CTD PMID:25530041 Plau Rat carbofuran increases expression EXP 6480464 Carbofuran results in increased expression of PLAU mRNA CTD PMID:20211217 Plau Rat carbon nanotube affects expression ISO PLAU (Homo sapiens) 6480464 Nanotubes and Carbon affects the expression of PLAU mRNA CTD PMID:25790727 Plau Rat carbon nanotube increases expression ISO Plau (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Plau Rat carbon nanotube increases expression ISO PLAU (Homo sapiens) 6480464 Nanotubes and Carbon results in increased expression of PLAU protein CTD PMID:25790727 Plau Rat carbon nanotube decreases expression ISO PLAU (Homo sapiens) 6480464 Nanotubes and Carbon results in decreased expression of PLAU mRNA CTD PMID:23634900 Plau Rat carbon nanotube multiple interactions ISO PLAU (Homo sapiens) 6480464 [Nanotubes more ... CTD PMID:25790727 Plau Rat casticin decreases expression ISO Plau (Mus musculus) 6480464 casticin results in decreased expression of PLAU protein CTD PMID:28444820 Plau Rat chlordecone increases expression ISO Plau (Mus musculus) 6480464 Chlordecone results in increased expression of PLAU mRNA CTD PMID:33711761 Plau Rat chloropicrin affects expression ISO PLAU (Homo sapiens) 6480464 chloropicrin affects the expression of PLAU mRNA CTD PMID:26352163 Plau Rat choline multiple interactions ISO Plau (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLAU mRNA CTD PMID:20938992 Plau Rat chrysin decreases expression ISO PLAU (Homo sapiens) 6480464 chrysin results in decreased expression of PLAU protein CTD PMID:30578657 Plau Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of PLAU mRNA CTD PMID:22023808 Plau Rat cisplatin affects expression ISO PLAU (Homo sapiens) 6480464 Cisplatin affects the expression of PLAU mRNA CTD PMID:23300844 Plau Rat cisplatin increases expression ISO PLAU (Homo sapiens) 6480464 Cisplatin results in increased expression of PLAU mRNA CTD PMID:27594783 Plau Rat clofibric acid affects expression EXP 6480464 Clofibric Acid affects the expression of PLAU mRNA CTD PMID:17602206 Plau Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of PLAU mRNA CTD PMID:30047161 Plau Rat cobalt dichloride decreases expression ISO PLAU (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of PLAU mRNA CTD PMID:19376846 Plau Rat copper atom multiple interactions ISO PLAU (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PLAU mRNA CTD PMID:30911355 Plau Rat copper(0) multiple interactions ISO PLAU (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of PLAU mRNA CTD PMID:30911355 Plau Rat copper(II) chloride increases expression ISO PLAU (Homo sapiens) 6480464 cupric chloride results in increased expression of PLAU mRNA CTD PMID:38568856 Plau Rat copper(II) sulfate increases expression ISO PLAU (Homo sapiens) 6480464 Copper Sulfate results in increased expression of PLAU mRNA CTD PMID:19549813 Plau Rat corosolic acid increases expression ISO PLAU (Homo sapiens) 6480464 corosolic acid results in increased expression of PLAU mRNA CTD PMID:37939859 Plau Rat crocidolite asbestos decreases expression ISO PLAU (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of PLAU mRNA CTD PMID:23634900 Plau Rat crocidolite asbestos increases expression ISO PLAU (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of PLAU mRNA CTD PMID:18687144 and PMID:25351596 Plau Rat curcumin decreases secretion ISO PLAU (Homo sapiens) 6480464 Curcumin results in decreased secretion of PLAU protein CTD PMID:18495463 Plau Rat curcumin multiple interactions ISO Plau (Mus musculus) 6480464 Curcumin inhibits the reaction [Bleomycin results in decreased expression of PLAU mRNA] and Curcumin inhibits the reaction [Bleomycin results in decreased expression of PLAU protein] CTD PMID:35716765 Plau Rat curcumin increases expression ISO PLAU (Homo sapiens) 6480464 Curcumin results in increased expression of PLAU mRNA CTD PMID:18025290 Plau Rat curcumin multiple interactions ISO PLAU (Homo sapiens) 6480464 TNFSF10 protein promotes the reaction [Curcumin results in decreased expression of PLAU protein] CTD PMID:18226269 Plau Rat curcumin decreases expression ISO PLAU (Homo sapiens) 6480464 Curcumin results in decreased expression of PLAU protein CTD PMID:18226269 Plau Rat cyclophosphamide increases expression ISO PLAU (Homo sapiens) 6480464 Cyclophosphamide results in increased expression of PLAU mRNA CTD PMID:21527772 Plau Rat Cytochalasin H decreases expression ISO PLAU (Homo sapiens) 6480464 cytochalasin H results in decreased expression of PLAU mRNA CTD PMID:30507090 Plau Rat D-glucose decreases expression ISO PLAU (Homo sapiens) 6480464 Glucose results in decreased expression of PLAU mRNA CTD PMID:31655124 Plau Rat DDE increases expression ISO PLAU (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of PLAU mRNA CTD PMID:38568856 Plau Rat demethoxycurcumin decreases secretion ISO PLAU (Homo sapiens) 6480464 demethoxycurcumin results in decreased secretion of PLAU protein CTD PMID:18495463 Plau Rat desferrioxamine B multiple interactions ISO PLAU (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [ferric nitrilotriacetate results in increased activity of PLAU mRNA] and Deferoxamine inhibits the reaction [ferric nitrilotriacetate results in increased expression of PLAU mRNA] CTD PMID:17571974 Plau Rat dexamethasone decreases expression ISO PLAU (Homo sapiens) 6480464 Dexamethasone results in decreased expression of PLAU mRNA and Dexamethasone results in decreased expression of PLAU protein CTD PMID:10467400 and PMID:25047013 Plau Rat dexamethasone multiple interactions ISO PLAU (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLAU mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAU mRNA CTD PMID:28628672 Plau Rat dexamethasone increases expression ISO Plau (Mus musculus) 6480464 Dexamethasone results in increased expression of PLAU mRNA CTD PMID:21041162 Plau Rat dexamethasone decreases activity ISO PLAU (Homo sapiens) 6480464 Dexamethasone results in decreased activity of PLAU protein CTD PMID:10455257 Plau Rat dexamethasone affects expression EXP 6480464 Dexamethasone affects the expression of PLAU protein CTD PMID:10485340 Plau Rat dexamethasone multiple interactions ISO Plau (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Mustard Gas results in increased activity of PLAU protein] and Dexamethasone inhibits the reaction [Mustard Gas results in increased expression of PLAU mRNA] CTD PMID:9101041 Plau Rat dextran sulfate multiple interactions ISO Plau (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLAU mRNA CTD PMID:29950665 Plau Rat diarsenic trioxide decreases expression ISO PLAU (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of PLAU mRNA CTD PMID:15962302 more ... Plau Rat diarsenic trioxide multiple interactions ISO PLAU (Homo sapiens) 6480464 [Silybin co-treated with Arsenic Trioxide] results in decreased expression of PLAU mRNA more ... CTD PMID:15962302 more ... Plau Rat diarsenic trioxide increases expression ISO PLAU (Homo sapiens) 6480464 Arsenic Trioxide results in increased expression of PLAU mRNA CTD PMID:20458559 Plau Rat dibutyl phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat diclofenac increases expression ISO Plau (Mus musculus) 6480464 Diclofenac results in increased expression of PLAU protein CTD PMID:23506792 Plau Rat diclofenac decreases expression ISO Plau (Mus musculus) 6480464 Diclofenac results in decreased expression of PLAU mRNA CTD PMID:35537566 Plau Rat dieckol decreases expression ISO PLAU (Homo sapiens) 6480464 dieckol results in decreased expression of PLAU protein CTD PMID:31291034 Plau Rat diethyl phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat diisobutyl phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat diisononyl phthalate multiple interactions ISO Plau (Mus musculus) 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of PLAU mRNA CTD PMID:39150890 Plau Rat dimethylarsinic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of PLAU mRNA CTD PMID:28793237 Plau Rat dinophysistoxin 1 increases expression ISO PLAU (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of PLAU mRNA CTD PMID:28939011 Plau Rat dioxygen multiple interactions ISO Plau (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of PLAU mRNA and Oxygen deficiency promotes the reaction [PLAU protein results in increased activity of PLG protein] CTD PMID:12485432 and PMID:30529165 Plau Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of PLAU mRNA CTD PMID:33729688 Plau Rat dioxygen multiple interactions ISO PLAU (Homo sapiens) 6480464 genipin inhibits the reaction [Oxygen deficiency results in increased expression of PLAU protein] CTD PMID:29630948 Plau Rat dioxygen increases expression ISO PLAU (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of PLAU protein CTD PMID:29630948 Plau Rat dioxygen increases expression ISO Plau (Mus musculus) 6480464 Oxygen deficiency results in increased expression of PLAU mRNA CTD PMID:12485432 Plau Rat dioxygen increases activity ISO Plau (Mus musculus) 6480464 Oxygen deficiency results in increased activity of PLAU protein CTD PMID:12485432 Plau Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PLAU mRNA CTD PMID:25152437 Plau Rat dorsomorphin multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plau Rat doxorubicin multiple interactions ISO PLAU (Homo sapiens) 6480464 4-(4-fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)imidazole inhibits the reaction [Doxorubicin results in increased expression of PLAU mRNA] more ... CTD PMID:12908082 and PMID:15557793 Plau Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of PLAU mRNA CTD PMID:20211217 Plau Rat doxorubicin affects response to substance ISO PLAU (Homo sapiens) 6480464 PLAU protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Plau Rat doxorubicin decreases response to substance ISO PLAU (Homo sapiens) 6480464 PLAU promoter modified form results in decreased susceptibility to Doxorubicin CTD PMID:16356834 Plau Rat doxorubicin increases expression ISO PLAU (Homo sapiens) 6480464 Doxorubicin results in increased expression of PLAU mRNA and Doxorubicin results in increased expression of PLAU protein CTD PMID:15557793 Plau Rat entinostat increases expression ISO PLAU (Homo sapiens) 6480464 entinostat results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat ethanol decreases expression EXP 6480464 Ethanol results in decreased expression of PLAU mRNA CTD PMID:15353170 Plau Rat ethanol multiple interactions ISO PLAU (Homo sapiens) 6480464 [[Gasoline co-treated with Ethanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of PLAU mRNA CTD PMID:29432896 Plau Rat ethanol multiple interactions ISO Plau (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of PLAU mRNA CTD PMID:30517762 Plau Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of PLAU mRNA CTD PMID:17478321 Plau Rat etoposide increases expression ISO PLAU (Homo sapiens) 6480464 Etoposide results in increased expression of PLAU mRNA CTD PMID:21527772 Plau Rat fenamidone increases expression ISO Plau (Mus musculus) 6480464 fenamidone results in increased expression of PLAU mRNA CTD PMID:27029645 Plau Rat flavonol decreases expression ISO PLAU (Homo sapiens) 6480464 3-hydroxyflavone results in decreased expression of PLAU protein CTD PMID:27600294 Plau Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of PLAU mRNA CTD PMID:24793618 Plau Rat folic acid affects expression ISO PLAU (Homo sapiens) 6480464 Folic Acid affects the expression of PLAU mRNA CTD PMID:16361273 Plau Rat folic acid multiple interactions ISO Plau (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLAU mRNA CTD PMID:20938992 Plau Rat folpet decreases expression ISO Plau (Mus musculus) 6480464 folpet results in decreased expression of PLAU mRNA CTD PMID:31558096 Plau Rat furan increases methylation EXP 6480464 furan results in increased methylation of PLAU gene CTD PMID:22079235 Plau Rat furan increases expression EXP 6480464 furan results in increased expression of PLAU mRNA CTD PMID:27387713 Plau Rat galactose multiple interactions EXP 6480464 Alpinia oxyphylla fruit extract inhibits the reaction [Galactose results in increased expression of PLAU protein] CTD PMID:30367734 Plau Rat galactose increases expression EXP 6480464 Galactose results in increased expression of PLAU protein CTD PMID:30367734 Plau Rat gefitinib multiple interactions ISO PLAU (Homo sapiens) 6480464 gefitinib inhibits the reaction [lysophosphatidic acid results in increased expression of PLAU mRNA] more ... CTD PMID:23127547 Plau Rat geldanamycin multiple interactions ISO PLAU (Homo sapiens) 6480464 [geldanamycin co-treated with PTHLH protein modified form] results in decreased expression of PLAU mRNA CTD PMID:12724357 Plau Rat gemcitabine increases expression ISO PLAU (Homo sapiens) 6480464 Gemcitabine results in increased expression of PLAU mRNA CTD PMID:17039268 Plau Rat Genipin multiple interactions ISO PLAU (Homo sapiens) 6480464 genipin inhibits the reaction [Oxygen deficiency results in increased expression of PLAU protein] CTD PMID:29630948 Plau Rat genistein increases expression ISO PLAU (Homo sapiens) 6480464 Genistein results in increased expression of PLAU mRNA CTD PMID:18025290 Plau Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of PLAU mRNA CTD PMID:21782745 Plau Rat genistein decreases expression ISO PLAU (Homo sapiens) 6480464 Genistein results in decreased expression of PLAU mRNA CTD PMID:23019147 Plau Rat genistein increases expression EXP 6480464 Genistein results in increased expression of PLAU protein CTD PMID:17823541 Plau Rat glucose decreases expression ISO PLAU (Homo sapiens) 6480464 Glucose results in decreased expression of PLAU mRNA CTD PMID:31655124 Plau Rat graphene oxide increases expression ISO PLAU (Homo sapiens) 6480464 graphene oxide results in increased expression of PLAU protein CTD PMID:33219560 and PMID:33219568 Plau Rat heparin decreases expression ISO PLAU (Homo sapiens) 6480464 Heparin analog results in decreased expression of PLAU mRNA CTD PMID:26476401 Plau Rat Hispolon multiple interactions ISO PLAU (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [hispolon results in decreased expression of and results in decreased activity of PLAU protein] and hispolon results in decreased expression of and results in decreased activity of PLAU protein CTD PMID:27037602 Plau Rat hyaluronic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 [Hyaluronic Acid analog binds to and results in increased activity of CD44 protein] which results in increased expression of PLAU mRNA and [Hyaluronic Acid analog binds to and results in increased activity of CD44 protein] which results in increased expression of PLAU protein CTD PMID:12402308 Plau Rat ibuprofen multiple interactions ISO PLAU (Homo sapiens) 6480464 Ibuprofen inhibits the reaction [EGF protein results in increased expression of PLAU mRNA] CTD PMID:16340751 Plau Rat indole-3-methanol increases expression ISO PLAU (Homo sapiens) 6480464 indole-3-carbinol results in increased expression of PLAU mRNA CTD PMID:18025290 Plau Rat indometacin increases expression ISO PLAU (Homo sapiens) 6480464 Indomethacin results in increased expression of PLAU mRNA CTD PMID:16984733 Plau Rat indometacin multiple interactions ISO PLAU (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of PLAU mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of PLAU mRNA CTD PMID:28628672 Plau Rat irinotecan multiple interactions ISO PLAU (Homo sapiens) 6480464 [Oleanolic Acid co-treated with Irinotecan] results in decreased secretion of PLAU protein more ... CTD PMID:36191607 Plau Rat irinotecan decreases secretion ISO PLAU (Homo sapiens) 6480464 Irinotecan results in decreased secretion of PLAU protein CTD PMID:36191607 Plau Rat iron(III) nitrilotriacetate increases expression ISO PLAU (Homo sapiens) 6480464 ferric nitrilotriacetate results in increased expression of PLAU mRNA CTD PMID:17571974 Plau Rat iron(III) nitrilotriacetate increases activity ISO PLAU (Homo sapiens) 6480464 ferric nitrilotriacetate results in increased activity of PLAU mRNA CTD PMID:17571974 Plau Rat iron(III) nitrilotriacetate multiple interactions ISO PLAU (Homo sapiens) 6480464 Deferoxamine inhibits the reaction [ferric nitrilotriacetate results in increased activity of PLAU mRNA] and Deferoxamine inhibits the reaction [ferric nitrilotriacetate results in increased expression of PLAU mRNA] CTD PMID:17571974 Plau Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of PLAU mRNA CTD PMID:20211217 Plau Rat L-methionine multiple interactions ISO Plau (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of PLAU mRNA CTD PMID:20938992 Plau Rat leflunomide increases expression ISO PLAU (Homo sapiens) 6480464 leflunomide results in increased expression of PLAU mRNA CTD PMID:28988120 Plau Rat Licochalcone A multiple interactions ISO PLAU (Homo sapiens) 6480464 licochalcone A promotes the reaction [Sorafenib results in decreased expression of PLAU protein] and Sorafenib promotes the reaction [licochalcone A results in decreased expression of PLAU protein] CTD PMID:30187994 Plau Rat Licochalcone A decreases expression ISO PLAU (Homo sapiens) 6480464 licochalcone A results in decreased expression of PLAU protein CTD PMID:30187994 Plau Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of PLAU mRNA CTD PMID:35283115 Plau Rat lipopolysaccharide affects expression ISO PLAU (Homo sapiens) 6480464 Lipopolysaccharides affects the expression of PLAU mRNA CTD PMID:28070326 Plau Rat lipopolysaccharide multiple interactions EXP 6480464 Plant Extracts inhibits the reaction [Lipopolysaccharides results in increased expression of PLAU protein] and U 0126 inhibits the reaction [Lipopolysaccharides results in increased expression of PLAU protein] CTD PMID:27098997 and PMID:30980805 Plau Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of PLAU protein CTD PMID:27098997 and PMID:30980805 Plau Rat lipopolysaccharide increases expression ISO PLAU (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of PLAU mRNA CTD PMID:18192897 Plau Rat lipopolysaccharide multiple interactions ISO PLAU (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of PLAU mRNA and Plant Extracts affects the reaction [Lipopolysaccharides affects the expression of PLAU mRNA] CTD PMID:28070326 and PMID:35877022 Plau Rat lithium chloride decreases expression ISO PLAU (Homo sapiens) 6480464 Lithium Chloride results in decreased expression of PLAU mRNA CTD PMID:15711924 Plau Rat lithium chloride increases expression ISO PLAU (Homo sapiens) 6480464 Lithium Chloride results in increased expression of PLAU mRNA CTD PMID:23527032 Plau Rat lovastatin decreases secretion ISO Plau (Mus musculus) 6480464 Lovastatin results in decreased secretion of PLAU protein CTD PMID:12405293 Plau Rat LY294002 multiple interactions ISO PLAU (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [hispolon results in decreased expression of and results in decreased activity of PLAU protein] CTD PMID:27037602 Plau Rat malathion increases expression ISO PLAU (Homo sapiens) 6480464 Malathion results in increased expression of PLAU mRNA CTD PMID:32069766 Plau Rat mangiferin multiple interactions EXP 6480464 mangiferin inhibits the reaction [AGT protein results in decreased expression of PLAU mRNA] CTD PMID:19706694 Plau Rat medroxyprogesterone acetate decreases expression ISO PLAU (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in decreased expression of PLAU mRNA CTD PMID:20843944 Plau Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of PLAU mRNA CTD PMID:30047161 Plau Rat methotrexate increases expression ISO PLAU (Homo sapiens) 6480464 Methotrexate results in increased expression of PLAU mRNA CTD PMID:21678067 Plau Rat methotrexate decreases expression ISO PLAU (Homo sapiens) 6480464 Methotrexate results in decreased expression of PLAU mRNA CTD PMID:24449571 Plau Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of PLAU mRNA CTD PMID:21782745 Plau Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of PLAU mRNA CTD PMID:21782745 Plau Rat methylmercury chloride increases expression ISO PLAU (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of PLAU mRNA CTD PMID:28001369 Plau Rat mitomycin C affects response to substance ISO PLAU (Homo sapiens) 6480464 PLAU protein affects the susceptibility to Mitomycin CTD PMID:16217747 Plau Rat morin decreases expression ISO PLAU (Homo sapiens) 6480464 morin results in decreased expression of PLAU protein CTD PMID:38093596 Plau Rat N-acetyl-L-cysteine decreases expression ISO PLAU (Homo sapiens) 6480464 Acetylcysteine results in decreased expression of PLAU mRNA CTD PMID:16084531 Plau Rat N-acetyl-L-cysteine multiple interactions ISO PLAU (Homo sapiens) 6480464 Acetylcysteine inhibits the reaction [arsenic trioxide results in decreased secretion of PLAU protein] CTD PMID:15962302 Plau Rat N-nitrosodiethylamine increases expression ISO PLAU (Homo sapiens) 6480464 Diethylnitrosamine results in increased expression of PLAU mRNA CTD PMID:21527772 Plau Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of PLAU mRNA CTD PMID:25380136 Plau Rat N-tosyl-L-phenylalanyl chloromethyl ketone decreases expression ISO PLAU (Homo sapiens) 6480464 Tosylphenylalanyl Chloromethyl Ketone results in decreased expression of PLAU protein CTD PMID:10467400 Plau Rat nickel atom increases expression ISO PLAU (Homo sapiens) 6480464 Nickel results in increased expression of PLAU mRNA CTD PMID:25583101 Plau Rat nickel sulfate multiple interactions ISO PLAU (Homo sapiens) 6480464 [macrophage stimulatory lipopeptide 2 co-treated with nickel sulfate] results in decreased expression of PLAU mRNA CTD PMID:18832182 Plau Rat nickel sulfate decreases expression ISO PLAU (Homo sapiens) 6480464 nickel sulfate results in decreased expression of PLAU mRNA CTD PMID:18832182 Plau Rat nicotine multiple interactions ISO PLAU (Homo sapiens) 6480464 MK-886 inhibits the reaction [Nicotine results in increased expression of PLAU mRNA] CTD PMID:20061081 Plau Rat nicotine increases expression ISO PLAU (Homo sapiens) 6480464 Nicotine results in increased expression of PLAU mRNA CTD PMID:20061081 and PMID:23825647 Plau Rat nicotine multiple interactions ISO Plau (Mus musculus) 6480464 PLAU inhibits the reaction [Nicotine binds to CHRNA1 protein] CTD PMID:19690163 Plau Rat nonanedioic acid decreases expression ISO PLAU (Homo sapiens) 6480464 azelaic acid results in decreased expression of PLAU mRNA CTD PMID:8635147 Plau Rat nonanedioic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 azelaic acid results in decreased expression of and results in decreased secretion of PLAU protein CTD PMID:8635147 Plau Rat notoginsenoside R1 increases expression ISO PLAU (Homo sapiens) 6480464 notoginsenoside R1 results in increased expression of PLAU mRNA and notoginsenoside R1 results in increased expression of PLAU protein CTD PMID:9220151 Plau Rat oleanolic acid decreases secretion ISO PLAU (Homo sapiens) 6480464 Oleanolic Acid results in decreased secretion of PLAU protein CTD PMID:36191607 Plau Rat oleanolic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 [Oleanolic Acid co-treated with Irinotecan] results in decreased secretion of PLAU protein more ... CTD PMID:36191607 Plau Rat ornidazole decreases expression EXP 6480464 Ornidazole results in decreased expression of PLAU mRNA and Ornidazole results in decreased expression of PLAU protein CTD PMID:18998460 Plau Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of PLAU mRNA CTD PMID:25729387 Plau Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLAU mRNA CTD PMID:25729387 Plau Rat ozone increases expression EXP 6480464 Ozone results in increased expression of PLAU mRNA CTD PMID:16716893 Plau Rat ozone multiple interactions ISO PLAU (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of PLAU mRNA CTD PMID:31476115 Plau Rat ozone increases expression ISO PLAU (Homo sapiens) 6480464 Ozone results in increased expression of PLAU mRNA CTD PMID:31476115 Plau Rat panobinostat multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat panobinostat increases expression ISO PLAU (Homo sapiens) 6480464 panobinostat results in increased expression of PLAU mRNA CTD PMID:26272509 Plau Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of PLAU mRNA CTD PMID:18198484 and PMID:32680482 Plau Rat PD 0325901 multiple interactions ISO PLAU (Homo sapiens) 6480464 [mirdametinib co-treated with (+)-JQ1 compound] results in decreased expression of PLAU mRNA CTD PMID:25119042 Plau Rat PD 0325901 decreases expression ISO PLAU (Homo sapiens) 6480464 mirdametinib results in decreased expression of PLAU mRNA CTD PMID:25119042 Plau Rat pentane-2,3-dione increases expression EXP 6480464 2 and 3-pentanedione results in increased expression of PLAU mRNA CTD PMID:25710175 Plau Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Plau (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of PLAU mRNA CTD PMID:36331819 Plau Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PLAU mRNA CTD PMID:35163327 Plau Rat phenylmercury acetate increases expression ISO PLAU (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of PLAU mRNA CTD PMID:26272509 Plau Rat phenylmercury acetate multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat phorbol 13-acetate 12-myristate multiple interactions ISO PLAU (Homo sapiens) 6480464 arsenic trioxide inhibits the reaction [Tetradecanoylphorbol Acetate results in increased secretion of PLAU protein] CTD PMID:15962302 Plau Rat phorbol 13-acetate 12-myristate multiple interactions ISO Plau (Mus musculus) 6480464 TAC 101 inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of PLAU protein] CTD PMID:9848099 Plau Rat phorbol 13-acetate 12-myristate increases expression ISO Plau (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of PLAU protein CTD PMID:9848099 Plau Rat phorbol 13-acetate 12-myristate increases secretion ISO PLAU (Homo sapiens) 6480464 Tetradecanoylphorbol Acetate results in increased secretion of PLAU protein CTD PMID:15962302 Plau Rat Phytolaccoside E increases expression ISO PLAU (Homo sapiens) 6480464 esculentoside A results in increased expression of PLAU protein CTD PMID:36460195 Plau Rat platycodin D decreases expression EXP 6480464 platycodin D results in decreased expression of PLAU protein CTD PMID:29595072 Plau Rat potassium chromate decreases expression ISO PLAU (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of PLAU mRNA CTD PMID:22714537 Plau Rat progesterone multiple interactions ISO PLAU (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of PLAU mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of PLAU mRNA CTD PMID:17404688 and PMID:20660070 Plau Rat progesterone decreases expression ISO PLAU (Homo sapiens) 6480464 Progesterone results in decreased expression of PLAU mRNA CTD PMID:17404688 and PMID:18070364 Plau Rat propanal increases expression ISO PLAU (Homo sapiens) 6480464 propionaldehyde results in increased expression of PLAU mRNA CTD PMID:26079696 Plau Rat pyrrolidine dithiocarbamate multiple interactions ISO PLAU (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [EGF protein results in increased expression of PLAU mRNA] CTD PMID:16340751 Plau Rat quercetin decreases expression ISO PLAU (Homo sapiens) 6480464 Quercetin results in decreased expression of PLAU mRNA and Quercetin results in decreased expression of PLAU protein CTD PMID:21308698 and PMID:23645742 Plau Rat quercetin increases expression ISO PLAU (Homo sapiens) 6480464 Quercetin results in increased expression of PLAU mRNA and Quercetin results in increased expression of PLAU protein CTD PMID:11236827 and PMID:12724357 Plau Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of PLAU mRNA CTD PMID:17478321 Plau Rat quercetin multiple interactions ISO PLAU (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Quercetin results in increased expression of PLAU mRNA] CTD PMID:11236827 Plau Rat rac-lactic acid increases expression ISO PLAU (Homo sapiens) 6480464 Lactic Acid results in increased expression of PLAU mRNA CTD PMID:30851411 Plau Rat raloxifene multiple interactions ISO PLAU (Homo sapiens) 6480464 [Raloxifene Hydrochloride co-treated with ESR1 protein] results in decreased expression of PLAU mRNA CTD PMID:19059307 Plau Rat raloxifene decreases expression ISO PLAU (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of PLAU protein CTD PMID:16277677 Plau Rat resveratrol multiple interactions ISO PLAU (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [resveratrol results in increased expression of PLAU mRNA] more ... CTD PMID:11236827 more ... Plau Rat resveratrol decreases expression ISO PLAU (Homo sapiens) 6480464 resveratrol results in decreased expression of PLAU mRNA and resveratrol results in decreased expression of PLAU protein CTD PMID:22199285 more ... Plau Rat resveratrol decreases activity ISO PLAU (Homo sapiens) 6480464 resveratrol results in decreased activity of PLAU protein CTD PMID:25605016 Plau Rat resveratrol multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of PLAU mRNA CTD PMID:25905778 Plau Rat resveratrol increases expression ISO PLAU (Homo sapiens) 6480464 resveratrol results in increased expression of PLAU mRNA and resveratrol results in increased expression of PLAU protein CTD PMID:11236827 Plau Rat ryanodine multiple interactions ISO Plau (Mus musculus) 6480464 Ryanodine promotes the reaction [Mustard Gas results in increased activity of PLAU protein] CTD PMID:9101041 Plau Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PLAU (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PLAU mRNA CTD PMID:33725128 Plau Rat SB 431542 increases expression ISO PLAU (Homo sapiens) 6480464 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide results in increased expression of PLAU mRNA CTD PMID:25670856 Plau Rat SB 431542 multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Plau Rat serpentine asbestos increases expression ISO Plau (Mus musculus) 6480464 Asbestos and Serpentine results in increased expression of PLAU mRNA CTD PMID:23917077 Plau Rat serpentine asbestos increases expression ISO PLAU (Homo sapiens) 6480464 Asbestos and Serpentine results in increased expression of PLAU mRNA CTD PMID:9853007 Plau Rat silibinin decreases expression ISO PLAU (Homo sapiens) 6480464 Silybin results in decreased expression of PLAU mRNA CTD PMID:21969006 Plau Rat silibinin multiple interactions ISO PLAU (Homo sapiens) 6480464 [Silybin co-treated with Arsenic Trioxide] results in decreased expression of PLAU mRNA more ... CTD PMID:21969006 Plau Rat silicon dioxide increases expression ISO PLAU (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of PLAU mRNA and Silicon Dioxide results in increased expression of PLAU mRNA CTD PMID:25351596 more ... Plau Rat silicon dioxide increases expression ISO Plau (Mus musculus) 6480464 Silicon Dioxide results in increased expression of PLAU mRNA CTD PMID:19073995 and PMID:29203145 Plau Rat silver atom increases expression ISO Plau (Mus musculus) 6480464 Silver results in increased expression of PLAU mRNA CTD PMID:27131904 Plau Rat silver(0) increases expression ISO Plau (Mus musculus) 6480464 Silver results in increased expression of PLAU mRNA CTD PMID:27131904 Plau Rat simvastatin decreases expression ISO Plau (Mus musculus) 6480464 Simvastatin results in decreased expression of PLAU mRNA CTD PMID:10412775 Plau Rat sodium arsenite multiple interactions ISO PLAU (Homo sapiens) 6480464 decitabine inhibits the reaction [sodium arsenite results in increased expression of PLAU mRNA] more ... CTD PMID:21167264 Plau Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of PLAU protein CTD PMID:21167264 Plau Rat sodium arsenite increases expression ISO PLAU (Homo sapiens) 6480464 sodium arsenite results in increased expression of PLAU mRNA and sodium arsenite results in increased expression of PLAU protein CTD PMID:21167264 and PMID:29301061 Plau Rat sodium arsenite decreases expression ISO PLAU (Homo sapiens) 6480464 sodium arsenite results in decreased expression of PLAU mRNA CTD PMID:12016162 more ... Plau Rat sodium dichromate decreases expression ISO PLAU (Homo sapiens) 6480464 sodium bichromate results in decreased expression of PLAU mRNA and sodium bichromate results in decreased expression of PLAU protein CTD PMID:10438662 and PMID:17685462 Plau Rat sodium hydroxide affects response to substance ISO PLAU (Homo sapiens) 6480464 PLAU SNP affects the susceptibility to Sodium Hydroxide CTD PMID:27206134 Plau Rat sorafenib decreases expression ISO PLAU (Homo sapiens) 6480464 Sorafenib results in decreased expression of PLAU protein CTD PMID:30187994 Plau Rat sorafenib multiple interactions ISO PLAU (Homo sapiens) 6480464 licochalcone A promotes the reaction [Sorafenib results in decreased expression of PLAU protein] and Sorafenib promotes the reaction [licochalcone A results in decreased expression of PLAU protein] CTD PMID:30187994 Plau Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of PLAU mRNA and Streptozocin results in increased expression of PLAU protein CTD PMID:15322501 Plau Rat streptozocin multiple interactions EXP 6480464 [resveratrol co-treated with Streptozocin] results in increased expression of PLAU mRNA and benazepril inhibits the reaction [Streptozocin results in increased expression of PLAU mRNA] CTD PMID:15322501 and PMID:25905778 Plau Rat succimer multiple interactions ISO Plau (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of PLAU mRNA CTD PMID:21641980 Plau Rat succimer multiple interactions ISO PLAU (Homo sapiens) 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of PLAU mRNA CTD PMID:26378955 Plau Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of PLAU mRNA CTD PMID:30047161 Plau Rat sulforaphane increases expression ISO PLAU (Homo sapiens) 6480464 sulforaphane results in increased expression of PLAU mRNA CTD PMID:35724838 Plau Rat sulindac sulfide decreases expression ISO PLAU (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of PLAU mRNA CTD PMID:15767558 Plau Rat sunitinib decreases expression ISO PLAU (Homo sapiens) 6480464 Sunitinib results in decreased expression of PLAU mRNA CTD PMID:31533062 Plau Rat sunitinib decreases secretion ISO PLAU (Homo sapiens) 6480464 Sunitinib results in decreased secretion of PLAU protein CTD PMID:39025287 Plau Rat tamoxifen multiple interactions ISO PLAU (Homo sapiens) 6480464 [Tamoxifen co-treated with ESR1 protein] results in decreased expression of PLAU mRNA CTD PMID:19059307 Plau Rat tebuconazole decreases expression ISO PLAU (Homo sapiens) 6480464 tebuconazole results in decreased expression of PLAU mRNA CTD PMID:26852204 Plau Rat telmisartan multiple interactions EXP 6480464 telmisartan inhibits the reaction [AGT protein results in decreased expression of PLAU mRNA] CTD PMID:19706694 Plau Rat temozolomide increases expression ISO PLAU (Homo sapiens) 6480464 Temozolomide results in increased expression of PLAU mRNA CTD PMID:31758290 Plau Rat tetrachloromethane multiple interactions ISO Plau (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with 1-trifluoromethoxyphenyl-3-(1-propionylpiperidine-4-yl)urea] results in increased expression of PLAU mRNA more ... CTD PMID:18279442 more ... Plau Rat tetrachloromethane increases expression ISO Plau (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of PLAU mRNA CTD PMID:24639359 and PMID:25827057 Plau Rat tetrachloromethane multiple interactions EXP 6480464 PLAU protein inhibits the reaction [Carbon Tetrachloride results in increased expression of ACTA2 protein] more ... CTD PMID:18481824 Plau Rat thalidomide decreases expression ISO Plau (Mus musculus) 6480464 Thalidomide results in decreased expression of PLAU protein CTD PMID:16288038 Plau Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PLAU mRNA CTD PMID:34492290 Plau Rat titanium dioxide multiple interactions ISO Plau (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PLAU mRNA CTD PMID:29950665 Plau Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of PLAU mRNA CTD PMID:25729387 Plau Rat trans-anethole decreases expression ISO PLAU (Homo sapiens) 6480464 anethole results in decreased expression of PLAU mRNA CTD PMID:21212515 Plau Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of PLAU mRNA CTD PMID:33387578 Plau Rat trichostatin A increases expression ISO PLAU (Homo sapiens) 6480464 trichostatin A results in increased expression of PLAU mRNA CTD PMID:24935251 and PMID:26272509 Plau Rat trichostatin A multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat triclosan multiple interactions ISO PLAU (Homo sapiens) 6480464 Triclosan inhibits the reaction [TNF protein results in increased activity of PLAU protein] more ... CTD PMID:19874453 Plau Rat troglitazone increases expression ISO PLAU (Homo sapiens) 6480464 troglitazone results in increased expression of PLAU mRNA CTD PMID:19140230 Plau Rat trovafloxacin increases expression ISO Plau (Mus musculus) 6480464 trovafloxacin results in increased expression of PLAU mRNA CTD PMID:35537566 Plau Rat tubocurarine multiple interactions ISO Plau (Mus musculus) 6480464 Tubocurarine inhibits the reaction [CHRNA1 protein binds to PLAU protein] CTD PMID:19690163 Plau Rat ursolic acid decreases secretion ISO PLAU (Homo sapiens) 6480464 Ursolic Acid results in decreased secretion of PLAU protein CTD PMID:36191607 Plau Rat ursolic acid multiple interactions ISO PLAU (Homo sapiens) 6480464 [Ursolic Acid co-treated with Irinotecan] results in decreased secretion of PLAU protein more ... CTD PMID:36191607 Plau Rat valproic acid increases expression ISO PLAU (Homo sapiens) 6480464 Valproic Acid results in increased expression of PLAU mRNA CTD PMID:24383497 and PMID:28001369 Plau Rat valproic acid affects expression ISO PLAU (Homo sapiens) 6480464 Valproic Acid affects the expression of PLAU mRNA CTD PMID:25979313 Plau Rat valproic acid increases methylation ISO PLAU (Homo sapiens) 6480464 Valproic Acid results in increased methylation of PLAU gene CTD PMID:29154799 Plau Rat vanadium atom increases expression ISO PLAU (Homo sapiens) 6480464 Vanadium results in increased expression of PLAU mRNA CTD PMID:19000753 Plau Rat vanadium(0) increases expression ISO PLAU (Homo sapiens) 6480464 Vanadium results in increased expression of PLAU mRNA CTD PMID:19000753 Plau Rat vincaleukoblastine affects response to substance ISO PLAU (Homo sapiens) 6480464 PLAU protein affects the susceptibility to Vinblastine CTD PMID:16217747 Plau Rat vorinostat multiple interactions ISO PLAU (Homo sapiens) 6480464 [NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of PLAU mRNA CTD PMID:27188386 Plau Rat vorinostat increases expression ISO PLAU (Homo sapiens) 6480464 vorinostat results in increased expression of PLAU mRNA CTD PMID:26272509 Plau Rat zinc atom multiple interactions ISO PLAU (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PLAU mRNA CTD PMID:18593933 Plau Rat zinc(0) multiple interactions ISO PLAU (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of PLAU mRNA CTD PMID:18593933 Plau Rat zoledronic acid increases expression ISO PLAU (Homo sapiens) 6480464 zoledronic acid results in increased expression of PLAU mRNA CTD PMID:20977926
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
Acute Lung Injury (IDA) adenocarcinoma (ISO) adult respiratory distress syndrome (ISO) alcoholic liver cirrhosis (IDA) Alzheimer's disease (ISO,ISS) Alzheimer's disease 1 (ISO) Angina Pectoris (ISO) anuria (ISO) appendicitis (ISO) Arterial Occlusive Diseases (ISO) Asthenozoospermia (IEP,ISO) asthma (ISO) atherosclerosis (ISO) Bone Neoplasms (ISO) brain edema (IEP,ISO) Brain Hypoxia-Ischemia (IDA,IEP) brain ischemia (ISO) breast cancer (IDA,ISO) Cardiomegaly (IDA) carotid artery disease (ISO) Cerebral Hemorrhage (ISO) cerebral infarction (ISO) cerebrovascular disease (ISO) cholesterol embolism (ISO) Chronic Allograft Nephropathy (ISO) Chronic Hepatitis C (ISO) chronic obstructive pulmonary disease (IMP,ISO) Colonic Neoplasms (ISO) Coronary Disease (ISO) Diabetic Nephropathies (IEP) Eczema (ISO) end stage renal disease (IEP,ISO) Experimental Arthritis (ISO) Experimental Liver Cirrhosis (IDA,IEP,IMP,ISO) Experimental Mammary Neoplasms (IMP) Experimental Seizures (ISO) familial hyperlipidemia (ISO) Genitopatellar Syndrome (ISO) gliosarcoma (ISO) Graft Occlusion, Vascular (ISO) Heart Rupture, Post-Infarction (ISO) Hematuria (ISO) Hemorrhage (ISO) Henoch-Schoenlein purpura (ISO) hepatitis B (ISO) hepatocellular carcinoma (ISS) high grade glioma (ISO) Hirschsprung's disease (ISO) Hyperoxia (IEP) Hypotension (ISO) idiopathic pulmonary fibrosis (ISO) IgA glomerulonephritis (ISO) Inflammation (ISO) intermediate coronary syndrome (ISO) intracranial aneurysm (ISO) Intracranial Embolism and Thrombosis (ISO) Intracranial Hemorrhages (IMP,ISO) ischemia (ISO) Jaw Cysts (ISO) Kidney Neoplasms (ISO) Left Ventricular Hypertrophy (ISO) liver cirrhosis (ISO) Lung Injury (IEP) Lung Neoplasms (ISO) lung non-small cell carcinoma (ISO) meningitis (ISO) middle cerebral artery infarction (ISO) mitral valve prolapse (ISO) Mouth Neoplasms (ISO) myocardial infarction (IEP,ISO) Neoplasm Invasiveness (ISO) Neoplasm Metastasis (ISO) Neoplasm Recurrence, Local (ISO) nephritis (ISO) Optic Nerve Injuries (IEP) oral squamous cell carcinoma (ISO) otitis media (ISO) pancreatic cancer (ISO) papillary thyroid carcinoma (ISO) Peripheral Nerve Injuries (IEP) peritonitis (ISO) pleural empyema (ISO) prion disease (ISO) prostate cancer (ISO) Prostatic Neoplasms (ISO) pulmonary embolism (ISO) pulmonary fibrosis (IDA,ISO) Quebec platelet disorder (ISO) renal cell carcinoma (ISO) renal fibrosis (ISO) Reperfusion Injury (IEP,ISO) rhinitis (ISO) sagittal sinus thrombosis (ISO) sciatic neuropathy (IDA,IEP) Sepsis (ISO) sinusitis (ISO) Spinal Cord Injuries (ISO) squamous cell carcinoma (ISO) status epilepticus (IDA,IEP,ISO) steatotic liver disease (ISS) Stomach Neoplasms (ISO) Stroke (ISO) Strongylida Infections (IMP) Thromboembolism (ISO) thrombosis (IEP,ISO) transient cerebral ischemia (IDA,IEP) transitional cell carcinoma (ISO) Transplant Rejection (ISO) urinary bladder cancer (IDA,ISO) urolithiasis (ISO) Venous Thrombosis (ISO) Ventricular Fibrillation (ISO) Viral Myocarditis (ISO)
(+)-catechin (EXP,ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (ISO) 1,10-phenanthroline (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 1-octadec-9-enoylglycero-3-phosphate (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,3'-diindolylmethane (ISO) 3-[3-(tert-butylsulfanyl)-1-(4-chlorobenzyl)-5-(propan-2-yl)-1H-indol-2-yl]-2,2-dimethylpropanoic acid (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (ISO) acetaldehyde (EXP) acetamide (EXP) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) allyl isothiocyanate (ISO) alpha-D-galactose (EXP) alpha-Zearalanol (EXP) amiloride (ISO) amitrole (EXP) ammonium chloride (EXP) andrographolide (ISO) anethole (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (ISO) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) atorvastatin calcium (ISO) ATP (ISO) avobenzone (ISO) Azoxymethane (ISO) baicalein (ISO) Bardoxolone methyl (ISO) belinostat (ISO) benazepril (EXP) benomyl (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisdemethoxycurcumin (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) butan-1-ol (ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP) cadmium dichloride (EXP) capsaicin (ISO) captan (ISO) carbamazepine (ISO) carbendazim (ISO) carbofuran (EXP) carbon nanotube (ISO) casticin (ISO) chlordecone (ISO) chloropicrin (ISO) choline (ISO) chrysin (ISO) cisplatin (EXP,ISO) clofibric acid (EXP) clotrimazole (EXP) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) crocidolite asbestos (ISO) curcumin (ISO) cyclophosphamide (ISO) Cytochalasin H (ISO) D-glucose (ISO) DDE (ISO) demethoxycurcumin (ISO) desferrioxamine B (ISO) dexamethasone (EXP,ISO) dextran sulfate (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diclofenac (ISO) dieckol (ISO) diethyl phthalate (ISO) diisobutyl phthalate (ISO) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) dinophysistoxin 1 (ISO) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (EXP,ISO) entinostat (ISO) ethanol (EXP,ISO) etoposide (ISO) fenamidone (ISO) flavonol (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) furan (EXP) galactose (EXP) gefitinib (ISO) geldanamycin (ISO) gemcitabine (ISO) Genipin (ISO) genistein (EXP,ISO) glucose (ISO) graphene oxide (ISO) heparin (ISO) Hispolon (ISO) hyaluronic acid (ISO) ibuprofen (ISO) indole-3-methanol (ISO) indometacin (ISO) irinotecan (ISO) iron(III) nitrilotriacetate (ISO) isoprenaline (EXP) L-methionine (ISO) leflunomide (ISO) Licochalcone A (ISO) lidocaine (EXP) lipopolysaccharide (EXP,ISO) lithium chloride (ISO) lovastatin (ISO) LY294002 (ISO) malathion (ISO) mangiferin (EXP) medroxyprogesterone acetate (ISO) methimazole (EXP) methotrexate (ISO) methoxychlor (EXP) methylmercury chloride (ISO) mitomycin C (ISO) morin (ISO) N-acetyl-L-cysteine (ISO) N-nitrosodiethylamine (ISO) N-nitrosodimethylamine (EXP) N-tosyl-L-phenylalanyl chloromethyl ketone (ISO) nickel atom (ISO) nickel sulfate (ISO) nicotine (ISO) nonanedioic acid (ISO) notoginsenoside R1 (ISO) oleanolic acid (ISO) ornidazole (EXP) oxaliplatin (EXP) ozone (EXP,ISO) panobinostat (ISO) paraquat (EXP) PD 0325901 (ISO) pentane-2,3-dione (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (EXP) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) Phytolaccoside E (ISO) platycodin D (EXP) potassium chromate (ISO) progesterone (ISO) propanal (ISO) pyrrolidine dithiocarbamate (ISO) quercetin (EXP,ISO) rac-lactic acid (ISO) raloxifene (ISO) resveratrol (EXP,ISO) ryanodine (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) serpentine asbestos (ISO) silibinin (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) simvastatin (ISO) sodium arsenite (EXP,ISO) sodium dichromate (ISO) sodium hydroxide (ISO) sorafenib (ISO) streptozocin (EXP) succimer (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sulindac sulfide (ISO) sunitinib (ISO) tamoxifen (ISO) tebuconazole (ISO) telmisartan (EXP) temozolomide (ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) trans-anethole (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) troglitazone (ISO) trovafloxacin (ISO) tubocurarine (ISO) ursolic acid (ISO) valproic acid (ISO) vanadium atom (ISO) vanadium(0) (ISO) vincaleukoblastine (ISO) vorinostat (ISO) zinc atom (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
angiogenesis (IMP) cellular response to fluid shear stress (IEP) cellular response to glucose stimulus (IEP) cellular response to hepatocyte growth factor stimulus (IEP) cellular response to hypoxia (IEP) cellular response to lipopolysaccharide (IEP) cellular response to staurosporine (IEP) embryo implantation (IEP) fibrinolysis (IBA,IEA,ISO) plasminogen activation (IEA,ISO) positive regulation of cell migration (IEA,ISO) positive regulation of cell population proliferation (IMP) positive regulation of reactive oxygen species metabolic process (IDA) positive regulation of smooth muscle cell migration (IMP) proteolysis (IEA) regulation of cell adhesion (ISO) regulation of cell adhesion mediated by integrin (IBA,IEA,ISO) regulation of cell population proliferation (IEA,ISO) regulation of hepatocyte proliferation (IMP) regulation of signaling receptor activity (ISO) regulation of smooth muscle cell migration (IEA,ISO) regulation of smooth muscle cell-matrix adhesion (IEA,ISO) response to activity (IEP) response to hepatocyte growth factor (IEP) response to hyperoxia (IEP) response to hypoxia (IEA,ISO) skeletal muscle tissue regeneration (IMP) smooth muscle cell migration (IEA,ISO) spermatogenesis (IEP)
1.
Antineoplastic effect of iodine in mammary cancer: participation of 6-iodolactone (6-IL) and peroxisome proliferator-activated receptors (PPAR).
Aceves C, etal., Mol Cancer. 2009 Jun 6;8:33. doi: 10.1186/1476-4598-8-33.
2.
Deleterious effects of plasminogen activators in neonatal cerebral hypoxia-ischemia.
Adhami F, etal., Am J Pathol. 2008 Jun;172(6):1704-16. Epub 2008 May 8.
3.
Differences in the implantation rates of rat embryos developed in vivo and in vitro: possible role for plasminogen activators.
Aflalo ED, etal., Fertil Steril. 2004 Mar;81 Suppl 1:780-5.
4.
Therapeutic potential and anti-amyloidosis mechanisms of tert-butylhydroquinone for Alzheimer's disease.
Akhter H, etal., J Alzheimers Dis. 2011;26(4):767-78.
5.
Association between urokinase haplotypes and outcome from infection-associated acute lung injury.
Arcaroli J, etal., Intensive Care Med. 2008 Feb;34(2):300-7. Epub 2007 Nov 10.
6.
Activators and inhibitors of the plasminogen system in Alzheimer's disease.
Barker R, etal., J Cell Mol Med. 2012 Apr;16(4):865-76. doi: 10.1111/j.1582-4934.2011.01394.x.
7.
Transcriptional activation of endothelial cells by TGFbeta coincides with acute microvascular plasticity following focal spinal cord ischaemia/reperfusion injury.
Benton RL, etal., ASN Neuro. 2009 Aug 26;1(3). pii: e00015. doi: 10.1042/AN20090008.
8.
Urokinase-type plasminogen activator gene therapy in liver cirrhosis is mediated by collagens gene expression down-regulation and up-regulation of MMPs, HGF and VEGF.
Bueno M, etal., J Gene Med. 2006 Nov;8(11):1291-9.
9.
Protection of cerebral microvasculature after moderate hypothermia following experimental focal cerebral ischemia in mice.
Burk J, etal., Brain Res. 2008 Aug 21;1226:248-55. Epub 2008 Jun 16.
10.
Both tissue-type plasminogen activator and urokinase prevent intraabdominal abscess formation after surgical treatment of peritonitis in the rat.
Buyne OR, etal., Surgery. 2008 Jul;144(1):66-73. Epub 2008 May 21.
11.
Whole genome microarray of the major pelvic ganglion after cavernous nerve injury: new insights into molecular profile changes after nerve injury.
Calenda G, etal., BJU Int. 2012 May;109(10):1552-64. doi: 10.1111/j.1464-410X.2011.10705.x. Epub 2012 Feb 2.
12.
Hepatocyte growth factor (HGF) modulates Leydig cell extracellular matrix components.
Catizone A, etal., J Androl. 2010 May-Jun;31(3):306-13. doi: 10.2164/jandrol.109.007658. Epub 2009 Oct 15.
13.
Hepatocyte growth factor (HGF) regulates blood-testis barrier (BTB) in adult rats.
Catizone A, etal., Mol Cell Endocrinol. 2012 Jan 2;348(1):135-46. doi: 10.1016/j.mce.2011.07.050. Epub 2011 Aug 5.
14.
[Effects of Qinggan Huoxue Recipe and its separated recipes on urokinase-type plasminogen activator and plasminogen activator inhibitor-1 fibrinolytic system in rats with alcoholic liver fibrosis].
Chen JM, etal., Zhong Xi Yi Jie He Xue Bao. 2009 Jul;7(7):642-50. doi: 10.3736/jcim20090708.
15.
Intravesical administration of plasminogen activator inhibitor type-1 inhibits in vivo bladder tumor invasion and progression.
Chen SC, etal., J Urol. 2009 Jan;181(1):336-42. Epub 2008 Nov 17.
16.
Lipopolysaccharide upregulates uPA, MMP-2 and MMP-9 via ERK1/2 signaling in H9c2 cardiomyoblast cells.
Cheng YC, etal., Mol Cell Biochem. 2009 May;325(1-2):15-23. doi: 10.1007/s11010-008-0016-y. Epub 2009 Jan 28.
17.
Neuroprotection by urokinase plasminogen activator in the hippocampus.
Cho E, etal., Neurobiol Dis. 2012 Apr;46(1):215-24. Epub 2012 Jan 24.
18.
Association between urokinase-plasminogen activator gene T4065C polymorphism and risk of mitral valve prolapse.
Chou HT, etal., Int J Cardiol. 2004 Aug;96(2):165-70.
19.
Effects of losartan on hepatic expression of nonphagocytic NADPH oxidase and fibrogenic genes in patients with chronic hepatitis C.
Colmenero J, etal., Am J Physiol Gastrointest Liver Physiol. 2009 Oct;297(4):G726-34. Epub 2009 Jul 23.
20.
Selective abrogation of the uPA-uPAR interaction in vivo reveals a novel role in suppression of fibrin-associated inflammation.
Connolly BM, etal., Blood. 2010 Sep 2;116(9):1593-603. Epub 2010 May 13.
21.
No replication of genetic association between candidate polymorphisms and Alzheimer's disease.
Cousin E, etal., Neurobiol Aging. 2011 Aug;32(8):1443-51. Epub 2009 Nov 3.
22.
Thrombus versus Wall Biological Activities in Experimental Aortic Aneurysms.
Coutard M, etal., J Vasc Res. 2009 Dec 16;47(4):355-366.
23.
Macrophage-targeted overexpression of urokinase causes accelerated atherosclerosis, coronary artery occlusions, and premature death.
Cozen AE, etal., Circulation. 2004 May 4;109(17):2129-35. Epub 2004 Apr 19.
24.
Microglia and the urokinase plasminogen activator receptor/uPA system in innate brain inflammation.
Cunningham O, etal., Glia. 2009 Dec;57(16):1802-14.
25.
Urokinase-type plasminogen activator and arthritis progression: contrasting roles in systemic and monoarticular arthritis models.
De Nardo CM, etal., Arthritis Res Ther. 2010;12(5):R199. Epub 2010 Oct 25.
26.
Impaired fibrinolytic system in ApoE gene-deleted mice with hyperlipidemia augments deep vein thrombosis.
Diaz JA, etal., J Vasc Surg. 2012 Mar;55(3):815-22. Epub 2011 Nov 25.
27.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
28.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
29.
Effect of dietary beta carotene on cerebral aneurysm and subarachnoid haemorrhage in the brain apo E-/- mice.
Gopal K, etal., J Thromb Thrombolysis. 2011 Oct;32(3):343-55.
30.
An Antiangiogenic Urokinase-derived Peptide Combined with Tamoxifen Decreases Tumor Growth and Metastasis in a Syngeneic Model of Breast Cancer.
Guo Y, etal., Cancer Res 2002 Aug 15;62(16):4678-84.
31.
[Effect of amiloride on the pathology of a rat model of chronic obstructive pulmonary disease].
Han XD, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2007 May;30(5):363-7.
32.
Partial reversal of established bleomycin-induced pulmonary fibrosis by rh-urokinase in a rat model.
Hart DA, etal., Clin Invest Med. 1994 Apr;17(2):69-76.
33.
Urokinase-targeted fusion by oncolytic Sendai virus eradicates orthotopic glioblastomas by pronounced synergy with interferon-beta gene.
Hasegawa Y, etal., Mol Ther. 2010 Oct;18(10):1778-86. doi: 10.1038/mt.2010.138. Epub 2010 Jul 6.
34.
Transcriptional and posttranscriptional activation of urokinase plasminogen activator gene expression in metastatic tumor cells.
Henderson BR, etal., Cancer Res 1992 May 1;52(9):2489-96.
35.
Loss or inhibition of uPA or MMP-9 attenuates LV remodeling and dysfunction after acute pressure overload in mice.
Heymans S, etal., Am J Pathol. 2005 Jan;166(1):15-25.
36.
Fasudil, a Rho-kinase inhibitor, protects against excessive endurance exercise training-induced cardiac hypertrophy, apoptosis and fibrosis in rats.
Ho TJ, etal., Eur J Appl Physiol. 2012 Aug;112(8):2943-55. doi: 10.1007/s00421-011-2270-z. Epub 2011 Dec 9.
37.
Prognostic role of urokinase-type plasminogen activator in human gliomas.
Hsu DW, etal., Am J Pathol. 1995 Jul;147(1):114-23.
38.
Tissue-type plasminogen activator depletion affects the nasal mucosa matrix reconstruction in allergic rhinitis mice.
Hua H, etal., Allergol Immunopathol (Madr). 2011 Jul-Aug;39(4):206-11. doi: 10.1016/j.aller.2010.09.010. Epub 2011 Feb 19.
39.
Gene expression changes of urokinase plasminogen activator and urokinase receptor in rat testes at postnatal stages.
Huang DH, etal., Asian J Androl. 2007 Sep;9(5):679-83.
40.
Tumour-associated urokinase-type plasminogen activator (uPA) and its inhibitor PAI-1 in normal and neoplastic tissues of patients with squamous cell cancer of the oral cavity - clinical relevance and prognostic value.
Hundsdorfer B, etal., J Craniomaxillofac Surg. 2005 Jun;33(3):191-6. Epub 2005 Apr 22.
41.
Urokinase-type plasminogen activator system and human cationic antimicrobial protein 18 in serum and induced sputum of patients with chronic obstructive pulmonary disease.
Jiang Y, etal., Respirology. 2010 Aug;15(6):939-46. Epub 2010 Jul 6.
42.
Small, potent, and selective diaryl phosphonate inhibitors for urokinase-type plasminogen activator with in vivo antimetastatic properties.
Joossens J, etal., J Med Chem. 2007 Dec 27;50(26):6638-46. Epub 2007 Dec 1.
43.
Renal synthesis of urokinase type-plasminogen activator, its receptor, and plasminogen activator inhibitor-1 in diabetic nephropathy in rats: modulation by angiotensin-converting-enzyme inhibitor.
Kenichi M, etal., J Lab Clin Med. 2004 Aug;144(2):69-77.
44.
Localization of plasminogen activators in human colon cancer by immunoperoxidase staining.
Kohga S, etal., Cancer Res. 1985 Apr;45(4):1787-96.
45.
[Effects of acupoint-embedment of medicated-thread and acupoint-injection on expression of cortical urokinase-type plasminogen activator and plasminogen activator inhibitor-1 in rats with cerebral ischemia-reperfusion injury].
Kong LH, etal., Zhen Ci Yan Jiu. 2010 Dec;35(6):409-14.
46.
Plasminogen activator inhibitor-1 (PAI-1) and urokinase plasminogen activator (uPA) in sputum of allergic asthma patients.
Kowal K, etal., Folia Histochem Cytobiol. 2008;46(2):193-8.
47.
Increased expression and activity of urokinase-type plasminogen activator during epileptogenesis.
Lahtinen L, etal., Eur J Neurosci. 2006 Oct;24(7):1935-45. Epub 2006 Oct 16.
48.
Urokinase-type plasminogen activator regulates neurodegeneration and neurogenesis but not vascular changes in the mouse hippocampus after status epilepticus.
Lahtinen L, etal., Neurobiol Dis. 2010 Mar;37(3):692-703. Epub 2009 Dec 21.
49.
Expression of urokinase-type plasminogen activator receptor is increased during epileptogenesis in the rat hippocampus.
Lahtinen L, etal., Neuroscience. 2009 Sep 29;163(1):316-28. Epub 2009 Jun 12.
50.
Angiostrongylus cantonensis: induction of urokinase-type PA and degradation of type IV collagen in rat lung granulomatous fibrosis.
Lan KP and Lai SC, Exp Parasitol. 2008 Apr;118(4):472-7. Epub 2007 Oct 22.
51.
[Association of uPA and uPAR expression with invasive behaviors of urinary transitional cell carcinoma].
Li YJ, etal., Ai Zheng. 2004 Jun;23(6):704-6.
52.
Norrin attenuates protease-mediated death of transformed retinal ganglion cells.
Lin S, etal., Mol Vis. 2009;15:26-37. Epub 2009 Jan 12.
53.
Combination therapy of 17beta-estradiol and recombinant tissue plasminogen activator for experimental ischemic stroke.
Liu R, etal., J Pharmacol Exp Ther. 2010 Mar;332(3):1006-12. doi: 10.1124/jpet.109.160937. Epub 2009 Dec 1.
54.
[Changes of u-PA and PAI-1 expression in the lung tissue of neonatal rats after inhaling high concentration oxygen]
Liu XY and Xue XD, Zhonghua Er Ke Za Zhi. 2008 Jun;46(6):458-63.
55.
[Correlation of the content and expression of urokinase plasminogen activator with asthenospermia in rat models].
Liu Y, etal., Zhonghua Nan Ke Xue. 2008 Sep;14(9):786-91.
56.
Basic mechanisms and regulation of fibrinolysis.
Longstaff C and Kolev K, J Thromb Haemost. 2015 Jun;13 Suppl 1:S98-105. doi: 10.1111/jth.12935.
57.
Urokinase redistribution from the secreted to the cell-bound fraction in granulosa cells of rat preovulatory follicles.
Macchione E, etal., Biol Reprod. 2000 Apr;62(4):895-903.
58.
Association of Urokinase Gene 3'-UTR T/C polymorphism with bladder cancer.
Manchanda PK, etal., Urol Int. 2006;77(1):81-4.
59.
Multifunctionality of PAI-1 in fibrogenesis: evidence from obstructive nephropathy in PAI-1-overexpressing mice.
Matsuo S, etal., Kidney Int. 2005 Jun;67(6):2221-38.
60.
Urokinase plasminogen activator stimulates vascular smooth muscle cell proliferation via redox-dependent pathways.
Menshikov M, etal., Arterioscler Thromb Vasc Biol. 2006 Apr;26(4):801-7. Epub 2006 Feb 2.
61.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
62.
Elevation of urokinase-type plasminogen activator and its receptor densities as new predictors of disease progression and prognosis in men with prostate cancer.
Miyake H, etal., Int J Oncol. 1999 Mar;14(3):535-41.
63.
Downregulation of matrix metalloprotease-9 and urokinase plasminogen activator by TX-1877 results in decreased tumor growth and metastasis on xenograft model of rectal cancer.
Miyake K, etal., Cancer Chemother Pharmacol. 2009 Oct;64(5):885-92. doi: 10.1007/s00280-009-0937-5. Epub 2009 Feb 12.
64.
Identification of potential biomarkers of lymph node metastasis in oral squamous cell carcinoma by cDNA microarray analysis.
Nagata M, etal., Int J Cancer. 2003 Sep 20;106(5):683-9.
65.
Partial purification and characterization of epidermal plasminogen activator and their inhibitor.
Nakagawa M, etal., Chem Pharm Bull (Tokyo). 1989 Jul;37(7):1859-63.
66.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
67.
Immunohistochemical evidence of urokinase-type plasminogen activator in primary and metastatic tumors of pulmonary adenocarcinoma.
Oka T, etal., Cancer Res. 1991 Jul 1;51(13):3522-5.
68.
Cell surface-bound plasminogen regulates hepatocyte proliferation through a uPA-dependent mechanism.
Okumura N, etal., Biosci Biotechnol Biochem. 2007 Jun;71(6):1542-9.
69.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
70.
Association of urokinase gene 3'-UTR T/C polymorphism with calcium oxalate urolithiasis in children.
Ozturk M, etal., Int Urol Nephrol. 2008;40(3):563-8. doi: 10.1007/s11255-008-9335-x. Epub 2008 Feb 1.
71.
Blood brain barrier (BBB) dysfunction associated with increased expression of tissue and urokinase plasminogen activators following peripheral thermal injury.
Patel TH, etal., Neurosci Lett. 2008 Oct 31;444(3):222-6. Epub 2008 Aug 13.
72.
Identification of a novel biomarker signature associated with risk for bone metastasis in patients with renal cell carcinoma.
Paule B, etal., Int J Biol Markers. 2010 Apr-Jun;25(2):112-5.
73.
Hyperfibrinolysis, uPA/suPAR system, kynurenines, and the prevalence of cardiovascular disease in patients with chronic renal failure on conservative treatment.
Pawlak K, etal., Am J Med Sci. 2010 Jan;339(1):5-9.
74.
Urokinase-type plasminogen activator and metalloproteinase-2 are independently related to the carotid atherosclerosis in haemodialysis patients.
Pawlak K, etal., Thromb Res. 2008;121(4):543-8. Epub 2007 Aug 15.
75.
Effects of long-term erythropoietin therapy on fibrinolytic system in haemodialyzed patients.
Pawlak K, etal., Thromb Res. 2008;121(6):787-91. Epub 2007 Sep 14.
76.
Vascular endothelial growth factor and uPA/suPAR system in early and advanced chronic kidney disease patients: a new link between angiogenesis and hyperfibrinolysis?
Pawlak K, etal., Transl Res. 2012 Nov;160(5):346-54. doi: 10.1016/j.trsl.2012.04.004. Epub 2012 May 8.
77.
Fraxinus rhynchophylla ethanol extract attenuates carbon tetrachloride-induced liver fibrosis in rats via down-regulating the expressions of uPA, MMP-2, MMP-9 and TIMP-1.
Peng WH, etal., J Ethnopharmacol. 2010 Feb 17;127(3):606-13. Epub 2009 Dec 24.
78.
Involvement of urokinase-type plasminogen activator in sphingosylphosphorylcholine-induced angiogenesis.
Piao YJ, etal., Exp Dermatol. 2005 May;14(5):356-62.
79.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
80.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
81.
Momordica charantia leaf extract suppresses rat prostate cancer progression in vitro and in vivo.
Pitchakarn P, etal., Cancer Sci. 2010 Oct;101(10):2234-40. doi: 10.1111/j.1349-7006.2010.01669.x. Epub 2010 Aug 22.
82.
Urokinase plasminogen activator in injured adventitia increases the number of myofibroblasts and augments early proliferation.
Plekhanova OS, etal., J Vasc Res. 2006;43(5):437-46. Epub 2006 Aug 7.
83.
[Effects of shear stress on expression of plasminogen activator (tPA and uPA) in cultured kidney proximal tubular epithelial cells and its significance].
Pu L, etal., Sheng Wu Yi Xue Gong Cheng Xue Za Zhi. 2008 Dec;25(6):1319-21, 1343.
84.
[Effects of losartan on expressions of plasminogen activator and plasminogen activator inhibitor-1 of rat proximal tubular epithelial cells cultured with high glucose].
Pu LJ, etal., Sichuan Da Xue Xue Bao Yi Xue Ban. 2007 Sep;38(5):813-5.
85.
Proteins and carbohydrates in nipple aspirate fluid predict the presence of atypia and cancer in women requiring diagnostic breast biopsy.
Qin W, etal., BMC Cancer. 2012 Feb 1;12:52. doi: 10.1186/1471-2407-12-52.
86.
GOA pipeline
RGD automated data pipeline
87.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
88.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
89.
Expression of urokinase plasminogen activator and its receptor during acute renal allograft rejection.
Roelofs JJ, etal., Kidney Int. 2003 Nov;64(5):1845-53.
90.
Role of plasminogen activators during healing after uterine serosal lesioning in the rat.
Rout UK and Diamond MP, Fertil Steril 2003 Jan;79(1):138-45.
91.
Cerebrospinal fluid u-plasminogen activator and matrix metalloproteinase-9 levels in human eosinophilic meningitis associated with angiostrongyliasis.
Sanpool O, etal., Cytokine. 2010 Sep;51(3):294-7. Epub 2010 Jun 26.
92.
Plasminogen activator promotes recovery following spinal cord injury.
Seeds N, etal., Cell Mol Neurobiol. 2011 Aug;31(6):961-7. Epub 2011 May 14.
93.
The expression of fibrinolytic components in chronic paranasal sinus disease.
Sejima T, etal., Am J Rhinol Allergy. 2011 Jan-Feb;25(1):1-6.
94.
Urokinase and its receptor in follicular and inflammatory cysts of the jaws.
Serrati S, etal., Oral Dis. 2010 Nov;16(8):753-9. doi: 10.1111/j.1601-0825.2010.01679.x.
95.
Neuron Regeneration and Proliferation Effects of Danshen and Tanshinone IIA.
Shen JL, etal., Evid Based Complement Alternat Med. 2011;2011:378907. doi: 10.1155/2011/378907. Epub 2010 Dec 1.
96.
Association of polymorphisms in the genes of the urokinase plasminogen activation system with susceptibility to and severity of non-small cell lung cancer.
Shih CM, etal., Clin Chim Acta. 2011 Jan 14;412(1-2):194-8. Epub 2010 Oct 16.
97.
Inducible lung-specific urokinase expression reduces fibrosis and mortality after lung injury in mice.
Sisson TH, etal., Am J Physiol Lung Cell Mol Physiol. 2002 Nov;283(5):L1023-32.
98.
Differential regulation of urokinase-type plasminogen activator expression by fluid shear stress in human coronary artery endothelial cells.
Sokabe T, etal., Am J Physiol Heart Circ Physiol. 2004 Nov;287(5):H2027-34. Epub 2004 Jul 1.
99.
Progress of tissue injury in appendicitis involves the serine proteases uPA and PAI-1.
Solberg A, etal., Scand J Gastroenterol. 2009;44(5):579-84.
100.
Components of the plasminogen activator system and their complexes in renal cell and bladder cancer: comparison between normal and matched cancerous tissues.
Span PN, etal., BJU Int. 2008 Jul;102(2):177-82. doi: 10.1111/j.1464-410X.2008.07568.x. Epub 2008 Jul 1.
101.
uPA, uPAR and TGFbeta(1) expression during early and late post myocardial infarction period in rat myocardium.
Stavropoulou A, etal., In Vivo. 2010 Sep-Oct;24(5):647-52.
102.
Evaluation of a pediatric protocol of intrapleural urokinase for pleural empyema: a prospective study.
Stefanutti G, etal., Surgery. 2010 Sep;148(3):589-94. Epub 2010 Mar 20.
103.
Urokinase plasminogen activator induces smooth muscle cell migration: key role of growth factor-like domain.
Stepanova V, etal., FEBS Lett. 1997 Sep 8;414(2):471-4.
104.
Osteopontin: a fibrosis-related marker molecule in cardiac remodeling of enterovirus myocarditis in the susceptible host.
Szalay G, etal., Circ Res. 2009 Apr 10;104(7):851-9. doi: 10.1161/CIRCRESAHA.109.193805. Epub 2009 Feb 26.
105.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
106.
Matrix metalloproteinase-9 and urokinase plasminogen activator mediate interleukin-1-induced neurotoxicity.
Thornton P, etal., Mol Cell Neurosci. 2008 Jan;37(1):135-42. Epub 2007 Sep 12.
107.
Confronting complexity in late-onset Alzheimer disease: application of two-stage analysis approach addressing heterogeneity and epistasis.
Thornton-Wells TA, etal., Genet Epidemiol. 2008 Apr;32(3):187-203.
108.
Mutant prourokinase with adjunctive C1-inhibitor is an effective and safer alternative to tPA in rat stroke.
Tomasi S, etal., PLoS One. 2011;6(7):e21999. Epub 2011 Jul 14.
109.
Urokinase gene transfer augments angiogenesis in ischemic skeletal and myocardial muscle.
Traktuev DO, etal., Mol Ther. 2007 Nov;15(11):1939-46. Epub 2007 Jul 24.
110.
Urokinase gene 3'-UTR T/C polymorphism is associated with oral cancer.
Tsai MH, etal., J Clin Lab Anal. 2004;18(5):276-9.
111.
In papillary thyroid carcinoma BRAFV600E is associated with increased expression of the urokinase plasminogen activator and its cognate receptor, but not with disease-free interval.
Ulisse S, etal., Clin Endocrinol (Oxf). 2012 Nov;77(5):780-6. doi: 10.1111/j.1365-2265.2012.04465.x.
112.
Increased stratum corneum serine protease activity in acute eczematous atopic skin.
Voegeli R, etal., Br J Dermatol. 2009 Jul;161(1):70-7. Epub 2009 Mar 30.
113.
Coexpression of Smad7 and UPA attenuates carbon tetrachloride-induced rat liver fibrosis.
Wang B, etal., Med Sci Monit. 2012 Oct;18(10):BR394-401.
114.
Inhaled unfractionated heparin improves abnormalities of alveolar coagulation, fibrinolysis and inflammation in endotoxemia-induced lung injury rats.
Wang ZY, etal., Chin Med J (Engl). 2013 Jan;126(2):318-24.
115.
[Effect of inhalation of aerosolized unfractioned heparin on peri alveolar coagulability and inflammatory response in endotoxin induced acute lung injury rat model].
Wang ZY, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2011 Apr;23(4):239-42.
116.
[Curative machanism of Shenle capsule on 5/6 nephrectomy rats].
Wei RB, etal., Zhongguo Zhong Yao Za Zhi. 2004 Aug;29(8):770-3.
117.
Urokinase receptor is necessary for bacterial defense against pneumonia-derived septic melioidosis by facilitating phagocytosis.
Wiersinga WJ, etal., J Immunol. 2010 Mar 15;184(6):3079-86. Epub 2010 Feb 8.
118.
Expression of urokinase-type plasminogen activator and its receptor is up-regulated during tendon healing.
Xia W, etal., J Orthop Res. 2003 Sep;21(5):819-25.
119.
Effects of overtraining on skeletal muscle growth and gene expression.
Xiao W, etal., Int J Sports Med. 2012 Oct;33(10):846-53. Epub 2012 May 16.
120.
Association of putative functional variants in the PLAU gene and the PLAUR gene with myocardial infarction.
Xu J, etal., Clin Sci (Lond). 2010 Jul 9;119(8):353-9.
121.
[Effects of aerosolized earthworm fibrinolytic enzyme on bleomycin induced pulmonary fibrosis in rats].
Xue Y, etal., Zhonghua Yi Xue Za Zhi. 2012 Dec 25;92(48):3429-33.
122.
Possible involvement of urokinase-type plasminogen activator release from human peripheral blood lymphocytes in the pathophysiology of chronic allograft nephropathy.
Yamaguchi Y, etal., Transplant Proc. 2005 Dec;37(10):4276-81.
123.
Tissue plasminogen activator in primary afferents induces dorsal horn excitability and pain response after peripheral nerve injury.
Yamanaka H, etal., Eur J Neurosci. 2004 Jan;19(1):93-102.
124.
Therapeutic administration of plasminogen activator inhibitor-1 prevents hypoxic-ischemic brain injury in newborns.
Yang D, etal., J Neurosci. 2009 Jul 8;29(27):8669-74.
125.
Plasma soluble vascular endothelial growth factor receptor-1 levels predict outcomes of pneumonia-related septic shock patients: a prospective observational study.
Yang KY, etal., Crit Care. 2011 Jan 10;15(1):R11.
126.
The role and mechanism of the up-regulation of fibrinolytic activity in painful peripheral nerve injury.
Yong N and Guoping C, Neurochem Res. 2009 Mar;34(3):587-92. Epub 2008 Aug 21.
127.
A novel signaling pathway: fibroblast nicotinic receptor alpha1 binds urokinase and promotes renal fibrosis.
Zhang G, etal., J Biol Chem. 2009 Oct 16;284(42):29050-64. doi: 10.1074/jbc.M109.010249. Epub 2009 Aug 18.
128.
Evaluation of plasma urokinase-type plasminogen activator and urokinase-type plasminogen-activator receptor in patients with acute and chronic hepatitis B.
Zhou H, etal., Thromb Res. 2009;123(3):537-42. Epub 2008 Aug 8.
129.
Role of hypoxia-inducible factor-1 alpha in the regulation of plasminogen activator activity in rat knee joint chondrocytes.
Zhu G, etal., Osteoarthritis Cartilage. 2009 Nov;17(11):1494-502. doi: 10.1016/j.joca.2009.05.005. Epub 2009 May 19.
130.
Differential patterns of local gene regulation in crush lesions of the rat optic and sciatic nerve: relevance to posttraumatic regeneration.
Zickler P, etal., Cell Physiol Biochem. 2010;26(3):483-94. Epub 2010 Aug 24.
Plau Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 15 3,505,485 - 3,511,987 (-) NCBI GRCr8 mRatBN7.2 15 3,456,230 - 3,462,732 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 15 3,456,232 - 3,462,775 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 15 3,466,414 - 3,472,916 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 15 4,852,895 - 4,859,397 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 15 3,465,220 - 3,471,722 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 15 3,644,296 - 3,650,765 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 15 3,644,769 - 3,650,819 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 15 3,621,057 - 3,627,467 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 15 3,680,072 - 3,686,232 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 15 3,680,073 - 3,686,275 (-) NCBI Celera 15 1,129,191 - 1,135,694 (+) NCBI Celera Cytogenetic Map 15 p16 NCBI
PLAU Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 73,909,164 - 73,917,494 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 73,909,177 - 73,917,496 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 75,670,890 - 75,677,252 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 75,340,896 - 75,347,261 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 75,340,895 - 75,347,260 NCBI Celera 10 68,954,178 - 68,960,575 (+) NCBI Celera Cytogenetic Map 10 q22.2 NCBI HuRef 10 69,665,797 - 69,672,195 (+) NCBI HuRef CHM1_1 10 75,952,624 - 75,959,021 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 74,779,718 - 74,788,885 (+) NCBI T2T-CHM13v2.0
Plau Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 14 20,886,730 - 20,893,456 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 14 20,886,728 - 20,893,453 (+) Ensembl GRCm39 Ensembl GRCm38 14 20,836,662 - 20,843,388 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 14 20,836,660 - 20,843,385 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 14 21,655,884 - 21,662,610 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 14 19,625,259 - 19,631,940 (+) NCBI MGSCv36 mm8 Celera 14 17,217,270 - 17,223,995 (+) NCBI Celera Cytogenetic Map 14 A3 NCBI cM Map 14 11.53 NCBI
Plau Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 17,994,537 - 18,000,209 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 17,995,726 - 18,000,542 (-) NCBI ChiLan1.0 ChiLan1.0
PLAU Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 86,061,272 - 86,069,505 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 86,064,751 - 86,074,824 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 70,433,340 - 70,441,569 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 73,104,808 - 73,113,136 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 73,105,895 - 73,113,136 (+) Ensembl panpan1.1 panPan2
PLAU Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 24,329,139 - 24,333,893 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 24,328,925 - 24,334,851 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 24,466,425 - 24,471,181 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 24,609,212 - 24,613,966 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 24,578,978 - 24,727,745 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 24,506,511 - 24,511,263 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 24,706,941 - 24,711,694 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 25,061,896 - 25,066,649 (+) NCBI UU_Cfam_GSD_1.0
Plau Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 56,745,370 - 56,751,129 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 5,238,093 - 5,243,877 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 5,238,128 - 5,243,829 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PLAU Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 76,629,299 - 76,635,172 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 76,629,313 - 76,635,173 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 82,755,642 - 82,761,502 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 14 q24-q26 NCBI
PLAU Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 57,452,904 - 57,459,345 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 57,452,761 - 57,459,286 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 18,028,912 - 18,035,356 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Plau
.
Predicted Target Of
Count of predictions: 67 Count of miRNA genes: 55 Interacting mature miRNAs: 64 Transcripts: ENSRNOT00000014273 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641913 Colcr2 Colorectal carcinoma resistance QTL 2 6.57 0.0197 intestine integrity trait (VT:0010554) poorly differentiated malignant colorectal tumor number (CMO:0002076) 15 2266368 22711984 Rat 10401805 Kidm51 Kidney mass QTL 51 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 15 306329 45306329 Rat 5684946 Bss98 Bone structure and strength QTL 98 3.9 0.0026 tibia strength trait (VT:1000284) tibia ultimate force (CMO:0001734) 15 1058250 14481294 Rat 1354657 Despr13 Despair related QTL 13 0.0022 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 15 1 29912054 Rat 1641887 Alcrsp14 Alcohol response QTL 14 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 15 1 42356671 Rat 2298549 Neuinf12 Neuroinflammation QTL 12 3.5 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 15 1 55302115 Rat 731170 Pur3 Proteinuria QTL 3 2.3 0.0005 urine protein amount (VT:0005160) urine protein excretion rate (CMO:0000759) 15 1 41686771 Rat 8552920 Pigfal8 Plasma insulin-like growth factor 1 level QTL 8 3 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 15 1 34723002 Rat 738017 Hcas7 Hepatocarcinoma susceptibility QTL 7 2.91 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 15 2266368 46921453 Rat 8694361 Abfw6 Abdominal fat weight QTL 6 10.2 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 15 1 34723002 Rat 9589149 Insul29 Insulin level QTL 29 9.06 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 15 1 34723002 Rat
AU048556
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 15 3,461,133 - 3,461,294 (+) MAPPER mRatBN7.2 Rnor_6.0 15 3,649,167 - 3,649,327 NCBI Rnor6.0 Rnor_5.0 15 3,625,869 - 3,626,029 UniSTS Rnor5.0 RGSC_v3.4 15 3,684,634 - 3,684,794 UniSTS RGSC3.4 Celera 15 1,130,629 - 1,130,791 UniSTS Cytogenetic Map 15 p16 UniSTS
RH94858
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 3,505,578 - 3,505,800 (+) Marker Load Pipeline Celera 15 1,135,376 - 1,135,600 UniSTS Cytogenetic Map 15 p16 UniSTS
RH94873
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 3,506,111 - 3,506,323 (+) Marker Load Pipeline Celera 15 1,134,857 - 1,135,067 UniSTS Cytogenetic Map 15 p16 UniSTS
RH136861
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 15 3,505,600 - 3,505,802 (+) Marker Load Pipeline Celera 15 1,135,374 - 1,135,578 UniSTS RH 3.4 Map 15 48.7 UniSTS Cytogenetic Map 15 p16 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000014273 ⟹ ENSRNOP00000014273
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 3,456,232 - 3,462,775 (-) Ensembl Rnor_6.0 Ensembl 15 3,644,769 - 3,650,819 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097501 ⟹ ENSRNOP00000077608
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 3,456,805 - 3,462,775 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106260 ⟹ ENSRNOP00000085383
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 15 3,456,232 - 3,462,355 (-) Ensembl
RefSeq Acc Id:
NM_013085 ⟹ NP_037217
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 15 3,505,485 - 3,511,987 (-) NCBI mRatBN7.2 15 3,456,230 - 3,462,732 (-) NCBI Rnor_6.0 15 3,644,296 - 3,650,765 (-) NCBI Rnor_5.0 15 3,621,057 - 3,627,467 (-) NCBI RGSC_v3.4 15 3,680,072 - 3,686,232 (-) RGD Celera 15 1,129,191 - 1,135,694 (+) RGD
Sequence:
TGCCGGCGCCCTTCCGCTGCAGTCACCGAACTGCTGTCTAGAGAGAGCCCAGCGTCAGTACCATGAGAGTCTGGCTTGCGAGCCTGTTCCTCTGCGCCTTGGTGGCGCACTCTGAAGGTGGCAGTGAA
hide sequence
RefSeq Acc Id:
NP_037217 ⟸ NM_013085
- Peptide Label:
precursor
- UniProtKB:
Q6LBK5 (UniProtKB/Swiss-Prot), P29598 (UniProtKB/Swiss-Prot), Q3KR76 (UniProtKB/TrEMBL), A6KKR2 (UniProtKB/TrEMBL), F7F966 (UniProtKB/TrEMBL)
- Sequence:
MRVWLASLFLCALVAHSEGGSELGASDESNCGCQNGGVCVSYKYFSSIRRCSCPKKFKGEHCEIDTSKTCYHGNGQSYRGKANTDTKGRPCLAWNSPAVLQQTYNAHRSDALSLGLGKHNYCRNPDNQ
hide sequence
Ensembl Acc Id:
ENSRNOP00000014273 ⟸ ENSRNOT00000014273
Ensembl Acc Id:
ENSRNOP00000085383 ⟸ ENSRNOT00000106260
Ensembl Acc Id:
ENSRNOP00000077608 ⟸ ENSRNOT00000097501
RGD ID: 13699556 Promoter ID: EPDNEW_R10078 Type: single initiation site Name: Plau_1 Description: plasminogen activator, urokinase SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 15 3,650,810 - 3,650,870 EPDNEW
BioCyc Gene G2FUF-14565 BioCyc
Ensembl Genes ENSRNOG00000010516 Ensembl, UniProtKB/TrEMBL
Ensembl Transcript ENSRNOT00000014273.6 UniProtKB/TrEMBL
ENSRNOT00000097501.1 UniProtKB/TrEMBL
ENSRNOT00000106260.1 UniProtKB/TrEMBL
Gene3D-CATH 2.40.10.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
2.40.20.10 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Laminin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE IMAGE:7456771 IMAGE-MGC_LOAD
InterPro EGF-like_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Kringle UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Kringle-like UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Kringle_CS UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Kringle_sf UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Peptidase_S1_PA UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Peptidase_S1_PA_chymotrypsin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Peptidase_S1A UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Serine_Proteases_S1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Trypsin_dom UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TRYPSIN_SER UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report rno:25619 UniProtKB/TrEMBL
MGC_CLONE MGC:124931 IMAGE-MGC_LOAD
NCBI Gene 25619 ENTREZGENE
PANTHER PTHR24264:SF38 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TRYPSIN-RELATED UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam Kringle UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Trypsin UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen Plau PhenoGen
PRINTS CHYMOTRYPSIN UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KRINGLE UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE EGF_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
EGF_3 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KRINGLE_1 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KRINGLE_2 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TRYPSIN_DOM UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TRYPSIN_SER UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx ENSRNOG00000010516 RatGTEx
SMART SM00130 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Tryp_SPc UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP SSF50494 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF57440 UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR TC232485
UniProt A0A8I5ZKC2_RAT UniProtKB/TrEMBL
A0A8I5ZZ41_RAT UniProtKB/TrEMBL
A6KKR2 ENTREZGENE, UniProtKB/TrEMBL
F7F966 ENTREZGENE, UniProtKB/TrEMBL
P29598 ENTREZGENE
Q3KR76 ENTREZGENE
Q6LBK5 ENTREZGENE
UROK_RAT UniProtKB/Swiss-Prot
UniProt Secondary Q3KR76 UniProtKB/TrEMBL
Q6LBK5 UniProtKB/Swiss-Prot
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Plau
Urinary plasminogen activator, urokinase
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_cellular_localization
secreted as a single chain zymogen with low or no intrinsic enzyme activity
625460
gene_disease
expression associated with increased tumor-cell invasion, angiogenesis and metastasis in several malignancies including breast cancer
625460
gene_disease
plays a key role in degrading the extracellular matrix and basement membrane in various cancers (such as breast and prostate cancers)
625460
gene_regulation
following enzymatic cleavage by plasmin, is converted to the active HMW-uPA comprised of an A-chain and the low molecular-weight uPA which contains the catalytic activity for extracellular matrix degradation
625460
